| Basic Information | |
|---|---|
| Family ID | F089534 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKRKLNSKNPKYKKDKEEELVIIKKVPLTGKAPGYGVWYKNEK |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.50 % |
| % of genes near scaffold ends (potentially truncated) | 19.27 % |
| % of genes from short scaffolds (< 2000 bps) | 74.31 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (44.954 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (58.716 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.826 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 15.28% Coil/Unstructured: 80.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13479 | AAA_24 | 18.35 |
| PF03796 | DnaB_C | 9.17 |
| PF04851 | ResIII | 3.67 |
| PF00271 | Helicase_C | 3.67 |
| PF00476 | DNA_pol_A | 2.75 |
| PF01612 | DNA_pol_A_exo1 | 1.83 |
| PF13730 | HTH_36 | 1.83 |
| PF00149 | Metallophos | 1.83 |
| PF08774 | VRR_NUC | 1.83 |
| PF05866 | RusA | 0.92 |
| PF02086 | MethyltransfD12 | 0.92 |
| PF00216 | Bac_DNA_binding | 0.92 |
| PF13412 | HTH_24 | 0.92 |
| PF06067 | DUF932 | 0.92 |
| PF08299 | Bac_DnaA_C | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 9.17 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 9.17 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.75 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.92 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.92 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.92 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.92 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.39 % |
| Unclassified | root | N/A | 37.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10165338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 742 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10166980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 736 | Open in IMG/M |
| 3300000225|SI34jun09_120mDRAFT_1083783 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 516 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000751 | All Organisms → cellular organisms → Bacteria | 19532 | Open in IMG/M |
| 3300001450|JGI24006J15134_10002962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9212 | Open in IMG/M |
| 3300001450|JGI24006J15134_10003546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 8351 | Open in IMG/M |
| 3300001450|JGI24006J15134_10052845 | Not Available | 1648 | Open in IMG/M |
| 3300002231|KVRMV2_101261659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1280 | Open in IMG/M |
| 3300002514|JGI25133J35611_10154041 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300002514|JGI25133J35611_10200548 | Not Available | 523 | Open in IMG/M |
| 3300002760|JGI25136J39404_1019355 | Not Available | 1231 | Open in IMG/M |
| 3300003540|FS896DNA_10174431 | All Organisms → Viruses → Predicted Viral | 2335 | Open in IMG/M |
| 3300003542|FS900DNA_10317030 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005239|Ga0073579_1434402 | Not Available | 683 | Open in IMG/M |
| 3300005514|Ga0066866_10268420 | Not Available | 587 | Open in IMG/M |
| 3300006029|Ga0075466_1055539 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300006735|Ga0098038_1049699 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300006750|Ga0098058_1110602 | Not Available | 739 | Open in IMG/M |
| 3300006750|Ga0098058_1162718 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 587 | Open in IMG/M |
| 3300006752|Ga0098048_1185020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 617 | Open in IMG/M |
| 3300006753|Ga0098039_1107210 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006754|Ga0098044_1217323 | Not Available | 748 | Open in IMG/M |
| 3300006789|Ga0098054_1053855 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1537 | Open in IMG/M |
| 3300006789|Ga0098054_1118027 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006789|Ga0098054_1198499 | Not Available | 732 | Open in IMG/M |
| 3300006793|Ga0098055_1085022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1242 | Open in IMG/M |
| 3300006793|Ga0098055_1261878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 649 | Open in IMG/M |
| 3300006920|Ga0070748_1372003 | Not Available | 501 | Open in IMG/M |
| 3300006921|Ga0098060_1050320 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300006921|Ga0098060_1086361 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300006921|Ga0098060_1115204 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006921|Ga0098060_1133378 | Not Available | 693 | Open in IMG/M |
| 3300006923|Ga0098053_1029216 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300006926|Ga0098057_1058596 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 943 | Open in IMG/M |
| 3300006927|Ga0098034_1160183 | Not Available | 633 | Open in IMG/M |
| 3300006927|Ga0098034_1226141 | Not Available | 519 | Open in IMG/M |
| 3300006928|Ga0098041_1001129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → unclassified Neisseriaceae → Neisseriaceae bacterium | 10239 | Open in IMG/M |
| 3300006928|Ga0098041_1162083 | Not Available | 718 | Open in IMG/M |
| 3300006928|Ga0098041_1222205 | Not Available | 604 | Open in IMG/M |
| 3300007345|Ga0070752_1125806 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300008050|Ga0098052_1015786 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3740 | Open in IMG/M |
| 3300008050|Ga0098052_1037168 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300008050|Ga0098052_1106423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1138 | Open in IMG/M |
| 3300008050|Ga0098052_1227010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 719 | Open in IMG/M |
| 3300008253|Ga0105349_10347616 | Not Available | 617 | Open in IMG/M |
| 3300009079|Ga0102814_10728168 | Not Available | 546 | Open in IMG/M |
| 3300009086|Ga0102812_10204043 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300009409|Ga0114993_10400460 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300010153|Ga0098059_1013158 | Not Available | 3435 | Open in IMG/M |
| 3300010153|Ga0098059_1269299 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 654 | Open in IMG/M |
| 3300010153|Ga0098059_1341085 | Not Available | 569 | Open in IMG/M |
| 3300010153|Ga0098059_1363323 | Not Available | 549 | Open in IMG/M |
| 3300017713|Ga0181391_1115189 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017719|Ga0181390_1129543 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300017746|Ga0181389_1154202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 609 | Open in IMG/M |
| 3300017755|Ga0181411_1075577 | Not Available | 1014 | Open in IMG/M |
| 3300017757|Ga0181420_1178772 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300017757|Ga0181420_1228239 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017770|Ga0187217_1085874 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300017775|Ga0181432_1004260 | Not Available | 3262 | Open in IMG/M |
| 3300017779|Ga0181395_1103934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 909 | Open in IMG/M |
| 3300017786|Ga0181424_10338141 | Not Available | 621 | Open in IMG/M |
| 3300021089|Ga0206679_10169325 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300021089|Ga0206679_10347928 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 796 | Open in IMG/M |
| 3300021957|Ga0222717_10557200 | Not Available | 608 | Open in IMG/M |
| 3300022164|Ga0212022_1041028 | Not Available | 716 | Open in IMG/M |
| 3300022164|Ga0212022_1043048 | Not Available | 699 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10057082 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300024346|Ga0244775_10205199 | All Organisms → Viruses → Predicted Viral | 1653 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10195645 | Not Available | 924 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10338758 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10049836 | All Organisms → Viruses → Predicted Viral | 2180 | Open in IMG/M |
| 3300025079|Ga0207890_1072374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 546 | Open in IMG/M |
| 3300025098|Ga0208434_1082879 | Not Available | 650 | Open in IMG/M |
| 3300025099|Ga0208669_1096800 | Not Available | 619 | Open in IMG/M |
| 3300025103|Ga0208013_1009003 | All Organisms → Viruses → Predicted Viral | 3281 | Open in IMG/M |
| 3300025103|Ga0208013_1121732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 643 | Open in IMG/M |
| 3300025110|Ga0208158_1014370 | Not Available | 2126 | Open in IMG/M |
| 3300025122|Ga0209434_1139886 | Not Available | 664 | Open in IMG/M |
| 3300025132|Ga0209232_1000632 | All Organisms → cellular organisms → Bacteria | 20897 | Open in IMG/M |
| 3300025133|Ga0208299_1009296 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5018 | Open in IMG/M |
| 3300025133|Ga0208299_1011559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 4339 | Open in IMG/M |
| 3300025133|Ga0208299_1011721 | Not Available | 4297 | Open in IMG/M |
| 3300025133|Ga0208299_1016472 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3403 | Open in IMG/M |
| 3300025133|Ga0208299_1065549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 1325 | Open in IMG/M |
| 3300025133|Ga0208299_1215923 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300025141|Ga0209756_1000463 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 39755 | Open in IMG/M |
| 3300025141|Ga0209756_1253837 | Not Available | 643 | Open in IMG/M |
| 3300025168|Ga0209337_1000868 | All Organisms → cellular organisms → Bacteria | 23889 | Open in IMG/M |
| 3300025168|Ga0209337_1007102 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 7462 | Open in IMG/M |
| 3300025168|Ga0209337_1014078 | All Organisms → Viruses → Predicted Viral | 4895 | Open in IMG/M |
| 3300025168|Ga0209337_1022731 | All Organisms → Viruses → Predicted Viral | 3616 | Open in IMG/M |
| 3300025168|Ga0209337_1253161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 672 | Open in IMG/M |
| 3300025168|Ga0209337_1329385 | Not Available | 535 | Open in IMG/M |
| 3300025508|Ga0208148_1009872 | All Organisms → Viruses → Predicted Viral | 2954 | Open in IMG/M |
| 3300025671|Ga0208898_1023541 | Not Available | 2655 | Open in IMG/M |
| 3300025873|Ga0209757_10004743 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 3454 | Open in IMG/M |
| 3300025873|Ga0209757_10147312 | Not Available | 736 | Open in IMG/M |
| 3300025873|Ga0209757_10272486 | Not Available | 538 | Open in IMG/M |
| 3300026546|Ga0256913_10143882 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1400 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10018440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 2766 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10418014 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10000037 | Not Available | 66697 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10179477 | Not Available | 885 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10344456 | Not Available | 688 | Open in IMG/M |
| 3300029448|Ga0183755_1005009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 6229 | Open in IMG/M |
| 3300031851|Ga0315320_10990047 | Not Available | 509 | Open in IMG/M |
| 3300032019|Ga0315324_10071441 | Not Available | 1297 | Open in IMG/M |
| 3300032088|Ga0315321_10297680 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 58.72% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.09% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 7.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.59% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.83% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 1.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.92% |
| Deep-Sea Worm Associated Microbial Mat | Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat | 0.92% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.92% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.92% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000225 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003542 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026546 | Deep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_Mat | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101653382 | 3300000116 | Marine | MKKLKLNSKNPKYKKGEEEKLVVLKKVPFIGKAKGYGVWYKNQK* |
| DelMOSpr2010_101669802 | 3300000116 | Marine | MKKRKLNSKNPKYKKNNEEELVVLKKVPFTGKAKGYGVWYKNEK* |
| SI34jun09_120mDRAFT_10837832 | 3300000225 | Marine | MAKKRKLNSKNPKHKTGEEEKLVVLKKVPLTGKAKGYGVWYKNEK* |
| JGI24006J15134_1000075130 | 3300001450 | Marine | MKKRKLNSRNPKYNTEEKELVIIKKIPLTGKAKGHFVWYENKTK* |
| JGI24006J15134_1000296216 | 3300001450 | Marine | MKKRKLNSKNPKYSNNKEEELIIIKTVEFTGKAKGRGVWYKHKK* |
| JGI24006J15134_100035469 | 3300001450 | Marine | MKKKKLNSTNPKYNQGTKIKEKVIIKKIPLTGKAPGYGVFYKDEN* |
| JGI24006J15134_100528453 | 3300001450 | Marine | MKKRKLNSKNPKYKKDNEEKLVILKKVPFTGKAPGYGVWYKNEK* |
| KVRMV2_1012616595 | 3300002231 | Marine Sediment | MKKRKLNSKNPKYSNSKKEELIVIKTVELTGKAKGRGVWYKKQT* |
| JGI25133J35611_101540413 | 3300002514 | Marine | MTKKRKLNSKNPKYNTSKEEELIIIKTVEFTGKAKGRGVWYKDQK* |
| JGI25133J35611_102005481 | 3300002514 | Marine | MKKRKLNSKNPKYNKDDRQEDLEIAKKVPFTGKAKGYGVWYKKDKQNG*N |
| JGI25136J39404_10193554 | 3300002760 | Marine | MAKKRKLNSKNPKYKTDEGEKLVVIKRVPLTGNAPGYGVWYAKEKS* |
| FS896DNA_101744316 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MKKRKLNSKNPKYRKGEEEKLVVLKKVPLTGKVKGYGVWYKNEK* |
| FS900DNA_103170302 | 3300003542 | Diffuse Hydrothermal Flow Volcanic Vent | MKKRKLNSKNPKYNQGTETKEKVIIKKVPLTGKAKGHGIFYKDEN* |
| Ga0073579_14344023 | 3300005239 | Marine | KLNSKTPKYKKDNEEKLVVLKKVPFTGKAPGYGVWYKIQNNE* |
| Ga0066866_102684202 | 3300005514 | Marine | MKKRKLNSKNPKYKADTGEKLVIIKTVELTGKAKGRGVWYKKQ* |
| Ga0075466_10555395 | 3300006029 | Aqueous | MKKRKLNSKNPKYKKNTEEELVVLKKVPFTGKAKGYGVWYKNEK* |
| Ga0098038_10496992 | 3300006735 | Marine | MAKKRKLNSKNPKYKTDKGEELIVVKKVPLIGKAPGYGVWYKNEK* |
| Ga0098058_11106022 | 3300006750 | Marine | MAKKRKLNSKNPKWQGEKIELEIVKTVELTGKAKGRGVWYKREE* |
| Ga0098058_11627182 | 3300006750 | Marine | MTKKRKLNSKNPKYQDKSQIKEKVIIKKIPLTGKAPGYGVFYEDEK* |
| Ga0098048_11850203 | 3300006752 | Marine | MKKRKLNSKNPKYNKDDRQEDLEIAKKVPFTGKAKGYVVWY |
| Ga0098039_11072104 | 3300006753 | Marine | MKKRKLNSKNPKYQNQNKEDKRVIIKKVPLTGKAPGYGIFYADEK* |
| Ga0098044_12173234 | 3300006754 | Marine | MKKRKLNSKNPKYKIDTGEKLVVIKTVELTGKAKGRGVWYKKQ* |
| Ga0098054_10538552 | 3300006789 | Marine | MKKRKLNSKNPKYNKDIKENELVIVKKIPIKIKGEIKGYGVWYEKDN* |
| Ga0098054_11180274 | 3300006789 | Marine | MKKRKLNSKNPKYSNSKEEELIVIKTVEFTGKAKGRGVWYKDQK* |
| Ga0098054_11984994 | 3300006789 | Marine | MKKRKLNSKNPKYKTDTGEKLVVIKTVELTGKAKGRGVWYKKQ* |
| Ga0098055_10850224 | 3300006793 | Marine | MKKRKLNSKNPKYNKDIKENDLVIIKKIPLTGKAKGYGVWYEKDN* |
| Ga0098055_12618784 | 3300006793 | Marine | MKKRKLNSKNPKYSTSQKEELVIIKKVPLTGKAPGYGVWYKKDK* |
| Ga0070748_13720032 | 3300006920 | Aqueous | MKKRKLNSKNPKYRKNNEEKLVVLKKVPFTGKAKGYGVWYKNEK* |
| Ga0098060_10503205 | 3300006921 | Marine | MKKRKLNSNNPKYRKDEEEKLVVIKKVPLIGKAKGYGVWYSKEK* |
| Ga0098060_10863612 | 3300006921 | Marine | MTKKRKLNSKNPKYQDKSQIKEKVIIKKVPLTGKAPGYGVFYEDEK* |
| Ga0098060_11152044 | 3300006921 | Marine | MKKRKLNSKNPKYSNNKEEELIVIKTVEFTGKAKGRGVWYKHQK* |
| Ga0098060_11333781 | 3300006921 | Marine | PKYKKDKEEELVIIKKVPLTGKAPGYGVWYKNEK* |
| Ga0098053_10292161 | 3300006923 | Marine | KRKLNSKNPKYKKDNEEKLVVLKKVPFTGKAKGYGVWYKNEK* |
| Ga0098057_10585963 | 3300006926 | Marine | MKKRKLNSKNPKYKKGNEEKLVVVKKVALIGKAKGYGVWYKN* |
| Ga0098034_11601831 | 3300006927 | Marine | MKKRKLNSKNPKYNKDIKENDLVIIKKIPLTGKAKGYGVWYEKNY* |
| Ga0098034_12261412 | 3300006927 | Marine | MKKRKLNSKNPKYRKGEEEKLVVLKKVPLTGKAKGYGVWYKNEK* |
| Ga0098041_10011295 | 3300006928 | Marine | MPKKRKLNSKNPKYNNTKEEKLVVIKTVELTGKAKGRGVWYKKQI* |
| Ga0098041_11620834 | 3300006928 | Marine | MKKRKLNSKNPKYKKDTGEKLVVIKTVELTGKAKGRGVWYKKQ* |
| Ga0098041_12222054 | 3300006928 | Marine | MTKKRKLNSKNPKYKTSKEEELIVIKTVELTGKAKGRGVWYKSLV* |
| Ga0070752_11258061 | 3300007345 | Aqueous | KRKLNSKNPKYKKDNEKKLVVLKKVPFIGKAKGYGVWYKNEK* |
| Ga0098052_10157862 | 3300008050 | Marine | MKKRKLNSKNPKYSNNKEEKLIIIKTVELTGKAKGRGVWYKKQT* |
| Ga0098052_10371681 | 3300008050 | Marine | RKLNSKNPKWHGKKTELEIIKKVPLTGKAPGYGVWYAKEKS* |
| Ga0098052_11064231 | 3300008050 | Marine | MKKRKLNSKNPKYNNSKEEELIVIKTVELTGKAKGRGVWYKKQT* |
| Ga0098052_12270102 | 3300008050 | Marine | MKKRKLNSKNPKYNKDIKENELVIVKKIPIKIKGEVKGYGVWYEKDN* |
| Ga0105349_103476161 | 3300008253 | Methane Seep Mesocosm | MKKRKLNSKNPKYRKDSEEKLVVLKKVAFTGKAKGYGVWYNNEK* |
| Ga0102814_107281683 | 3300009079 | Estuarine | MKKRKLNSKNPKYSTEKKEESVIIKKVPLTGKAPGY |
| Ga0102812_102040433 | 3300009086 | Estuarine | MKKRKLNSKNPKYSTEKKEESVIIKKAPLTGKATGYGVWYKKQ* |
| Ga0114993_104004602 | 3300009409 | Marine | MKKRKLNSKNPKYNTEEKELVIIKKIPLTGKAKGNLIWYENKK* |
| Ga0098059_10131584 | 3300010153 | Marine | MSKKRKLNSKNPKYKKGEEEKLVILKKVPFTGKAKGYGVWYKNN* |
| Ga0098059_12692992 | 3300010153 | Marine | MSKKRKLNSKNPKYRKGKEEKLTVIKTVEFTGKAKGRGVWYKW* |
| Ga0098059_13410853 | 3300010153 | Marine | MKKRKLNSKNPKYKKDKGEELIIIKTVELTGKAKGRGVWYK |
| Ga0098059_13633232 | 3300010153 | Marine | MTKKRKLNSKNPKYSADKKEELVIVKKVPLTGKAPGYGVWYK* |
| Ga0181391_11151892 | 3300017713 | Seawater | MKKRKLNSKNPKYSTSQKEELVIIKKVPLTGKAPGYGVWYKKDK |
| Ga0181390_11295431 | 3300017719 | Seawater | NSKNPKYSTSQKEELVIIKKVPLTGKAPGYGVWYKKDK |
| Ga0181389_11542024 | 3300017746 | Seawater | MKKRKLNSKNPKYSTSQKEELVIIKKVPLTGKAPGYGVWY |
| Ga0181411_10755771 | 3300017755 | Seawater | MKKRKLNSKNPKYKKGEEEKLVILKKVPLTGKAPGYGVWYKNEK |
| Ga0181420_11787721 | 3300017757 | Seawater | MSKKRKLNSKNPKYSTSQKEELVIIKKVPLTGKAPGYGVWYKKDK |
| Ga0181420_12282392 | 3300017757 | Seawater | MTKKRKLNSKNPKYSKNKEEKLIVIKTVELTGKAKGRGVWYKKQT |
| Ga0187217_10858743 | 3300017770 | Seawater | MTKKRKLNSKNPKYSNNKEEELIVIKTVEFTGKAKGRGVWYKHQK |
| Ga0181432_10042605 | 3300017775 | Seawater | MAKKRKLNSKNPKWHGKKTELEIIKKVPLTGKAPGYGVWYAKEKS |
| Ga0181395_11039344 | 3300017779 | Seawater | MKKRKLNSKNPKYSNNKEEELIVIKTVEFTGKAKGRGVWYKHQK |
| Ga0181424_103381411 | 3300017786 | Seawater | KRKLNSKNPKYKKDNEEKLVVLKKVPFTGKAPGYGVWYKNEK |
| Ga0206679_101693251 | 3300021089 | Seawater | KRKLNSKNPKYKKDNEEKLVVLKKVPFIGKAKGYGVWYKNQK |
| Ga0206679_103479282 | 3300021089 | Seawater | MTIKTKTIDMKKRKLNSKNPKYSSAKEEKLVIIKKVPLTGKAPGYGVWYAKEN |
| Ga0222717_105572003 | 3300021957 | Estuarine Water | MKKRKLNSKNPKYKKDKEEELVIIKKVPLTGKAPGYGVWYKNEK |
| Ga0212022_10410281 | 3300022164 | Aqueous | MKKRKLNSKNPKYRKNNEEKLVVLKKVPFTGKAKGYGVWYKNEK |
| Ga0212022_10430484 | 3300022164 | Aqueous | NPKYKKNNEEELVVLKKVPFTGKAKGYGVWYKNEK |
| (restricted) Ga0255039_100570823 | 3300024062 | Seawater | MKKRKLNSKNPKYNTEKKEESVIIKKVSLTGKAPGYAVWYKKQ |
| Ga0244775_102051991 | 3300024346 | Estuarine | MKKRKLNSKNPKYSTEKKEESVIIKKVPLTGKAPGYAVWYKKQ |
| (restricted) Ga0255049_101956451 | 3300024517 | Seawater | KNPKYKKDNEEKLVVLKKVPFTGKAKGYGVWYKNEK |
| (restricted) Ga0255048_103387582 | 3300024518 | Seawater | MTKKRKLNSKNPKYQDKSQIKEKVIIKKVPLTGKAPGYGVFYENEN |
| (restricted) Ga0255047_100498364 | 3300024520 | Seawater | MKKRKLNSKNPKYRKDNEEKLVVLKKVPFTGKAKGYGVWYKNEK |
| Ga0207890_10723741 | 3300025079 | Marine | MKKRKLNSKNPKYSNNKEEELIIIKTVEFTGKAKGRGVW |
| Ga0208434_10828792 | 3300025098 | Marine | MAKKRKLNSKNPKYKTDKGEELIVVKKVPLIGKAPGYGVWYKNEK |
| Ga0208669_10968003 | 3300025099 | Marine | MKKRKLNSNNPKYRKDEEEKLVVIKKVPLIGKAKGYGVWYSKEK |
| Ga0208013_10090036 | 3300025103 | Marine | NMKKRKLNSKNPKYSNSKEEELIVIKTVEFTGKAKGRGVWYKDQK |
| Ga0208013_11217321 | 3300025103 | Marine | MKKRKLNSKNPKYSNSKEEELIVIKTVEFTGKAKGRGVWYKKQ |
| Ga0208158_10143702 | 3300025110 | Marine | MPKKRKLNSKNPKYNNTKEEKLVVIKTVELTGKAKGRGVWYKKQI |
| Ga0209434_11398861 | 3300025122 | Marine | NPKYKKGEEEKLVVLKKVPFTGKAKGYGVWYKNEK |
| Ga0209232_100063231 | 3300025132 | Marine | MAKKRKLNSKNPKYKTDKGEELIVVKKVPLIGKAPGHGVWYKNEK |
| Ga0208299_100929610 | 3300025133 | Marine | MKKRKLNSKNPKYSNSKEEELIVIKTVEFTGKAKGRGVWYKKQT |
| Ga0208299_10115592 | 3300025133 | Marine | MKKRKLNSKNPKYNNSKEEELIVIKTVELTGKAKGRGVWYKKQT |
| Ga0208299_10117218 | 3300025133 | Marine | MAKKRKLNSKNPKWQGKKTELEIIKKVPLTGKAPGYGVWYAKEKS |
| Ga0208299_10164726 | 3300025133 | Marine | MKKRKLNSKNPKYSNNKEEKLIIIKTVELTGKAKGRGVWYKKQT |
| Ga0208299_10655491 | 3300025133 | Marine | MKKRKLNSKNPKYNKDIKENELVIVKKIPIKIKGEVKGYGVWYEKDN |
| Ga0208299_12159232 | 3300025133 | Marine | MKKRKLNSKNPKYNKDIKENELVIVKKIPIKIKGEIKGYGVWYE |
| Ga0209756_100046324 | 3300025141 | Marine | MSKKRKLNSKNPKYKKGEEEKLVILKKVPFTGKAKGYGVWYKNN |
| Ga0209756_12538372 | 3300025141 | Marine | MAKKRKLNSKNPKYHGKKIELEIVKTVELTGKAKGRGVWYKREE |
| Ga0209337_10008682 | 3300025168 | Marine | MKKRKLNSRNPKYNTEEKELVIIKKIPLTGKAKGHFVWYENKTK |
| Ga0209337_10071022 | 3300025168 | Marine | MKKRKLNSKNPKYSNNKEEELIIIKTVEFTGKAKGRGVWYKHKK |
| Ga0209337_10140788 | 3300025168 | Marine | MKKKKLNSTNPKYNQGTKIKEKVIIKKIPLTGKAPGYGVFYKDEN |
| Ga0209337_10227317 | 3300025168 | Marine | MKKRKLNSKNPKYKKDNEEKLVILKKVPFTGKAPGYGVWYKNEK |
| Ga0209337_12531611 | 3300025168 | Marine | MKKRKLNSKNPKYNKDIKKDELVIIKKIPLTGKAKGYGVWYEKNN |
| Ga0209337_13293853 | 3300025168 | Marine | MTKKRKLNSKNPKYSKNKEEELIVIKTVELTGKAKG |
| Ga0208148_10098727 | 3300025508 | Aqueous | MKKRKLNSKNPKYKKNTEEELVVLKKVPFTGKAKGYGVWYKNEK |
| Ga0208898_10235417 | 3300025671 | Aqueous | MKKLKLNSKNPKYKKGEEEKLVVLKKVPFIGKAKGYGVWYKNQK |
| Ga0209757_100047434 | 3300025873 | Marine | MKKRKLNSKNPKYRKGNEEKLIVLKTVEFTGKAKGRGVWYKW |
| Ga0209757_101473121 | 3300025873 | Marine | MAKKRKLGSKNPKWNKELQEKPKVILKKVALTGKAPGYGIFYADEK |
| Ga0209757_102724862 | 3300025873 | Marine | MAKKRKLNSKNPKYKTDEGEKLVVIKRVPLTGNAPGYGVWYAKEKS |
| Ga0256913_101438824 | 3300026546 | Deep-Sea Worm Associated Microbial Mat | MKKRKLNSKNPKYRKGEEEKLVVLKKVPLTGKAKGYGVWYKNEK |
| (restricted) Ga0233415_100184402 | 3300027861 | Seawater | MAKKRKLGSKNPKYDTSKKEELVIIKTVELTGKAKGKGIWYKKQT |
| (restricted) Ga0233415_104180142 | 3300027861 | Seawater | MTKKRKLNSKNPKYDTSKKEEVVIIKKVPLTGKAPGYGVWYKNDK |
| (restricted) Ga0233413_1000003718 | 3300027996 | Seawater | MSKKRKLNSKNPKYKTDTGEELVVLKKVPLSGKAKGYGVWYKNN |
| (restricted) Ga0233413_101794771 | 3300027996 | Seawater | MKKRKLNSKNPKYKIDTGEKLVVIKTVELTGKAKGRGIWYKKQ |
| (restricted) Ga0233414_103444561 | 3300028045 | Seawater | MKKIKLNSNNPKYKKGEEEKLVVLKKVPLTGKAKGYGVWYKK |
| Ga0183755_10050092 | 3300029448 | Marine | MKKKKLNSKNPKYNQGTKIKEKVIIKKVPLTGKAPGYGVFYENE |
| Ga0315320_109900472 | 3300031851 | Seawater | MKKRKLNSKNPKYKKDKEEELVIIKKVPLTGKAAGYGVWYKNEK |
| Ga0315324_100714413 | 3300032019 | Seawater | MKKRKLNSKNPKYKTDTGEKIVIIKKTPLTGKAPGYGVWYK |
| Ga0315321_102976802 | 3300032088 | Seawater | MTKKRKLNSKNPKYDTSEKEELVIIKKVPLTGKAPGYGVWYKKDK |
| ⦗Top⦘ |