NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089577

Metagenome / Metatranscriptome Family F089577

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089577
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 47 residues
Representative Sequence GGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.75 %
% of genes near scaffold ends (potentially truncated) 96.33 %
% of genes from short scaffolds (< 2000 bps) 89.91 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.523 % of family members)
Environment Ontology (ENVO) Unclassified
(37.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.86%    β-sheet: 11.43%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00210Ferritin 37.61
PF00027cNMP_binding 30.28
PF13738Pyr_redox_3 6.42
PF00041fn3 1.83
PF08031BBE 1.83
PF01828Peptidase_A4 0.92
PF00196GerE 0.92
PF01494FAD_binding_3 0.92
PF09438DUF2017 0.92
PF01734Patatin 0.92
PF08281Sigma70_r4_2 0.92
PF04542Sigma70_r2 0.92
PF04250DUF429 0.92
PF13579Glyco_trans_4_4 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.83
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.83
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.92
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.92
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.92
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.92
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.92
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.92
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.92
COG2410Predicted nuclease (RNAse H fold)General function prediction only [R] 0.92
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.92
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.92
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.25 %
UnclassifiedrootN/A2.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000652|ARCol0yngRDRAFT_1019060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium530Open in IMG/M
3300001361|A30PFW6_1163236All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300003911|JGI25405J52794_10167966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium503Open in IMG/M
3300004157|Ga0062590_100040984All Organisms → cellular organisms → Bacteria2470Open in IMG/M
3300004463|Ga0063356_104493275All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300004479|Ga0062595_102272276All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300004643|Ga0062591_102083316All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300005168|Ga0066809_10129748All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300005187|Ga0066675_11198892All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005331|Ga0070670_101269065All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005335|Ga0070666_10525565All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005341|Ga0070691_10102274All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300005367|Ga0070667_101880143All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300005440|Ga0070705_100073939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. ES.0102070Open in IMG/M
3300005444|Ga0070694_100874385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium741Open in IMG/M
3300005546|Ga0070696_101162335All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300005546|Ga0070696_101977783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium506Open in IMG/M
3300005548|Ga0070665_102194541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium556Open in IMG/M
3300005578|Ga0068854_100533281All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300006046|Ga0066652_101451935All Organisms → cellular organisms → Bacteria → Terrabacteria group639Open in IMG/M
3300006577|Ga0074050_12085271All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300006755|Ga0079222_11940313All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300006804|Ga0079221_10450923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300006854|Ga0075425_102426319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium581Open in IMG/M
3300009012|Ga0066710_104125225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300009137|Ga0066709_100129384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3176Open in IMG/M
3300009148|Ga0105243_11653081All Organisms → cellular organisms → Bacteria → Terrabacteria group668Open in IMG/M
3300009148|Ga0105243_12024414All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300009156|Ga0111538_12917104All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300009156|Ga0111538_13629197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium535Open in IMG/M
3300009162|Ga0075423_12681970All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300010046|Ga0126384_11006933All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300010145|Ga0126321_1328252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium513Open in IMG/M
3300010145|Ga0126321_1341557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium684Open in IMG/M
3300010329|Ga0134111_10487378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300010398|Ga0126383_12359162All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010400|Ga0134122_11152399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium772Open in IMG/M
3300010403|Ga0134123_11647923All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300010999|Ga0138505_100070664All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300011003|Ga0138514_100004007All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300011003|Ga0138514_100044469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium881Open in IMG/M
3300011003|Ga0138514_100070628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300012011|Ga0120152_1014567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3176Open in IMG/M
3300012212|Ga0150985_110972721Not Available648Open in IMG/M
3300012285|Ga0137370_10603158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300012507|Ga0157342_1023028All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300012884|Ga0157300_1073538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium584Open in IMG/M
3300012891|Ga0157305_10272254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium519Open in IMG/M
3300012916|Ga0157310_10343978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium601Open in IMG/M
3300012937|Ga0162653_100073428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium554Open in IMG/M
3300012977|Ga0134087_10095876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1236Open in IMG/M
3300013105|Ga0157369_12063659All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300013307|Ga0157372_12842400All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300013772|Ga0120158_10007768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10455Open in IMG/M
3300014497|Ga0182008_10724636All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300014829|Ga0120104_1133146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300015201|Ga0173478_10194540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium845Open in IMG/M
3300015372|Ga0132256_100155900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2297Open in IMG/M
3300015374|Ga0132255_105573216All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300017947|Ga0187785_10458000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300017965|Ga0190266_10932122Not Available574Open in IMG/M
3300018032|Ga0187788_10383589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300019878|Ga0193715_1089431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300020004|Ga0193755_1214217All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300020070|Ga0206356_11832224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300021344|Ga0193719_10064574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1589Open in IMG/M
3300021445|Ga0182009_10105925All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300022756|Ga0222622_10555093All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300023071|Ga0247752_1013264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300024254|Ga0247661_1098247All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025910|Ga0207684_10606662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300025920|Ga0207649_11302946All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300025935|Ga0207709_11016351All Organisms → cellular organisms → Bacteria → Terrabacteria group678Open in IMG/M
3300026035|Ga0207703_11342577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300026300|Ga0209027_1316479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300026552|Ga0209577_10624046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rupiterrae634Open in IMG/M
3300026807|Ga0207547_106811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium523Open in IMG/M
3300026808|Ga0207581_102940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium509Open in IMG/M
3300027718|Ga0209795_10236673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium511Open in IMG/M
3300028719|Ga0307301_10007028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3149Open in IMG/M
3300028719|Ga0307301_10021790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1878Open in IMG/M
3300028720|Ga0307317_10227420All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300028721|Ga0307315_10175318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium658Open in IMG/M
3300028787|Ga0307323_10377690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium507Open in IMG/M
3300028793|Ga0307299_10019416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2433Open in IMG/M
3300028793|Ga0307299_10353173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales551Open in IMG/M
3300028799|Ga0307284_10415370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium548Open in IMG/M
3300028807|Ga0307305_10186641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium955Open in IMG/M
3300028810|Ga0307294_10011012All Organisms → cellular organisms → Bacteria2245Open in IMG/M
3300028811|Ga0307292_10465884All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300028814|Ga0307302_10147835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1137Open in IMG/M
3300028885|Ga0307304_10051157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1530Open in IMG/M
3300028885|Ga0307304_10210814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300030511|Ga0268241_10047967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300030785|Ga0102757_11443465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300031058|Ga0308189_10442800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium547Open in IMG/M
3300031092|Ga0308204_10147747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium695Open in IMG/M
3300031092|Ga0308204_10155809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium681Open in IMG/M
3300031092|Ga0308204_10265011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium562Open in IMG/M
3300031114|Ga0308187_10210421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300031114|Ga0308187_10241424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium652Open in IMG/M
3300031226|Ga0307497_10553247All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031720|Ga0307469_11615112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium623Open in IMG/M
3300031854|Ga0310904_10653806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales723Open in IMG/M
3300031938|Ga0308175_100008936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7403Open in IMG/M
3300031995|Ga0307409_100961217All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300032126|Ga0307415_101075593Not Available752Open in IMG/M
3300032261|Ga0306920_102455656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300034680|Ga0370541_036699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium607Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.59%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.92%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000652Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNAHost-AssociatedOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026807Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026808Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ARCol0yngRDRAFT_101906023300000652Arabidopsis RhizosphereWTPPTRGQHVCIVVKAGADPVLVSHGDDSGPKRLRFSAEDSYQRRHGHGDAVFLSAF*
A30PFW6_116323613300001361PermafrostVVWTPPSRGQHVCIVVAGGPDPMLVSHGDPSGPKRLRFSAERGYQRRNGHGNPVWLSAF*
JGI25405J52794_1016796623300003911Tabebuia Heterophylla RhizosphereDPLLVSHGDESGPKKLRFSAEDAYQRRHGHGTAVWLSAF*
Ga0062590_10004098443300004157SoilVVWTPPTRGQHVCIVVKAGADPVLVSHGDDTGPKRLRFSAEDSYQRRHGHGNAVFLSVF*
Ga0063356_10449327523300004463Arabidopsis Thaliana RhizospherePSTGQHVCLVVSGGADPLLVSHGSDSGPLKIRFSDEDAYQRRAGHGTAIFLSVF*
Ga0062595_10227227623300004479SoilGGADPMLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0062591_10208331613300004643SoilQHVCVVVTPGADPMLISHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0066809_1012974813300005168SoilVVAPGADPVLVSHGDESGPKRLRFSAEDAYQRRHGHGTAVWLTAF*
Ga0066675_1119889213300005187SoilCVVVKGGSDPMLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF*
Ga0070670_10126906533300005331Switchgrass RhizosphereDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0070666_1052556533300005335Switchgrass RhizosphereGDLVVWTPPGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF*
Ga0070691_1010227443300005341Corn, Switchgrass And Miscanthus RhizosphereDLVVWTPPTRGQHVCIVVKPGADPMLVSHGDDSGPKRLRFSAEDRYQRRHGHGSPVFLSAF*
Ga0070667_10188014323300005367Switchgrass RhizospherePGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF*
Ga0070705_10007393923300005440Corn, Switchgrass And Miscanthus RhizosphereSGGADPMLVSHGDDTGPNRVRFSAEDRSQQRRGHGMAVWLSAF*
Ga0070694_10087438523300005444Corn, Switchgrass And Miscanthus RhizosphereGDLVVWTPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAENGYQRRHGHGSPVFLSAF*
Ga0070696_10116233513300005546Corn, Switchgrass And Miscanthus RhizosphereGDLVVWTPPGAGQHVCVVVAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0070696_10197778323300005546Corn, Switchgrass And Miscanthus RhizospherePTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF*
Ga0070665_10219454113300005548Switchgrass RhizosphereADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVFLSAF*
Ga0068854_10053328113300005578Corn RhizosphereMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0066652_10145193523300006046SoilTGQHVCLVVSGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0074050_1208527113300006577SoilAGTDPLLVSHGDESGPKRLRFSAEDAYQRRNGHGTAVWLTAF*
Ga0079222_1194031313300006755Agricultural SoilQHVCVVIQGGADPLLVSHGDDTGPKKLRFSAEDAYQRQHGHGTSVWLTAF*
Ga0079221_1045092313300006804Agricultural SoilVAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0075425_10242631913300006854Populus RhizosphereIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0066710_10412522523300009012Grasslands SoilLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF
Ga0066709_10012938463300009137Grasslands SoilVVVKGGSDPMLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF*
Ga0105243_1165308113300009148Miscanthus RhizosphereTPPGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0105243_1202441423300009148Miscanthus RhizosphereMLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0111538_1291710423300009156Populus RhizosphereQHVCLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0111538_1362919723300009156Populus RhizosphereCIVVKAGADPVLVSHGDDTGPKRLRFSAEDGYQRRHGHGNAVFLSAF*
Ga0075423_1268197013300009162Populus RhizosphereSSGGADPTLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTVF*
Ga0126384_1100693313300010046Tropical Forest SoilVVWTPPAQGQHVCLVVQGGADPLLVSHGDDTGPKKLRFSAEDAYQRKHGHGTAVWLTVF*
Ga0126321_132825223300010145SoilSHGDDSGPKRLRFSVEDGYQRRNGHGTAVWLTVF*
Ga0126321_134155713300010145SoilRVGQHVCVVVAGGADPLLVSHGDDSGPKKLRFSGEDAYQRRHGHGTVVWLSAF*
Ga0134111_1048737813300010329Grasslands SoilPMLVSHGDNTGPKRVRFSAENASPRRNGHGTTVWLTAF*
Ga0126383_1235916233300010398Tropical Forest SoilGDLVVWTPPSQGQHVCLVVQGGADPLLVSHGDDSGPKKLRFSAEDAYQRKHGHGTAVWLTVF*
Ga0134122_1115239923300010400Terrestrial SoilVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDRYQRRHGHGSPVFLSAF*
Ga0134123_1164792333300010403Terrestrial SoilGADPVLVSHGDDTGPKKLRFWAEDAYQRSHGHGTAIWLTVF*
Ga0138505_10007066413300010999SoilVVVAAGPDPMLVSHGSDSGPKRLRFSAEDAYQRRHGHGNVVWLSAF*
Ga0138514_10000400733300011003SoilLVVWTPASRGHHVCLVVKPGADPTLVSHGDPSGPKHLHFTAEDRSQRRNGHGTAVWLTAF
Ga0138514_10004446923300011003SoilVTPGTDPMLVSHGDDTGPKRVRFSAEDRSQRRRGHGTAVWLTAF*
Ga0138514_10007062813300011003SoilPMLVSHGDPSGPKRLRFSAEDAYQRRNGHGTSVWLTAF*
Ga0120152_101456753300012011PermafrostGPDRMLVSHGDPSGPRRLRFSAERGYQRRNGHGNAVWLSAF*
Ga0150985_11097272113300012212Avena Fatua RhizospherePDPWLVSHGSDAGPKKLRFSAENAYQAAHGHGTVTWLSAFPA*
Ga0137370_1060315813300012285Vadose Zone SoilVVWTTPSRGQHVAVVVAGGTDPMLVSHGDDTGPKRLRFSAEDASQRRRGHGTAVWLTAF*
Ga0157342_102302813300012507Arabidopsis RhizosphereQGQHVCLVVQAGADPVLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTVF*
Ga0157300_107353813300012884SoilCLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0157305_1027225423300012891SoilGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0157310_1034397813300012916SoilHVCLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0162653_10007342823300012937SoilGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF*
Ga0134087_1009587613300012977Grasslands SoilLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF*
Ga0157369_1206365913300013105Corn RhizosphereVCVVVAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0157372_1284240023300013307Corn RhizosphereGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0120158_1000776813300013772PermafrostDPMLVSHGDPSGPKRLRFSAERGYQRRNGHGNPVWLSAF*
Ga0182008_1072463613300014497RhizospherePMLISHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF*
Ga0120104_113314613300014829PermafrostMLVSHGDASGPKQLRFSAEDAYQRRHGHRTTVWLSAF
Ga0173478_1019454013300015201SoilPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF*
Ga0132256_10015590043300015372Arabidopsis RhizosphereQHVCLVVAGGADPLLVSHGDDSGPKKLRFSAEDAYQRRHGHGTAVWLSAF*
Ga0132255_10557321623300015374Arabidopsis RhizosphereVVSLGADPWLVSHGDDSGPRKIRFSDEDASQRRHGHGTVTWLSAF*
Ga0187785_1045800013300017947Tropical PeatlandDEGQHVCIVVAAGPDPWLVSHGDHSGPKKLRFSAEDASQRRNGHTTATWLSAF
Ga0190266_1093212223300017965SoilVSHGGESGPLKIRFSAEDSWQRTHGHHTAIWLTAF
Ga0187788_1038358913300018032Tropical PeatlandPNPWLVSHGDHSGPKKLRFSAEDTSQQRNGHTAATWLSAF
Ga0193715_108943113300019878SoilVVVKGGSDPMLVSHGDPSGPKQLRFSAEDRYQRRNGHGTTVWLTAF
Ga0193755_121421723300020004SoilMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF
Ga0206356_1183222423300020070Corn, Switchgrass And Miscanthus RhizosphereVCLVVQGGADPLLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVFLTVF
Ga0193719_1006457433300021344SoilGGADPILISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF
Ga0182009_1010592513300021445SoilVVAGGADPMLVSHGDDIGPKKLRFSAEDAYQRSHGHGTAVWLSAF
Ga0222622_1055509333300022756Groundwater SedimentLVVSGGPDPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF
Ga0247752_101326433300023071SoilVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF
Ga0247661_109824713300024254SoilWTPPSQGQHVCLVVQGGADPVLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAIWLTVF
Ga0207684_1060666223300025910Corn, Switchgrass And Miscanthus RhizosphereIVVSHGDDSGPKRLRFSAEDASQRRGGHGTSVWLTAF
Ga0207649_1130294613300025920Corn RhizosphereLVVQAGADPVLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF
Ga0207709_1101635113300025935Miscanthus RhizosphereRGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF
Ga0207703_1134257733300026035Switchgrass RhizosphereGGSDPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAIWLTAF
Ga0209027_131647923300026300Grasslands SoilVVVTGGADPMLVSHGDDTGPKRVRFSAENASQRRNGHGTAVWLTAF
Ga0209577_1062404623300026552SoilLVSHGDDTGPKRLRFSAEDASQRRRGHGTAVWLTAF
Ga0207547_10681113300026807SoilGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF
Ga0207581_10294023300026808SoilLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF
Ga0209795_1023667323300027718AgaveTPPRSGQHVALVVNAADDPLLVSHGDDSGPKKLRFSAEQASQRRRGHGTAVWLSAF
Ga0307301_1000702813300028719SoilGDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF
Ga0307301_1002179033300028719SoilVWTPPGRGQHVCVVVAAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF
Ga0307317_1022742033300028720SoilSGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF
Ga0307315_1017531813300028721SoilPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0307323_1037769013300028787SoilGTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF
Ga0307299_1001941613300028793SoilVAAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF
Ga0307299_1035317313300028793SoilPGDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF
Ga0307284_1041537013300028799SoilPPGLGQHVCLVVAGGADPMLISHGDDSGPKRLRFSAEDAYQRRNGHGTAVWLTVF
Ga0307305_1018664113300028807SoilRGQHVCIVVTPGADPMLVSHGDNSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0307294_1001101213300028810SoilADPILISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF
Ga0307292_1046588423300028811SoilAAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF
Ga0307302_1014783513300028814SoilMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0307304_1005115713300028885SoilGDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSSEDSYQRRHGHGTAVWLSAF
Ga0307304_1021081413300028885SoilDPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF
Ga0268241_1004796733300030511SoilVVWTPPSRGQHVCVVVAAGPDPLLVSHGDDTGPKKLRFSAEDAYQRRHGHGTAVFLSAF
Ga0102757_1144346523300030785SoilPMLISHGDDSGPKRLRFSAEDAYQRRNGHGTAVWLTVF
Ga0308189_1044280013300031058SoilPGTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF
Ga0308204_1014774723300031092SoilVVWTPPTRGQHVCIVVTPGTDPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0308204_1015580913300031092SoilPPGTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF
Ga0308204_1026501123300031092SoilGDLVVWTPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0308187_1021042113300031114SoilTPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF
Ga0308187_1024142423300031114SoilLVVSGGADPMLISHGDDTGPKRLRFSAEDAYQRRNGHGTAVWLTVF
Ga0307497_1055324713300031226SoilVCLVVSAGADPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF
Ga0307469_1161511213300031720Hardwood Forest SoilVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF
Ga0310904_1065380633300031854SoilPGDLVVWTPPGTGQHVCLVISGGADPMLVSHGDDTGPKKLRFSAEDAYQRTHGHGTAIWLSAF
Ga0308175_10000893633300031938SoilMLVSHGDGSGSTRLRFSAEDGYRRRHGHGNPVFPSAF
Ga0307409_10096121723300031995RhizosphereTGQHVCLVVSGGSDPMLVSHGSDSGPLKIRFSDEDAYQRRAGHGTAIFLSAF
Ga0307415_10107559323300032126RhizosphereIQGGADPLLVSHGDDSGPKKLRFSAEDAYQRRHGHGTPIWLSAF
Ga0306920_10245565623300032261SoilGTHVVIVVQPGADPVVVSHGDDTGPKKLAFSAEDAYHRQHGSGTAVYLTAF
Ga0370541_036699_489_6023300034680SoilMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.