| Basic Information | |
|---|---|
| Family ID | F089404 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | KKAARPIEIIAEPGNAKATGKPEANAAIIIITSKAKNKCSIY |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.66 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.477 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (28.440 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.890 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.486 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.43% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF04290 | DctQ | 88.07 |
| PF03480 | DctP | 9.17 |
| PF02913 | FAD-oxidase_C | 1.83 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.48 % |
| All Organisms | root | All Organisms | 27.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559018|JCVI_READ_1223371 | Not Available | 966 | Open in IMG/M |
| 3300000142|LPaug09P16500mDRAFT_c1001080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7460 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1058241 | Not Available | 618 | Open in IMG/M |
| 3300001964|GOS2234_1034091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1948 | Open in IMG/M |
| 3300002040|GOScombined01_103119312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3019 | Open in IMG/M |
| 3300002956|JGI26059J44795_1024714 | Not Available | 856 | Open in IMG/M |
| 3300003264|JGI26119J46589_1040045 | Not Available | 558 | Open in IMG/M |
| 3300005401|Ga0066857_10074598 | Not Available | 1213 | Open in IMG/M |
| 3300005401|Ga0066857_10343092 | Not Available | 526 | Open in IMG/M |
| 3300005429|Ga0066846_10125681 | Not Available | 876 | Open in IMG/M |
| 3300005523|Ga0066865_10078316 | Not Available | 1179 | Open in IMG/M |
| 3300006024|Ga0066371_10063669 | Not Available | 1074 | Open in IMG/M |
| 3300006166|Ga0066836_10154158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1353 | Open in IMG/M |
| 3300006166|Ga0066836_10667009 | Not Available | 629 | Open in IMG/M |
| 3300006315|Ga0068487_1080054 | Not Available | 1237 | Open in IMG/M |
| 3300006329|Ga0068486_1067713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 807 | Open in IMG/M |
| 3300006332|Ga0068500_1282364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1203 | Open in IMG/M |
| 3300006334|Ga0099675_1654598 | Not Available | 784 | Open in IMG/M |
| 3300006478|Ga0100224_1153644 | Not Available | 745 | Open in IMG/M |
| 3300006478|Ga0100224_1166579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1632 | Open in IMG/M |
| 3300006478|Ga0100224_1217787 | Not Available | 652 | Open in IMG/M |
| 3300007137|Ga0101673_1025249 | Not Available | 933 | Open in IMG/M |
| 3300007754|Ga0105023_1041254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1574 | Open in IMG/M |
| 3300008097|Ga0111541_10023377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2317 | Open in IMG/M |
| 3300008097|Ga0111541_10092583 | Not Available | 1216 | Open in IMG/M |
| 3300008223|Ga0105348_1209570 | Not Available | 532 | Open in IMG/M |
| 3300008738|Ga0115660_1131418 | Not Available | 1168 | Open in IMG/M |
| 3300009080|Ga0102815_10850407 | Not Available | 521 | Open in IMG/M |
| 3300009104|Ga0117902_1727851 | Not Available | 712 | Open in IMG/M |
| 3300009109|Ga0117922_1153718 | Not Available | 1063 | Open in IMG/M |
| 3300009126|Ga0118723_1111340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1652 | Open in IMG/M |
| 3300009550|Ga0115013_10465487 | Not Available | 819 | Open in IMG/M |
| 3300009593|Ga0115011_12235945 | Not Available | 505 | Open in IMG/M |
| 3300009703|Ga0114933_10056075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2865 | Open in IMG/M |
| 3300009703|Ga0114933_10586454 | Not Available | 719 | Open in IMG/M |
| 3300009790|Ga0115012_10657672 | Not Available | 836 | Open in IMG/M |
| 3300009790|Ga0115012_11163395 | Not Available | 646 | Open in IMG/M |
| 3300011326|Ga0138403_1110716 | Not Available | 517 | Open in IMG/M |
| 3300012919|Ga0160422_10732946 | Not Available | 632 | Open in IMG/M |
| 3300012928|Ga0163110_10174120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1508 | Open in IMG/M |
| 3300012954|Ga0163111_10575984 | Not Available | 1048 | Open in IMG/M |
| 3300017818|Ga0181565_10314539 | Not Available | 1048 | Open in IMG/M |
| 3300018039|Ga0181579_10127770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1560 | Open in IMG/M |
| 3300018421|Ga0181592_10297282 | Not Available | 1169 | Open in IMG/M |
| 3300020240|Ga0211494_1021107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1394 | Open in IMG/M |
| 3300020252|Ga0211696_1024689 | Not Available | 734 | Open in IMG/M |
| 3300020282|Ga0211667_1004244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4090 | Open in IMG/M |
| 3300020315|Ga0211589_1050791 | Not Available | 782 | Open in IMG/M |
| 3300020329|Ga0211632_1063355 | Not Available | 762 | Open in IMG/M |
| 3300020359|Ga0211610_1106820 | Not Available | 656 | Open in IMG/M |
| 3300020383|Ga0211646_10250453 | Not Available | 629 | Open in IMG/M |
| 3300020387|Ga0211590_10145841 | Not Available | 727 | Open in IMG/M |
| 3300020387|Ga0211590_10147524 | Not Available | 723 | Open in IMG/M |
| 3300020395|Ga0211705_10034081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1849 | Open in IMG/M |
| 3300020395|Ga0211705_10359404 | Not Available | 540 | Open in IMG/M |
| 3300020402|Ga0211499_10194196 | Not Available | 727 | Open in IMG/M |
| 3300020405|Ga0211496_10282581 | Not Available | 619 | Open in IMG/M |
| 3300020418|Ga0211557_10443275 | Not Available | 572 | Open in IMG/M |
| 3300020429|Ga0211581_10413024 | Not Available | 551 | Open in IMG/M |
| 3300020431|Ga0211554_10101344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1469 | Open in IMG/M |
| 3300020440|Ga0211518_10196395 | Not Available | 995 | Open in IMG/M |
| 3300020451|Ga0211473_10324757 | Not Available | 789 | Open in IMG/M |
| 3300020451|Ga0211473_10586080 | Not Available | 565 | Open in IMG/M |
| 3300020453|Ga0211550_10068144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1692 | Open in IMG/M |
| 3300020454|Ga0211548_10327852 | Not Available | 748 | Open in IMG/M |
| 3300020454|Ga0211548_10384096 | Not Available | 687 | Open in IMG/M |
| 3300020455|Ga0211664_10297668 | Not Available | 747 | Open in IMG/M |
| 3300020456|Ga0211551_10352951 | Not Available | 701 | Open in IMG/M |
| 3300020462|Ga0211546_10172454 | Not Available | 1071 | Open in IMG/M |
| 3300020466|Ga0211714_10049820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2143 | Open in IMG/M |
| 3300020466|Ga0211714_10433830 | Not Available | 622 | Open in IMG/M |
| 3300020470|Ga0211543_10409119 | Not Available | 651 | Open in IMG/M |
| 3300020472|Ga0211579_10684152 | Not Available | 572 | Open in IMG/M |
| 3300020475|Ga0211541_10384793 | Not Available | 686 | Open in IMG/M |
| 3300020584|Ga0211540_1036989 | Not Available | 674 | Open in IMG/M |
| 3300020595|Ga0206126_10085959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1586 | Open in IMG/M |
| 3300021365|Ga0206123_10311001 | Not Available | 668 | Open in IMG/M |
| 3300022928|Ga0255758_10105873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1476 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10180776 | Not Available | 1072 | Open in IMG/M |
| 3300023178|Ga0255759_10313182 | Not Available | 983 | Open in IMG/M |
| 3300023180|Ga0255768_10263532 | Not Available | 991 | Open in IMG/M |
| 3300024236|Ga0228655_1036939 | Not Available | 1158 | Open in IMG/M |
| 3300024322|Ga0228656_1109508 | Not Available | 586 | Open in IMG/M |
| 3300024334|Ga0228671_1118793 | Not Available | 622 | Open in IMG/M |
| 3300025828|Ga0208547_1173778 | Not Available | 598 | Open in IMG/M |
| 3300026262|Ga0207990_1037034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1420 | Open in IMG/M |
| 3300026263|Ga0207992_1134513 | Not Available | 629 | Open in IMG/M |
| 3300026269|Ga0208766_1030883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1854 | Open in IMG/M |
| 3300026279|Ga0208411_1176089 | Not Available | 548 | Open in IMG/M |
| 3300026321|Ga0208764_10124838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1314 | Open in IMG/M |
| 3300026321|Ga0208764_10326562 | Not Available | 733 | Open in IMG/M |
| 3300027553|Ga0208947_1090113 | Not Available | 701 | Open in IMG/M |
| 3300027699|Ga0209752_1017634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2757 | Open in IMG/M |
| 3300027830|Ga0209359_10068414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1430 | Open in IMG/M |
| 3300027830|Ga0209359_10560301 | Not Available | 527 | Open in IMG/M |
| 3300028131|Ga0228642_1151041 | Not Available | 553 | Open in IMG/M |
| 3300031757|Ga0315328_10372680 | Not Available | 830 | Open in IMG/M |
| 3300031766|Ga0315322_10150883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1654 | Open in IMG/M |
| 3300031766|Ga0315322_10358347 | Not Available | 984 | Open in IMG/M |
| 3300031774|Ga0315331_10284007 | Not Available | 1222 | Open in IMG/M |
| 3300031774|Ga0315331_10344282 | Not Available | 1095 | Open in IMG/M |
| 3300031774|Ga0315331_10737024 | Not Available | 693 | Open in IMG/M |
| 3300031851|Ga0315320_10105552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2149 | Open in IMG/M |
| 3300032006|Ga0310344_10227520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1589 | Open in IMG/M |
| 3300032011|Ga0315316_10321106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1298 | Open in IMG/M |
| 3300032011|Ga0315316_10942108 | Not Available | 705 | Open in IMG/M |
| 3300032032|Ga0315327_10203542 | Not Available | 1241 | Open in IMG/M |
| 3300032073|Ga0315315_11752980 | Not Available | 529 | Open in IMG/M |
| 3300032088|Ga0315321_10311716 | Not Available | 1000 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 28.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 11.01% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.67% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.75% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.83% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.92% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.92% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.92% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.92% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559018 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) | Environmental | Open in IMG/M |
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002956 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300005401 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 | Environmental | Open in IMG/M |
| 3300005429 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006478 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125m | Environmental | Open in IMG/M |
| 3300007137 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dc | Environmental | Open in IMG/M |
| 3300007754 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008223 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson Canyon | Environmental | Open in IMG/M |
| 3300008738 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300011326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020240 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982) | Environmental | Open in IMG/M |
| 3300020252 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020315 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX555948-ERR598972) | Environmental | Open in IMG/M |
| 3300020329 | Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555981-ERR599083) | Environmental | Open in IMG/M |
| 3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020387 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020584 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555983-ERR599011) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026262 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027699 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_250m (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean6-_01438350 | 2166559018 | Environmental And Host-Associated | RPIEIIAEPGKAKATGKPEANAPIIIITSKPRNKCSII |
| LPaug09P16500mDRAFT_10010807 | 3300000142 | Marine | ALISPSKRYPKKAARPIEIIAEPGNAKATGKPDANATIIINTSRAKKKCSII* |
| LPjun09P12500mDRAFT_10582411 | 3300000222 | Marine | IEIIAEPGNAKATGKPDANAAIIINTSRDKNRCSII* |
| GOS2234_10340911 | 3300001964 | Marine | KAARPIDIIAEPGKANATGKPEARATIMISTSIVKNKCSID* |
| GOScombined01_1031193124 | 3300002040 | Marine | AEPGNAKATGKPDASATIIIKTSKDRNKCSINYFFKSI* |
| JGI26059J44795_10247141 | 3300002956 | Marine | PKKAARPIAIIAEPGNAKATGKPEANAAIIISTSRDKNRCSII* |
| JGI26119J46589_10400451 | 3300003264 | Marine | ASPIEIIAEPGRAKATGKPDANAAIIMITSKAKNKCSII* |
| Ga0066857_100745982 | 3300005401 | Marine | LVSPSKRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIITSRDKNKFSII* |
| Ga0066857_103430921 | 3300005401 | Marine | KRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIATSRAKKKCSIN* |
| Ga0066846_101256812 | 3300005429 | Marine | SKRYPKKAARPIEIIAEPGNAKATGKPEANAAIIIITSRDKNKFSII* |
| Ga0066865_100783161 | 3300005523 | Marine | PSKRYPKKAARPIEIIAEPGKAKATGKPEANAPIIIITSKARNRCSII* |
| Ga0066371_100636692 | 3300006024 | Marine | RYPKKAARPIAIIAEPGSAKATGKPDANATIIINTSIDKNRCSIN* |
| Ga0066836_101541581 | 3300006166 | Marine | SKRYPIKAARPIETIAEPGKAKATGKPEANAPIIMITSKAKKKCSII* |
| Ga0066836_106670092 | 3300006166 | Marine | PAKRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIATSIAKKKCSIN* |
| Ga0068487_10800541 | 3300006315 | Marine | SNRYPKKAARPIEIMAEPGNAKATGKPDASATIIIKTSKDKNKCSINYFFKST* |
| Ga0068486_10677131 | 3300006329 | Marine | SKRYPKKAARPIEIIAEPGKANATGNPEARATIMISTSIVKNKCSID* |
| Ga0068500_12823641 | 3300006332 | Marine | KRYPKKAARPIEIIAEPGNAKATGKPDANAAIIINTNKAKKKCSINYFFKST* |
| Ga0099675_16545982 | 3300006334 | Marine | EIIADPGNAKATGKPDAKAPIIIITSKAKNKCSII* |
| Ga0100224_11536441 | 3300006478 | Marine | PIEIIAEPGNAKATGKPDANAAIIINTSKAKKKCSII* |
| Ga0100224_11665793 | 3300006478 | Marine | PSKRYPKKAARPIEIIAEPGNAKATGKPDANATIIIKTSRDKNKCSIV* |
| Ga0100224_12177871 | 3300006478 | Marine | PKKAARPIEIIAEPGNAKATGKPEASAAIIINTSIVKNRCSII* |
| Ga0101673_10252491 | 3300007137 | Volcanic Co2 Seeps | SPIEIIADPGNAKATGKPEANAPIIMITSKAKNRCSII* |
| Ga0105023_10412543 | 3300007754 | Marine | TSPAKRYPKKAARPIEIIAEPGNAKATGKPEANATIIINTSRDKNKCSII* |
| Ga0111541_100233773 | 3300008097 | Marine | AARPIEIIAEPGNAKATGKPDASAPIIINTNKVKNRCSINYFFKSI* |
| Ga0111541_100925831 | 3300008097 | Marine | KAARPIEIIAEPGNAKATGKPEASAAIIIITSKAKNRCSII* |
| Ga0105348_12095701 | 3300008223 | Methane Seep Mesocosm | YPKKAARPIEIIAEPGNAKATGKPDANATIIINTSRDKNRCSII* |
| Ga0115660_11314181 | 3300008738 | Marine | PIAIIAEPGSAKATGKPDANAAIIINTSIVKNRCSII* |
| Ga0102815_108504071 | 3300009080 | Estuarine | AARPIEIIAEPGSAKATGKPDAKAEIIIITSKAKNKCSIF* |
| Ga0117902_17278511 | 3300009104 | Marine | AIIAEPGSAKATGKPDANAAIIINTSIVKNRCSII* |
| Ga0117922_11537181 | 3300009109 | Marine | IEIMAEPGNAKATGKPDANATIIINTSKAKKKCSII* |
| Ga0118723_11113401 | 3300009126 | Marine | TKAARPIEIMAEPGNAKATGKPDANVAIIINTSKAKKKCSII* |
| Ga0115013_104654872 | 3300009550 | Marine | AARPIEIIAEPGRAKATGKPEPRAEIIIITSKAKNKCSIF* |
| Ga0115011_122359451 | 3300009593 | Marine | PIEIIAEPGNAKATGKPEANAPIIINTSKVKNKCSII* |
| Ga0114933_100560751 | 3300009703 | Deep Subsurface | KAAAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIF* |
| Ga0114933_105864541 | 3300009703 | Deep Subsurface | AFPSKRYPKKAARPIAIIAEPGNAKATGKPEANAAIIISTSRDKNRCSII* |
| Ga0115012_106576722 | 3300009790 | Marine | PSKRYPKKAARPIEIIAEPGNAKATGKPDANATIIINTSKAKKKCSINYFFKST* |
| Ga0115012_111633951 | 3300009790 | Marine | KAARPIEIIAEPGNAKATGKPDANAAIIIITSIVKNRCSII* |
| Ga0138403_11107161 | 3300011326 | Marine | SNKYPKKAANPIDIIAEPGSANATGYPEARATIIIKTKTAKKNSSIL* |
| Ga0160422_107329462 | 3300012919 | Seawater | AAKPIDIIAEPGSANATGYPEARATIIIKTKTAKKKSSIL* |
| Ga0163110_101741203 | 3300012928 | Surface Seawater | PIEIIADPGKAKATGNPEAKAPIIIITSKAKNKCSII* |
| Ga0163111_105759841 | 3300012954 | Surface Seawater | IEIIAEPGKAKATGKPDAKAPIIIITSKAKNKCSMS* |
| Ga0181565_103145392 | 3300017818 | Salt Marsh | KKAASPIEIIADPGKAKATGKPEAKAPIIIITSKAKNKCSII |
| Ga0181579_101277701 | 3300018039 | Salt Marsh | SPIEIIADPGNAKATGKPEANAPIIIITSKAKNKCSII |
| Ga0181592_102972821 | 3300018421 | Salt Marsh | PKKAASPIEIIADPGKAKATGKPEAKAPIIITTSKAKNKCSII |
| Ga0211494_10211071 | 3300020240 | Marine | KNAARPIEIIAEPGKAKATGKPEANAPIIIITSKARNRCSII |
| Ga0211696_10246892 | 3300020252 | Marine | PIEIIADPGNAKATGKPDAKAPIIMITSKAKNKCSII |
| Ga0211667_10042441 | 3300020282 | Marine | SPSKIYPKKAARPIEMIAEPGKAKATGKPEANAPIMIITSKAKNKCSIF |
| Ga0211589_10507912 | 3300020315 | Marine | IEIIAEPGKAKATGKPEANAPIIMITSKARNKCSII |
| Ga0211632_10633552 | 3300020329 | Marine | PIEMIAEPGKAKATGKPEANAPIMIITSKAKNKCSIF |
| Ga0211610_11068201 | 3300020359 | Marine | ARPIEMIAEPGKAKATGKPEANAPIIIITSKAKNKCSIF |
| Ga0211646_102504531 | 3300020383 | Marine | PKKAARPIEIIAEPGNAKATGKPEANAAIIINTSRDKNKCSII |
| Ga0211590_101458412 | 3300020387 | Marine | VAKYALTFPSKRYPKKAARPIEIIAEPGNAKATGKPEASAAIIINTSIVKNRCSII |
| Ga0211590_101475242 | 3300020387 | Marine | SPSKRYPKKAARPIEIIAEPGKAKATGKPEANAPIIMITSKARNKCSII |
| Ga0211705_100340813 | 3300020395 | Marine | PKKAAAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIV |
| Ga0211705_103594041 | 3300020395 | Marine | YPKKAARPIEIIAEPGKAKATGKPEANAPIIIITSKARNKCSII |
| Ga0211499_101941962 | 3300020402 | Marine | VAKYALALPSKRYPKKAARPIDMIAEPGNAKATGKPDANAAIMINTSKDKNKCSIV |
| Ga0211496_102825812 | 3300020405 | Marine | PIEIIAEPGKAKATGKPEANAPIIMITSKARNKCSII |
| Ga0211557_104432751 | 3300020418 | Marine | PKKAARPIEIIAEPGNAKATGKPDANATIIINTSIDKNRCSII |
| Ga0211581_104130241 | 3300020429 | Marine | SPIEIIADPGNAKATGKPEANAPIIIITSKAKNKCSIF |
| Ga0211554_101013443 | 3300020431 | Marine | ARPIEIIAEPGKAKATGKPDANAPIIIITSKAKNKCSIF |
| Ga0211518_101963951 | 3300020440 | Marine | PSKRYPKKAAAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIV |
| Ga0211473_103247572 | 3300020451 | Marine | LTSPSKRYPKKAARPIEIIAEPGNAKATGKPEASAAIIIITSKAKNRCSII |
| Ga0211473_105860801 | 3300020451 | Marine | FPSKRYPKNAARPIEIMAEPGNAKATGNPEANAPIIINTSKVKNKCSII |
| Ga0211550_100681441 | 3300020453 | Marine | AARPIEIIAEPGKAKATGKPEANAPIIIITSKARNRCSII |
| Ga0211548_103278521 | 3300020454 | Marine | HSFGPSVAKYAPTSPSNRYPKKAARPIEIMAEPGNAKATGKPDASATIIIKTSKDKNKCSINYFFKST |
| Ga0211548_103840962 | 3300020454 | Marine | PSKRYPKKAAAPIEMIAEPGNAKATGKPDANATIIIKTSRDKNKCSIV |
| Ga0211664_102976681 | 3300020455 | Marine | RYPKKAAKPIAIIAEPGNAKATGKPEANAAIIISTSRDKNRCSII |
| Ga0211551_103529511 | 3300020456 | Marine | ALALPSKRYPKKAARPIDMIAEPGNAKATGKPDANAAIMINTSKDKNKCSII |
| Ga0211546_101724541 | 3300020462 | Marine | IEIIAEPGKAKATGKPDAKAPIIIITSKAKNKCSMS |
| Ga0211714_100498201 | 3300020466 | Marine | LPSKRYPKKAARPIDMIAEPGNAKATGKPDANAAIMINTSKDKNKCSII |
| Ga0211714_104338302 | 3300020466 | Marine | KNDARPIEIIAEPGNAKATGKPDASATIIINTSKVKNKCSIV |
| Ga0211543_104091191 | 3300020470 | Marine | KKAAAPIEIIAEPGNAKATGKPDANATIIIKTRRDKNKCSMV |
| Ga0211579_106841521 | 3300020472 | Marine | PIETIAEPGKAKATGKPEANAPIIIITSKARNRCSII |
| Ga0211541_103847932 | 3300020475 | Marine | KRYPKKAAKPIAIIAEPGNAKATGKPEANAAIIISTSKDKNKCSII |
| Ga0211540_10369892 | 3300020584 | Marine | PKKAASPIEIIADPGNAKATGKPDAKAPIIIITSKAKNKCSII |
| Ga0206126_100859593 | 3300020595 | Seawater | PIEIIAEPGRAKATGKPEAKAEIIINTSKAKNKCSIF |
| Ga0206123_103110012 | 3300021365 | Seawater | AARPIDIIAEPGSAKATGKPEASAEIIIITSKAKNKCSIF |
| Ga0255758_101058733 | 3300022928 | Salt Marsh | AARPIEIIADPGKAKATGKPEAKAPIIIITSKAKNKCSII |
| (restricted) Ga0233432_101807761 | 3300023109 | Seawater | SPIEIIAEPGRAKATGKPDANAAIIMITSKAKNKCSII |
| Ga0255759_103131822 | 3300023178 | Salt Marsh | RKAASPIEIMAEPGSAKATGKPDANAAIIIITSKAKKKCSIF |
| Ga0255768_102635322 | 3300023180 | Salt Marsh | PKNAARPIEIIAEPGNAKATGNPDASAIIIINTSNDKNKCSIVYFFKS |
| Ga0228655_10369391 | 3300024236 | Seawater | IDIIAEPGSAKATGKPEASAEIIIITSKAKNKCSIF |
| Ga0228656_11095081 | 3300024322 | Seawater | PVNAARPIEIIAEPGRAKATGKPEPRAEIIIITSKAKNKCSIF |
| Ga0228671_11187932 | 3300024334 | Seawater | NAARPIEIIAEPGSAKATGKPEARAEIIIITSKAKNKCSIF |
| Ga0208547_11737781 | 3300025828 | Aqueous | RPIEIIAEPGRAKATGKPEAKAEIIINTSKAKNKCSIF |
| Ga0207990_10370343 | 3300026262 | Marine | KKAARPIEIIAEPGNAKATGKPDANAAIIISTSRAKKKFSII |
| Ga0207992_11345131 | 3300026263 | Marine | KRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIATSRAKKKCSIN |
| Ga0208766_10308833 | 3300026269 | Marine | LTSPAKRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIITSRDKNKCSII |
| Ga0208411_11760891 | 3300026279 | Marine | AKRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIITSRDKNKFSII |
| Ga0208764_101248383 | 3300026321 | Marine | RYPIKAARPIETIAEPGKAKATGKPEANAPIIMITSKAKKKCSII |
| Ga0208764_103265622 | 3300026321 | Marine | KRYPKKAARPIEIIAEPGNAKATGKPDANAAIIIITSKDKNKFSII |
| Ga0208947_10901131 | 3300027553 | Marine | LASPSKRYPKKAARPIEIIAEPGNAKATGKPDASAVIIIITSSDKNKCSMI |
| Ga0209752_10176341 | 3300027699 | Marine | KRYPKKAARPIEIIAEPGNAKATGKPEANATIIINTSSDKNRCSII |
| Ga0209359_100684143 | 3300027830 | Marine | IDIIADPGSAKATGNPEARAEIIIITSKAKNKCSIF |
| Ga0209359_105603011 | 3300027830 | Marine | KAASPIEIIADPGNAKATGKPEANAPIIIITSNAKNKCSII |
| Ga0228642_11510412 | 3300028131 | Seawater | IEIIAEPGSAKATGKPEARAEIIIITSKAKNKCSIF |
| Ga0315328_103726802 | 3300031757 | Seawater | KAARPIEIIAEPGNAKATGKPDASAAIMIITSSDKNKCSMI |
| Ga0315322_101508833 | 3300031766 | Seawater | YPMKAARPIVIIAEPGKAKATGKPDANAEIIMITSKDKNKCSIF |
| Ga0315322_103583472 | 3300031766 | Seawater | SKRYPKKAARPIEIIAEPGNAKATGKPEANAAIIINTSRDKNKCSII |
| Ga0315331_102840071 | 3300031774 | Seawater | KKAARPIEIIAEPGNAKATGKPEANAAIIIITSKAKNKCSIY |
| Ga0315331_103442822 | 3300031774 | Seawater | SPSKRYPKKAAAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIV |
| Ga0315331_107370242 | 3300031774 | Seawater | KAASPIEIIAEPGRAKATGKPDANAAIIMITSKAKNKCSII |
| Ga0315320_101055521 | 3300031851 | Seawater | AARPMEIIAEPGSAKATGNPEARAEIIIITSKAKNKCSIF |
| Ga0310344_102275201 | 3300032006 | Seawater | RPIEIIAEPGNAKATGNPDANAAIIINTSRDKNRCSII |
| Ga0315316_103211061 | 3300032011 | Seawater | PNKAAAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIV |
| Ga0315316_109421081 | 3300032011 | Seawater | AARPIEIIAEPGSAKATGKPEARAEIIIITSKAKNKCSIF |
| Ga0315327_102035422 | 3300032032 | Seawater | AAPIEIIAEPGNAKATGKPDANATIIIKTSKDKNKCSIV |
| Ga0315315_117529801 | 3300032073 | Seawater | PIDIIADPGSAKATGNPEARAEIIIITSKAKNKCSIF |
| Ga0315321_103117162 | 3300032088 | Seawater | RYPKKAARPIEIIAEPGNAKATGKPEASAAIIIITSSDKNKCSMI |
| ⦗Top⦘ |