Basic Information | |
---|---|
Family ID | F089577 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 47 residues |
Representative Sequence | GGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.75 % |
% of genes near scaffold ends (potentially truncated) | 96.33 % |
% of genes from short scaffolds (< 2000 bps) | 89.91 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.248 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.523 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.615 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.872 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.86% β-sheet: 11.43% Coil/Unstructured: 75.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF00210 | Ferritin | 37.61 |
PF00027 | cNMP_binding | 30.28 |
PF13738 | Pyr_redox_3 | 6.42 |
PF00041 | fn3 | 1.83 |
PF08031 | BBE | 1.83 |
PF01828 | Peptidase_A4 | 0.92 |
PF00196 | GerE | 0.92 |
PF01494 | FAD_binding_3 | 0.92 |
PF09438 | DUF2017 | 0.92 |
PF01734 | Patatin | 0.92 |
PF08281 | Sigma70_r4_2 | 0.92 |
PF04542 | Sigma70_r2 | 0.92 |
PF04250 | DUF429 | 0.92 |
PF13579 | Glyco_trans_4_4 | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.83 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.83 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.92 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.92 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.92 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.92 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.92 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.92 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.92 |
COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.92 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.92 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.92 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.25 % |
Unclassified | root | N/A | 2.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000652|ARCol0yngRDRAFT_1019060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 530 | Open in IMG/M |
3300001361|A30PFW6_1163236 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300003911|JGI25405J52794_10167966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 503 | Open in IMG/M |
3300004157|Ga0062590_100040984 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300004463|Ga0063356_104493275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300004479|Ga0062595_102272276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300004643|Ga0062591_102083316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
3300005168|Ga0066809_10129748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300005187|Ga0066675_11198892 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005331|Ga0070670_101269065 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300005335|Ga0070666_10525565 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300005341|Ga0070691_10102274 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300005367|Ga0070667_101880143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
3300005440|Ga0070705_100073939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. ES.010 | 2070 | Open in IMG/M |
3300005444|Ga0070694_100874385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 741 | Open in IMG/M |
3300005546|Ga0070696_101162335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
3300005546|Ga0070696_101977783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 506 | Open in IMG/M |
3300005548|Ga0070665_102194541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 556 | Open in IMG/M |
3300005578|Ga0068854_100533281 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300006046|Ga0066652_101451935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 639 | Open in IMG/M |
3300006577|Ga0074050_12085271 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300006755|Ga0079222_11940313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300006804|Ga0079221_10450923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300006854|Ga0075425_102426319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 581 | Open in IMG/M |
3300009012|Ga0066710_104125225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300009137|Ga0066709_100129384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3176 | Open in IMG/M |
3300009148|Ga0105243_11653081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300009148|Ga0105243_12024414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
3300009156|Ga0111538_12917104 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300009156|Ga0111538_13629197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 535 | Open in IMG/M |
3300009162|Ga0075423_12681970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300010046|Ga0126384_11006933 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300010145|Ga0126321_1328252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 513 | Open in IMG/M |
3300010145|Ga0126321_1341557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 684 | Open in IMG/M |
3300010329|Ga0134111_10487378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
3300010398|Ga0126383_12359162 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010400|Ga0134122_11152399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 772 | Open in IMG/M |
3300010403|Ga0134123_11647923 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300010999|Ga0138505_100070664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
3300011003|Ga0138514_100004007 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
3300011003|Ga0138514_100044469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 881 | Open in IMG/M |
3300011003|Ga0138514_100070628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
3300012011|Ga0120152_1014567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3176 | Open in IMG/M |
3300012212|Ga0150985_110972721 | Not Available | 648 | Open in IMG/M |
3300012285|Ga0137370_10603158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300012507|Ga0157342_1023028 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012884|Ga0157300_1073538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 584 | Open in IMG/M |
3300012891|Ga0157305_10272254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 519 | Open in IMG/M |
3300012916|Ga0157310_10343978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 601 | Open in IMG/M |
3300012937|Ga0162653_100073428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 554 | Open in IMG/M |
3300012977|Ga0134087_10095876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1236 | Open in IMG/M |
3300013105|Ga0157369_12063659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300013307|Ga0157372_12842400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300013772|Ga0120158_10007768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10455 | Open in IMG/M |
3300014497|Ga0182008_10724636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300014829|Ga0120104_1133146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300015201|Ga0173478_10194540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 845 | Open in IMG/M |
3300015372|Ga0132256_100155900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2297 | Open in IMG/M |
3300015374|Ga0132255_105573216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300017947|Ga0187785_10458000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300017965|Ga0190266_10932122 | Not Available | 574 | Open in IMG/M |
3300018032|Ga0187788_10383589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300019878|Ga0193715_1089431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
3300020004|Ga0193755_1214217 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300020070|Ga0206356_11832224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
3300021344|Ga0193719_10064574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
3300021445|Ga0182009_10105925 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300022756|Ga0222622_10555093 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300023071|Ga0247752_1013264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300024254|Ga0247661_1098247 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300025910|Ga0207684_10606662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
3300025920|Ga0207649_11302946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300025935|Ga0207709_11016351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
3300026035|Ga0207703_11342577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300026300|Ga0209027_1316479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300026552|Ga0209577_10624046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rupiterrae | 634 | Open in IMG/M |
3300026807|Ga0207547_106811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 523 | Open in IMG/M |
3300026808|Ga0207581_102940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 509 | Open in IMG/M |
3300027718|Ga0209795_10236673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 511 | Open in IMG/M |
3300028719|Ga0307301_10007028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3149 | Open in IMG/M |
3300028719|Ga0307301_10021790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
3300028720|Ga0307317_10227420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
3300028721|Ga0307315_10175318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 658 | Open in IMG/M |
3300028787|Ga0307323_10377690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 507 | Open in IMG/M |
3300028793|Ga0307299_10019416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2433 | Open in IMG/M |
3300028793|Ga0307299_10353173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 551 | Open in IMG/M |
3300028799|Ga0307284_10415370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 548 | Open in IMG/M |
3300028807|Ga0307305_10186641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 955 | Open in IMG/M |
3300028810|Ga0307294_10011012 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
3300028811|Ga0307292_10465884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
3300028814|Ga0307302_10147835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
3300028885|Ga0307304_10051157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
3300028885|Ga0307304_10210814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300030511|Ga0268241_10047967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
3300030785|Ga0102757_11443465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300031058|Ga0308189_10442800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 547 | Open in IMG/M |
3300031092|Ga0308204_10147747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 695 | Open in IMG/M |
3300031092|Ga0308204_10155809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 681 | Open in IMG/M |
3300031092|Ga0308204_10265011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 562 | Open in IMG/M |
3300031114|Ga0308187_10210421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300031114|Ga0308187_10241424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 652 | Open in IMG/M |
3300031226|Ga0307497_10553247 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300031720|Ga0307469_11615112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 623 | Open in IMG/M |
3300031854|Ga0310904_10653806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 723 | Open in IMG/M |
3300031938|Ga0308175_100008936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7403 | Open in IMG/M |
3300031995|Ga0307409_100961217 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300032126|Ga0307415_101075593 | Not Available | 752 | Open in IMG/M |
3300032261|Ga0306920_102455656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300034680|Ga0370541_036699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 607 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.59% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 4.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026807 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-11 (SPAdes) | Environmental | Open in IMG/M |
3300026808 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-10 (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ARCol0yngRDRAFT_10190602 | 3300000652 | Arabidopsis Rhizosphere | WTPPTRGQHVCIVVKAGADPVLVSHGDDSGPKRLRFSAEDSYQRRHGHGDAVFLSAF* |
A30PFW6_11632361 | 3300001361 | Permafrost | VVWTPPSRGQHVCIVVAGGPDPMLVSHGDPSGPKRLRFSAERGYQRRNGHGNPVWLSAF* |
JGI25405J52794_101679662 | 3300003911 | Tabebuia Heterophylla Rhizosphere | DPLLVSHGDESGPKKLRFSAEDAYQRRHGHGTAVWLSAF* |
Ga0062590_1000409844 | 3300004157 | Soil | VVWTPPTRGQHVCIVVKAGADPVLVSHGDDTGPKRLRFSAEDSYQRRHGHGNAVFLSVF* |
Ga0063356_1044932752 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PSTGQHVCLVVSGGADPLLVSHGSDSGPLKIRFSDEDAYQRRAGHGTAIFLSVF* |
Ga0062595_1022722762 | 3300004479 | Soil | GGADPMLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0062591_1020833161 | 3300004643 | Soil | QHVCVVVTPGADPMLISHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0066809_101297481 | 3300005168 | Soil | VVAPGADPVLVSHGDESGPKRLRFSAEDAYQRRHGHGTAVWLTAF* |
Ga0066675_111988921 | 3300005187 | Soil | CVVVKGGSDPMLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF* |
Ga0070670_1012690653 | 3300005331 | Switchgrass Rhizosphere | DPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0070666_105255653 | 3300005335 | Switchgrass Rhizosphere | GDLVVWTPPGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF* |
Ga0070691_101022744 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | DLVVWTPPTRGQHVCIVVKPGADPMLVSHGDDSGPKRLRFSAEDRYQRRHGHGSPVFLSAF* |
Ga0070667_1018801432 | 3300005367 | Switchgrass Rhizosphere | PGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF* |
Ga0070705_1000739392 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SGGADPMLVSHGDDTGPNRVRFSAEDRSQQRRGHGMAVWLSAF* |
Ga0070694_1008743852 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVVWTPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAENGYQRRHGHGSPVFLSAF* |
Ga0070696_1011623351 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLVVWTPPGAGQHVCVVVAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0070696_1019777832 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF* |
Ga0070665_1021945411 | 3300005548 | Switchgrass Rhizosphere | ADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVFLSAF* |
Ga0068854_1005332811 | 3300005578 | Corn Rhizosphere | MLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0066652_1014519352 | 3300006046 | Soil | TGQHVCLVVSGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0074050_120852711 | 3300006577 | Soil | AGTDPLLVSHGDESGPKRLRFSAEDAYQRRNGHGTAVWLTAF* |
Ga0079222_119403131 | 3300006755 | Agricultural Soil | QHVCVVIQGGADPLLVSHGDDTGPKKLRFSAEDAYQRQHGHGTSVWLTAF* |
Ga0079221_104509231 | 3300006804 | Agricultural Soil | VAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0075425_1024263191 | 3300006854 | Populus Rhizosphere | IQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0066710_1041252252 | 3300009012 | Grasslands Soil | LVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF |
Ga0066709_1001293846 | 3300009137 | Grasslands Soil | VVVKGGSDPMLVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF* |
Ga0105243_116530811 | 3300009148 | Miscanthus Rhizosphere | TPPGTGQHVCLVVGGGSDPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0105243_120244142 | 3300009148 | Miscanthus Rhizosphere | MLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0111538_129171042 | 3300009156 | Populus Rhizosphere | QHVCLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0111538_136291972 | 3300009156 | Populus Rhizosphere | CIVVKAGADPVLVSHGDDTGPKRLRFSAEDGYQRRHGHGNAVFLSAF* |
Ga0075423_126819701 | 3300009162 | Populus Rhizosphere | SSGGADPTLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTVF* |
Ga0126384_110069331 | 3300010046 | Tropical Forest Soil | VVWTPPAQGQHVCLVVQGGADPLLVSHGDDTGPKKLRFSAEDAYQRKHGHGTAVWLTVF* |
Ga0126321_13282522 | 3300010145 | Soil | SHGDDSGPKRLRFSVEDGYQRRNGHGTAVWLTVF* |
Ga0126321_13415571 | 3300010145 | Soil | RVGQHVCVVVAGGADPLLVSHGDDSGPKKLRFSGEDAYQRRHGHGTVVWLSAF* |
Ga0134111_104873781 | 3300010329 | Grasslands Soil | PMLVSHGDNTGPKRVRFSAENASPRRNGHGTTVWLTAF* |
Ga0126383_123591623 | 3300010398 | Tropical Forest Soil | GDLVVWTPPSQGQHVCLVVQGGADPLLVSHGDDSGPKKLRFSAEDAYQRKHGHGTAVWLTVF* |
Ga0134122_111523992 | 3300010400 | Terrestrial Soil | VCIVVTPGADPMLVSHGDDSGPKRLRFSAEDRYQRRHGHGSPVFLSAF* |
Ga0134123_116479233 | 3300010403 | Terrestrial Soil | GADPVLVSHGDDTGPKKLRFWAEDAYQRSHGHGTAIWLTVF* |
Ga0138505_1000706641 | 3300010999 | Soil | VVVAAGPDPMLVSHGSDSGPKRLRFSAEDAYQRRHGHGNVVWLSAF* |
Ga0138514_1000040073 | 3300011003 | Soil | LVVWTPASRGHHVCLVVKPGADPTLVSHGDPSGPKHLHFTAEDRSQRRNGHGTAVWLTAF |
Ga0138514_1000444692 | 3300011003 | Soil | VTPGTDPMLVSHGDDTGPKRVRFSAEDRSQRRRGHGTAVWLTAF* |
Ga0138514_1000706281 | 3300011003 | Soil | PMLVSHGDPSGPKRLRFSAEDAYQRRNGHGTSVWLTAF* |
Ga0120152_10145675 | 3300012011 | Permafrost | GPDRMLVSHGDPSGPRRLRFSAERGYQRRNGHGNAVWLSAF* |
Ga0150985_1109727211 | 3300012212 | Avena Fatua Rhizosphere | PDPWLVSHGSDAGPKKLRFSAENAYQAAHGHGTVTWLSAFPA* |
Ga0137370_106031581 | 3300012285 | Vadose Zone Soil | VVWTTPSRGQHVAVVVAGGTDPMLVSHGDDTGPKRLRFSAEDASQRRRGHGTAVWLTAF* |
Ga0157342_10230281 | 3300012507 | Arabidopsis Rhizosphere | QGQHVCLVVQAGADPVLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTVF* |
Ga0157300_10735381 | 3300012884 | Soil | CLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0157305_102722542 | 3300012891 | Soil | GGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0157310_103439781 | 3300012916 | Soil | HVCLVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0162653_1000734282 | 3300012937 | Soil | GADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF* |
Ga0134087_100958761 | 3300012977 | Grasslands Soil | LVSHGDPSGPKQLRFSAEDAYQRRNGHGTTVWLTAF* |
Ga0157369_120636591 | 3300013105 | Corn Rhizosphere | VCVVVAGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0157372_128424002 | 3300013307 | Corn Rhizosphere | GGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0120158_100077681 | 3300013772 | Permafrost | DPMLVSHGDPSGPKRLRFSAERGYQRRNGHGNPVWLSAF* |
Ga0182008_107246361 | 3300014497 | Rhizosphere | PMLISHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF* |
Ga0120104_11331461 | 3300014829 | Permafrost | MLVSHGDASGPKQLRFSAEDAYQRRHGHRTTVWLSAF |
Ga0173478_101945401 | 3300015201 | Soil | PLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF* |
Ga0132256_1001559004 | 3300015372 | Arabidopsis Rhizosphere | QHVCLVVAGGADPLLVSHGDDSGPKKLRFSAEDAYQRRHGHGTAVWLSAF* |
Ga0132255_1055732162 | 3300015374 | Arabidopsis Rhizosphere | VVSLGADPWLVSHGDDSGPRKIRFSDEDASQRRHGHGTVTWLSAF* |
Ga0187785_104580001 | 3300017947 | Tropical Peatland | DEGQHVCIVVAAGPDPWLVSHGDHSGPKKLRFSAEDASQRRNGHTTATWLSAF |
Ga0190266_109321222 | 3300017965 | Soil | VSHGGESGPLKIRFSAEDSWQRTHGHHTAIWLTAF |
Ga0187788_103835891 | 3300018032 | Tropical Peatland | PNPWLVSHGDHSGPKKLRFSAEDTSQQRNGHTAATWLSAF |
Ga0193715_10894311 | 3300019878 | Soil | VVVKGGSDPMLVSHGDPSGPKQLRFSAEDRYQRRNGHGTTVWLTAF |
Ga0193755_12142172 | 3300020004 | Soil | MLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF |
Ga0206356_118322242 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VCLVVQGGADPLLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVFLTVF |
Ga0193719_100645743 | 3300021344 | Soil | GGADPILISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF |
Ga0182009_101059251 | 3300021445 | Soil | VVAGGADPMLVSHGDDIGPKKLRFSAEDAYQRSHGHGTAVWLSAF |
Ga0222622_105550933 | 3300022756 | Groundwater Sediment | LVVSGGPDPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF |
Ga0247752_10132643 | 3300023071 | Soil | VSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF |
Ga0247661_10982471 | 3300024254 | Soil | WTPPSQGQHVCLVVQGGADPVLVSHGDDTGPKKLRFSAEDAYQRSHGHGTAIWLTVF |
Ga0207684_106066622 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IVVSHGDDSGPKRLRFSAEDASQRRGGHGTSVWLTAF |
Ga0207649_113029461 | 3300025920 | Corn Rhizosphere | LVVQAGADPVLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAIWLTAF |
Ga0207709_110163511 | 3300025935 | Miscanthus Rhizosphere | RGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF |
Ga0207703_113425773 | 3300026035 | Switchgrass Rhizosphere | GGSDPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAIWLTAF |
Ga0209027_13164792 | 3300026300 | Grasslands Soil | VVVTGGADPMLVSHGDDTGPKRVRFSAENASQRRNGHGTAVWLTAF |
Ga0209577_106240462 | 3300026552 | Soil | LVSHGDDTGPKRLRFSAEDASQRRRGHGTAVWLTAF |
Ga0207547_1068111 | 3300026807 | Soil | GGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF |
Ga0207581_1029402 | 3300026808 | Soil | LVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF |
Ga0209795_102366732 | 3300027718 | Agave | TPPRSGQHVALVVNAADDPLLVSHGDDSGPKKLRFSAEQASQRRRGHGTAVWLSAF |
Ga0307301_100070281 | 3300028719 | Soil | GDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF |
Ga0307301_100217903 | 3300028719 | Soil | VWTPPGRGQHVCVVVAAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF |
Ga0307317_102274203 | 3300028720 | Soil | SGGADPMLVSHGDDSGPKKLRFSAEDAYQRSHGHGTAVWLSAF |
Ga0307315_101753181 | 3300028721 | Soil | PPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0307323_103776901 | 3300028787 | Soil | GTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF |
Ga0307299_100194161 | 3300028793 | Soil | VAAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF |
Ga0307299_103531731 | 3300028793 | Soil | PGDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF |
Ga0307284_104153701 | 3300028799 | Soil | PPGLGQHVCLVVAGGADPMLISHGDDSGPKRLRFSAEDAYQRRNGHGTAVWLTVF |
Ga0307305_101866411 | 3300028807 | Soil | RGQHVCIVVTPGADPMLVSHGDNSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0307294_100110121 | 3300028810 | Soil | ADPILISHGDDTGPKKLRFSAEDSYQRRHGHGTAVWLSAF |
Ga0307292_104658842 | 3300028811 | Soil | AAGRDPMLVSHGSDSGPKRLRFSAEDAYQRGHGHGNAVWLSAF |
Ga0307302_101478351 | 3300028814 | Soil | MLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0307304_100511571 | 3300028885 | Soil | GDLVVWTPPSRGQHVCVVVSGGADPMLISHGDDTGPKKLRFSSEDSYQRRHGHGTAVWLSAF |
Ga0307304_102108141 | 3300028885 | Soil | DPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF |
Ga0268241_100479673 | 3300030511 | Soil | VVWTPPSRGQHVCVVVAAGPDPLLVSHGDDTGPKKLRFSAEDAYQRRHGHGTAVFLSAF |
Ga0102757_114434652 | 3300030785 | Soil | PMLISHGDDSGPKRLRFSAEDAYQRRNGHGTAVWLTVF |
Ga0308189_104428001 | 3300031058 | Soil | PGTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF |
Ga0308204_101477472 | 3300031092 | Soil | VVWTPPTRGQHVCIVVTPGTDPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0308204_101558091 | 3300031092 | Soil | PPGTGQHVCLVAAGGADPMLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF |
Ga0308204_102650112 | 3300031092 | Soil | GDLVVWTPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0308187_102104211 | 3300031114 | Soil | TPPTRGQHVCIVVTPGADPMLVSHGDDSGPKRLRFSAEDGYQRRHGHGSPVFLSAF |
Ga0308187_102414242 | 3300031114 | Soil | LVVSGGADPMLISHGDDTGPKRLRFSAEDAYQRRNGHGTAVWLTVF |
Ga0307497_105532471 | 3300031226 | Soil | VCLVVSAGADPMLVSHGDDSGPKKLRFSAEDAYQRGHGHGTAVWLSAF |
Ga0307469_116151121 | 3300031720 | Hardwood Forest Soil | VIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF |
Ga0310904_106538063 | 3300031854 | Soil | PGDLVVWTPPGTGQHVCLVISGGADPMLVSHGDDTGPKKLRFSAEDAYQRTHGHGTAIWLSAF |
Ga0308175_1000089363 | 3300031938 | Soil | MLVSHGDGSGSTRLRFSAEDGYRRRHGHGNPVFPSAF |
Ga0307409_1009612172 | 3300031995 | Rhizosphere | TGQHVCLVVSGGSDPMLVSHGSDSGPLKIRFSDEDAYQRRAGHGTAIFLSAF |
Ga0307415_1010755932 | 3300032126 | Rhizosphere | IQGGADPLLVSHGDDSGPKKLRFSAEDAYQRRHGHGTPIWLSAF |
Ga0306920_1024556562 | 3300032261 | Soil | GTHVVIVVQPGADPVVVSHGDDTGPKKLAFSAEDAYHRQHGSGTAVYLTAF |
Ga0370541_036699_489_602 | 3300034680 | Soil | MLVSHGDDSGPKRLRFSAEDASQRRNGHGTAVWLTVF |
⦗Top⦘ |