Metagenome Family F089143

Overview

Basic Information

• Family ID: F089143
• Family Type: Metagenome
• Number of Sequences: 109
• Average Sequence Length: 41 residues
• Representative Sequence: LTDTTLKIKHTLAMSEGDKAAGGPLSRPTPRVDAEDDEP
• Number of Associated Samples: 92
• Number of Associated Scaffolds: 109

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.92 %
• % of genes near scaffold ends (potentially truncated): 97.25 %
• % of genes from short scaffolds (< 2000 bps): 95.41 %
• Associated GOLD sequencing projects: 84
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (97.248 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.927 % of family members)
• Environment Ontology (ENVO): Unclassified (54.128 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (62.385 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF00588	SpoU_methylase	6.42
PF00990	GGDEF	0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	6.42
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	6.42
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	6.42

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.25 %
Unclassified	root	N/A	2.75 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.25 %
Unclassified	root	N/A	2.75 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.25 %
Unclassified	root	N/A	2.75 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	95.41 %
Unclassified	root	N/A	2.75 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	2.75 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.92 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459019|G14TP7Y02GZUXB	All Organisms → cellular organisms → Bacteria → Acidobacteria	702
3300000033|ICChiseqgaiiDRAFT_c0869307	All Organisms → cellular organisms → Bacteria → Acidobacteria	650
3300000550|F24TB_11241445	All Organisms → cellular organisms → Bacteria → Acidobacteria	1745
3300000953|JGI11615J12901_10417766	All Organisms → cellular organisms → Bacteria → Acidobacteria	862
3300000955|JGI1027J12803_105156408	All Organisms → cellular organisms → Bacteria → Acidobacteria	737
3300003321|soilH1_10233781	All Organisms → cellular organisms → Bacteria → Acidobacteria	3591
3300005330|Ga0070690_101592278	All Organisms → cellular organisms → Bacteria → Acidobacteria	529
3300005335|Ga0070666_10528689	All Organisms → cellular organisms → Bacteria → Acidobacteria	857
3300005364|Ga0070673_100539412	All Organisms → cellular organisms → Bacteria → Acidobacteria	1059
3300005365|Ga0070688_101126220	All Organisms → cellular organisms → Bacteria → Acidobacteria	628
3300005444|Ga0070694_101131215	All Organisms → cellular organisms → Bacteria → Acidobacteria	654
3300005445|Ga0070708_101522333	All Organisms → cellular organisms → Bacteria → Acidobacteria	623
3300005466|Ga0070685_11457933	All Organisms → cellular organisms → Bacteria → Acidobacteria	526
3300005518|Ga0070699_101278923	All Organisms → cellular organisms → Bacteria → Acidobacteria	673
3300005577|Ga0068857_101015843	All Organisms → cellular organisms → Bacteria → Acidobacteria	799
3300005578|Ga0068854_100651511	All Organisms → cellular organisms → Bacteria → Acidobacteria	904
3300005614|Ga0068856_102279479	All Organisms → cellular organisms → Bacteria → Acidobacteria	550
3300005615|Ga0070702_101189106	All Organisms → cellular organisms → Bacteria → Acidobacteria	614
3300005617|Ga0068859_100142267	Not Available	2472
3300005617|Ga0068859_100170725	All Organisms → cellular organisms → Bacteria	2255
3300005617|Ga0068859_100665746	All Organisms → cellular organisms → Bacteria → Acidobacteria	1132
3300005840|Ga0068870_10504557	All Organisms → cellular organisms → Bacteria → Acidobacteria	807
3300005840|Ga0068870_11468353	All Organisms → cellular organisms → Bacteria → Acidobacteria	501
3300005841|Ga0068863_101706352	All Organisms → cellular organisms → Bacteria → Acidobacteria	639
3300005841|Ga0068863_102350697	All Organisms → cellular organisms → Bacteria → Acidobacteria	543
3300005842|Ga0068858_100696127	All Organisms → cellular organisms → Bacteria → Acidobacteria	989
3300005937|Ga0081455_10823931	All Organisms → cellular organisms → Bacteria → Acidobacteria	581
3300006058|Ga0075432_10283014	All Organisms → cellular organisms → Bacteria → Acidobacteria	683
3300006194|Ga0075427_10097612	All Organisms → cellular organisms → Bacteria → Acidobacteria	544
3300006237|Ga0097621_102305685	All Organisms → cellular organisms → Bacteria → Acidobacteria	515
3300006755|Ga0079222_10316258	All Organisms → cellular organisms → Bacteria → Acidobacteria	1031
3300006755|Ga0079222_12157705	All Organisms → cellular organisms → Bacteria → Acidobacteria	553
3300006844|Ga0075428_101580812	All Organisms → cellular organisms → Bacteria → Acidobacteria	686
3300006854|Ga0075425_100634285	All Organisms → cellular organisms → Bacteria → Acidobacteria	1228
3300006880|Ga0075429_101758621	Not Available	538
3300006918|Ga0079216_10041836	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1924
3300009011|Ga0105251_10149231	All Organisms → cellular organisms → Bacteria → Acidobacteria	1056
3300009093|Ga0105240_11413268	All Organisms → cellular organisms → Bacteria → Acidobacteria	731
3300009098|Ga0105245_10192107	All Organisms → cellular organisms → Bacteria → Acidobacteria	1956
3300009101|Ga0105247_10433493	All Organisms → cellular organisms → Bacteria → Acidobacteria	944
3300009156|Ga0111538_11231220	All Organisms → cellular organisms → Bacteria → Acidobacteria	946
3300009162|Ga0075423_12394575	Not Available	575
3300009177|Ga0105248_10493101	All Organisms → cellular organisms → Bacteria → Acidobacteria	1381
3300009177|Ga0105248_11683487	All Organisms → cellular organisms → Bacteria → Acidobacteria	719
3300009789|Ga0126307_11747729	All Organisms → cellular organisms → Bacteria → Acidobacteria	506
3300010037|Ga0126304_11263107	All Organisms → cellular organisms → Bacteria → Acidobacteria	507
3300010047|Ga0126382_10412372	All Organisms → cellular organisms → Bacteria → Acidobacteria	1058
3300010371|Ga0134125_11756707	All Organisms → cellular organisms → Bacteria → Acidobacteria	675
3300010375|Ga0105239_10748192	All Organisms → cellular organisms → Bacteria → Acidobacteria	1119
3300010397|Ga0134124_10271880	All Organisms → cellular organisms → Bacteria → Acidobacteria	1568
3300010397|Ga0134124_10558480	All Organisms → cellular organisms → Bacteria → Acidobacteria	1116
3300010397|Ga0134124_13184011	All Organisms → cellular organisms → Bacteria → Acidobacteria	503
3300010398|Ga0126383_12609059	All Organisms → cellular organisms → Bacteria → Acidobacteria	589
3300010403|Ga0134123_13444315	All Organisms → cellular organisms → Bacteria → Acidobacteria	511
3300011119|Ga0105246_12366071	All Organisms → cellular organisms → Bacteria → Acidobacteria	520
3300011119|Ga0105246_12375814	All Organisms → cellular organisms → Bacteria → Acidobacteria	519
3300012021|Ga0120192_10156493	All Organisms → cellular organisms → Bacteria → Acidobacteria	502
3300012045|Ga0136623_10329883	All Organisms → cellular organisms → Bacteria → Acidobacteria	646
3300012205|Ga0137362_10375684	All Organisms → cellular organisms → Bacteria → Acidobacteria	1231
3300012212|Ga0150985_111818873	All Organisms → cellular organisms → Bacteria → Acidobacteria	674
3300012363|Ga0137390_10446592	All Organisms → cellular organisms → Bacteria → Acidobacteria	1269
3300012927|Ga0137416_10878422	All Organisms → cellular organisms → Bacteria → Acidobacteria	796
3300012958|Ga0164299_11615470	All Organisms → cellular organisms → Bacteria → Acidobacteria	511
3300012989|Ga0164305_11350596	All Organisms → cellular organisms → Bacteria → Acidobacteria	625
3300013100|Ga0157373_10567525	All Organisms → cellular organisms → Bacteria → Acidobacteria	824
3300013102|Ga0157371_10424259	All Organisms → cellular organisms → Bacteria → Acidobacteria	975
3300013102|Ga0157371_11265385	All Organisms → cellular organisms → Bacteria → Acidobacteria	570
3300013297|Ga0157378_10374506	All Organisms → cellular organisms → Bacteria → Acidobacteria	1397
3300013307|Ga0157372_12971196	All Organisms → cellular organisms → Bacteria → Acidobacteria	542
3300013760|Ga0120188_1024099	All Organisms → cellular organisms → Bacteria → Acidobacteria	657
3300014326|Ga0157380_10121140	All Organisms → cellular organisms → Bacteria	2216
3300014968|Ga0157379_10071988	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	3093
3300017695|Ga0180121_10325117	All Organisms → cellular organisms → Bacteria → Acidobacteria	587
3300018076|Ga0184609_10130536	All Organisms → cellular organisms → Bacteria → Acidobacteria	1147
3300021073|Ga0210378_10052786	All Organisms → cellular organisms → Bacteria → Acidobacteria	1603
3300021290|Ga0213902_105725	All Organisms → cellular organisms → Bacteria → Acidobacteria	575
3300025911|Ga0207654_10379563	All Organisms → cellular organisms → Bacteria → Acidobacteria	979
3300025927|Ga0207687_11054528	All Organisms → cellular organisms → Bacteria → Acidobacteria	698
3300025936|Ga0207670_10708804	All Organisms → cellular organisms → Bacteria → Acidobacteria	834
3300025941|Ga0207711_10767642	All Organisms → cellular organisms → Bacteria → Acidobacteria	898
3300025941|Ga0207711_11967932	All Organisms → cellular organisms → Bacteria → Acidobacteria	527
3300025945|Ga0207679_11279491	All Organisms → cellular organisms → Bacteria → Acidobacteria	673
3300025960|Ga0207651_11003731	All Organisms → cellular organisms → Bacteria → Acidobacteria	746
3300025972|Ga0207668_11758145	All Organisms → cellular organisms → Bacteria → Acidobacteria	560
3300025981|Ga0207640_10354730	All Organisms → cellular organisms → Bacteria → Acidobacteria	1179
3300025981|Ga0207640_10807922	All Organisms → cellular organisms → Bacteria → Acidobacteria	813
3300026035|Ga0207703_11096960	All Organisms → cellular organisms → Bacteria → Acidobacteria	764
3300026088|Ga0207641_10444393	All Organisms → cellular organisms → Bacteria → Acidobacteria	1252
3300026089|Ga0207648_10353012	All Organisms → cellular organisms → Bacteria → Acidobacteria	1326
3300026116|Ga0207674_12104367	All Organisms → cellular organisms → Bacteria → Acidobacteria	528
3300026118|Ga0207675_101551804	All Organisms → cellular organisms → Bacteria → Acidobacteria	683
3300026118|Ga0207675_102452401	All Organisms → cellular organisms → Bacteria → Acidobacteria	533
3300027691|Ga0209485_1102157	All Organisms → cellular organisms → Bacteria → Acidobacteria	809
3300027718|Ga0209795_10038881	All Organisms → cellular organisms → Bacteria → Acidobacteria	1506
3300027718|Ga0209795_10193118	All Organisms → cellular organisms → Bacteria → Acidobacteria	572
3300028380|Ga0268265_12034873	All Organisms → cellular organisms → Bacteria → Acidobacteria	581
3300028381|Ga0268264_11127804	All Organisms → cellular organisms → Bacteria → Acidobacteria	793
3300028381|Ga0268264_11701267	All Organisms → cellular organisms → Bacteria → Acidobacteria	641
3300030511|Ga0268241_10131931	All Organisms → cellular organisms → Bacteria → Acidobacteria	600
3300031847|Ga0310907_10731371	All Organisms → cellular organisms → Bacteria → Acidobacteria	549
3300031908|Ga0310900_11876287	All Organisms → cellular organisms → Bacteria → Acidobacteria	511
3300031911|Ga0307412_10616310	All Organisms → cellular organisms → Bacteria → Acidobacteria	921
3300031913|Ga0310891_10041961	All Organisms → cellular organisms → Bacteria → Acidobacteria	1251
3300031913|Ga0310891_10343220	All Organisms → cellular organisms → Bacteria → Acidobacteria	534
3300032003|Ga0310897_10508043	All Organisms → cellular organisms → Bacteria → Acidobacteria	585
3300032012|Ga0310902_10711726	All Organisms → cellular organisms → Bacteria → Acidobacteria	677
3300032211|Ga0310896_10415749	All Organisms → cellular organisms → Bacteria → Acidobacteria	721
3300033412|Ga0310810_11016059	All Organisms → cellular organisms → Bacteria → Acidobacteria	706
3300033412|Ga0310810_11491551	All Organisms → cellular organisms → Bacteria → Acidobacteria	503

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	55.05%
Environmental	Environmental	44.04%
Engineered	Engineered	0.92%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.05%
Terrestrial	Environmental → Terrestrial	40.37%
Aquatic	Environmental → Aquatic	3.67%
Solid Waste	Engineered → Solid Waste	0.92%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	40.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.28%
Rhizoplane	Host-Associated → Plants → Rhizoplane	22.02%
Freshwater	Environmental → Aquatic → Freshwater	2.75%
Phylloplane	Host-Associated → Plants → Phylloplane	1.83%
Sediment	Environmental → Aquatic → Sediment	0.92%
Roots	Host-Associated → Plants → Roots	0.92%
Grass	Engineered → Solid Waste → Grass	0.92%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.69%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	21.10%
Loam	Environmental → Terrestrial → Soil → Loam	8.26%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.59%
Ice	Environmental → Aquatic → Freshwater → Ice	1.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	1.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.92%
Composting	Engineered → Solid Waste → Grass → Composting	0.92%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	21.10%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.35%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.34%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.42%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.59%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.75%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.92%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.92%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.92%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.92%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	11.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.42%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	5.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.59%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.67%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.67%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.75%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.83%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.83%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	1.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.83%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	1.83%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.92%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.92%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.92%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.92%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.92%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.92%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.92%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459019	Litter degradation MG4	Engineered
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300003321	Sugarcane bulk soil Sample H1	Environmental
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300012021	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1	Environmental
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental
3300021290	Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Cave_2	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental
3300027718	Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4MG_01964680	2170459019	Switchgrass, Maize And Mischanthus Litter	TSLKIKHTIPMSEGDKTAGLLSRPTPKVDAEDDEP
ICChiseqgaiiDRAFT_08693072	3300000033	Soil	TTLKIKHTLAMTEGERGVGNPLTRPTPRVESEDDEP*
F24TB_112414452	3300000550	Soil	VVFVDTNLQIKHKLAMTEGDKAAGSPLSRPTPRVDAEDDEPR*
JGI11615J12901_104177661	3300000953	Soil	ANLKIQHKLAMTEGDKGAGGPLARPTPRVDSEDDEP*
JGI1027J12803_1051564081	3300000955	Soil	IVFVDTNLKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP*
soilH1_102337812	3300003321	Sugarcane Root And Bulk Soil	LVMMDTTLKIKHTLAMTESDKGSGNPLTRPTPRVESEDDEP*
Ga0070690_1015922782	3300005330	Switchgrass Rhizosphere	DKEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPLN*
Ga0070666_105286891	3300005335	Switchgrass Rhizosphere	SIADKEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPHD*
Ga0070673_1005394121	3300005364	Switchgrass Rhizosphere	TDTTLKIKHTIVKSEGDKGAGGPLSRPTPRVDAEDDEP*SIRK*
Ga0070688_1011262201	3300005365	Switchgrass Rhizosphere	FVDTNLKIKHSLAMTEGERTAGAPSARPTPRVDAEDDEP*
Ga0070694_1011312151	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VLTDTSLKIKHTIAMSENDRTGGPLSRPTPRVDSEDDEP*
Ga0070708_1015223332	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	EKEVVFMDANLKIKHTLAMTESERVSGSPLGRPTPRVDSEDDEP*
Ga0070685_114579331	3300005466	Switchgrass Rhizosphere	EIVFVDTNLKIKHTLAMTEGERTASSPTTRPTPRVDAEDDEPQL*
Ga0070699_1012789231	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	LIDTNLKIKHNLAMSEGERGSTNPLTRPTPNVDVDDEPDD*
Ga0068857_1010158431	3300005577	Corn Rhizosphere	SQKELVLTDTSLKIKHTIAMSESDKGTGPLSRPTPRVDSEDDEP*
Ga0068854_1006515112	3300005578	Corn Rhizosphere	ELVLLDATLKIQHKITMSEGDKSLGSPLTRPTPRVDAEDDEP*
Ga0068856_1022794792	3300005614	Corn Rhizosphere	DTTLKIKHTLPMTEGEKGAGPLSRPTPRVDAEDDEP*
Ga0070702_1011891061	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	ELVLMDTSLKIKHILPMTEGDKTAGGPMSRPTPRVDSEDDEP*
Ga0068859_1001422676	3300005617	Switchgrass Rhizosphere	SEKELVVMDATLKITHKLTMSEGDKSLGSPLARPTPRVDSEDDEP*
Ga0068859_1001707255	3300005617	Switchgrass Rhizosphere	LVVVDTSLKIKHILPMTEGDKTSGPLTRPTPRVDSEDDEP*
Ga0068859_1006657463	3300005617	Switchgrass Rhizosphere	DTSLKIKHILPMTEGDKTAGGPMSRPTPRVDSEDDEP*
Ga0068870_105045572	3300005840	Miscanthus Rhizosphere	VLTDTSLKIKHTLAMSEGDKTASGLTARPTPRVDAEDDEP*
Ga0068870_114683531	3300005840	Miscanthus Rhizosphere	NLKITHKLPMTEGDKNFGNPLARPTPRVESEDDEP*
Ga0068863_1017063522	3300005841	Switchgrass Rhizosphere	KEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPLN*
Ga0068863_1023506972	3300005841	Switchgrass Rhizosphere	SISDKELVLTDTSLKIKHSLAMTEGDKSAGALSRPTPRVDAEDDEP*
Ga0068858_1006961272	3300005842	Switchgrass Rhizosphere	DTSLKIKHILPMTEGDKTSGPLTRPTPRVDSEDDEP*
Ga0081455_108239312	3300005937	Tabebuia Heterophylla Rhizosphere	LTDTTLKIKHTIAMSEPDKGSGPLSRPTPRVDAEDDEP*
Ga0075432_102830142	3300006058	Populus Rhizosphere	SLKIKHSLAKTEGDKSTGALSRPTPRVDSEDDEP*
Ga0075427_100976122	3300006194	Populus Rhizosphere	TDTSLKIKHSLAMSEGDKSAGALSRPTPRVDAEDDEP*
Ga0097621_1023056851	3300006237	Miscanthus Rhizosphere	LKIKHTLAMTEGDKALGNPLTRPTPRVEAEDDEP*
Ga0079222_103162581	3300006755	Agricultural Soil	VLTDTTLKIKHTLKMAEAEKGVGPLSRPTPRVDSEDDEP*
Ga0079222_121577051	3300006755	Agricultural Soil	KEVVFMDANLKIKHTLAMTEGERVSGAPLGRPTPRVDSEDDEP*
Ga0075428_1015808121	3300006844	Populus Rhizosphere	TLKIKHTIAMSEGDKSAGPLARPTPRVDAEDDEP*
Ga0075425_1006342851	3300006854	Populus Rhizosphere	IKHTLTMTEGERAASSPAARPTPRVDAEDDEPQR*
Ga0075429_1017586212	3300006880	Populus Rhizosphere	KELVLTDTTLKIKHTIAMSEGDKAAGGPLSRPTPRVDAEDDEP*
Ga0079216_100418364	3300006918	Agricultural Soil	MDTTLKIKHTLAMSEGDKNVNNPLMRPTPRVEVEDDEP*
Ga0105251_101492311	3300009011	Switchgrass Rhizosphere	ISEKELVVVDTSLKIKHVLPMTEGDKGSGPMSRPTPRVDSEDDEP*
Ga0105240_114132681	3300009093	Corn Rhizosphere	VFVDTNLKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP*
Ga0105245_101921071	3300009098	Miscanthus Rhizosphere	TSIADKEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPHD*
Ga0105247_104334932	3300009101	Switchgrass Rhizosphere	LKIKHTLAMSEGDKTASGLTARPTPRVDAEDDEP*
Ga0111538_112312201	3300009156	Populus Rhizosphere	SIADKEIVFTDTNLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPQN*
Ga0075423_123945752	3300009162	Populus Rhizosphere	VMTDTNLRIKHTLAMTEGDKGLNNPLTRPTPRVEAEDDEP*
Ga0105248_104931011	3300009177	Switchgrass Rhizosphere	SLKIKHILPMSEGDKGSGPLSRPTPRVDSEDDEP*
Ga0105248_116834871	3300009177	Switchgrass Rhizosphere	LKIKHSLAMTEGERAAGSPSSRPTPRVDAEDDEP*
Ga0126307_117477292	3300009789	Serpentine Soil	VMMDTTLKIKHTLAMTEGEKGFGNPLNRPTPRVESEDDEP*
Ga0126304_112631072	3300010037	Serpentine Soil	SEKEVVMVDTSLKIKHTIAMSEGDKGVGPLSRPPPRVDAEDDEP*
Ga0126382_104123721	3300010047	Tropical Forest Soil	SLKIKHSLAMTEGDKSGGPLSRPTPRVDSEDDEP*
Ga0134125_117567071	3300010371	Terrestrial Soil	NLKIQHKLKMSEGDKSFGSPLSRPTPRVDAEDDEP*
Ga0105239_107481922	3300010375	Corn Rhizosphere	TNLKIKHTLAMTEGERTASSPTTRPTPRVDAEDDEPQL*
Ga0134124_102718804	3300010397	Terrestrial Soil	VMMDTNLKIKHTLAMTESDKALGNPLTRPTPRVEAEDDEP*
Ga0134124_105584801	3300010397	Terrestrial Soil	DKELVLTDTSLKIKHTIAMTEGDKSAGPLSRPTPRVDSEDDEP*
Ga0134124_131840112	3300010397	Terrestrial Soil	LKIKHTLAMTEGDKNASNPLARPTPRVESEDDEP*
Ga0126383_126090592	3300010398	Tropical Forest Soil	DKELVLTDTTLKIKHTLKMTEADKGAGPLSRPTPRVDAEDDEP*
Ga0134123_134443152	3300010403	Terrestrial Soil	ISQKELVLTDTSLKIKHTIAMSESDKNAGPLSRPTPRVDSEDDEP*
Ga0105246_123660711	3300011119	Miscanthus Rhizosphere	VLVDTTLKIKHNLAMTEGDKNPTSPLNRPTPKVDAEDDEP*
Ga0105246_123758141	3300011119	Miscanthus Rhizosphere	ISEKEIVFIDNNLKIKHNIAMTEGERVAGSPSARPTPRVDAEDDEP*
Ga0120192_101564931	3300012021	Terrestrial	SEKELVVVDTSLKIEHTLPFTTERERGLGPSSRPTPRVDSEDDEP*
Ga0136623_103298832	3300012045	Polar Desert Sand	RLTSISDTELVIMDTTLKIKHTLAMTTDTTKGFGPQARPTPKVDSEDDEP*
Ga0137362_103756843	3300012205	Vadose Zone Soil	DTNLKIRHNLAMIEGEKGSGPLSRPTPAVVEVDDEP*
Ga0150985_1118188732	3300012212	Avena Fatua Rhizosphere	VVVDTSLKIKHVLPMTEGDKAGGPLARPTPRVDSEDDEP*
Ga0137390_104465921	3300012363	Vadose Zone Soil	SDRELVLVDTNLKIRHNLTMMEGEKGSGPLSRPTPAVVDVDDEP*
Ga0137416_108784222	3300012927	Vadose Zone Soil	DTNLKIRHNLSMVEGEKGSGPLSRPTPAVVEVDDEP*
Ga0164299_116154701	3300012958	Soil	DTTLKIKHTLAMTEGDKSFGNPLTRPTPRVESEDDEP*
Ga0164305_113505961	3300012989	Soil	KEVLFMDANLKIKHTLAMTEGERVSGAPLGRPTPRVDSEDDEP*
Ga0157373_105675252	3300013100	Corn Rhizosphere	TTLKIKHTLAMTEGDKSASNPLARPTPRVESEDDEP*
Ga0157371_104242591	3300013102	Corn Rhizosphere	KELVLTDTSLKIKHTLAMSEGDKTASGLTARPTPRVDAEDDEP*
Ga0157371_112653851	3300013102	Corn Rhizosphere	LKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP*
Ga0157378_103745063	3300013297	Miscanthus Rhizosphere	LTDTTLKIKHTLAMSEGDKAAGGPLSRPTPRVDAEDDEP*
Ga0157372_129711961	3300013307	Corn Rhizosphere	KELVMMDTTLKIKHTLAMTEGDKSASNPLARPTPRVESEDDEP*
Ga0120188_10240991	3300013760	Terrestrial	KELVLVDTTLKIKHTIAMSEGDKSAGPLARPTPRVDAEDDEP*
Ga0157380_101211405	3300014326	Switchgrass Rhizosphere	KEIVFVDTNLKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP*
Ga0157379_100719885	3300014968	Switchgrass Rhizosphere	VLTDTSLKIKHSIPMSEGDKTAGGPLSRPTPRVDAEDDEP*
Ga0180121_103251171	3300017695	Polar Desert Sand	EQEILLIDTTLKIKHTLVMTTDQNKGFGPQSRPTPKVESEDDEP
Ga0184609_101305361	3300018076	Groundwater Sediment	ISDNELVLVDTTLKIKHTLAMTTDQNKGFGPQSRPTPKVDSEDDEP
Ga0210378_100527861	3300021073	Groundwater Sediment	TSISDNELVLVDTTLKIKHTLAMTTDQNKGFGPQSRPTPKVDSEDDEP
Ga0213902_1057251	3300021290	Soil	ELVLTDTNLKIKHTLTMTEGEKGAGPLSRPTPRVDAEDDEP
Ga0207654_103795631	3300025911	Corn Rhizosphere	VLTDTSLKIKHTIAMSESDKGAGALSRPTPRVDSEDDEP
Ga0207687_110545282	3300025927	Miscanthus Rhizosphere	ELVLTDTSLKIKHTIAMTESDKGSGPLSRPTPRVDSEDDEP
Ga0207670_107088041	3300025936	Switchgrass Rhizosphere	RLTSIADKEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPHD
Ga0207711_107676421	3300025941	Switchgrass Rhizosphere	IVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPHD
Ga0207711_119679322	3300025941	Switchgrass Rhizosphere	SDKEIVFVDTNLKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP
Ga0207679_112794912	3300025945	Corn Rhizosphere	VDTNLKIKHSLAMTEGERTAGSPIARPTPRVDSEDDEP
Ga0207651_110037312	3300025960	Switchgrass Rhizosphere	LTDTTLKIKHTIVKSEGDKSAGGPLSRPTPRVDAEDDEP
Ga0207668_117581451	3300025972	Switchgrass Rhizosphere	SISQKELVLTDTSLKIKHTIAMSESDKGAGALSRPTPRVDSEDDEP
Ga0207640_103547301	3300025981	Corn Rhizosphere	ELVLLDATLKIQHKITMSEGDKSLGSPLTRPTPRVDAEDDEP
Ga0207640_108079221	3300025981	Corn Rhizosphere	TLKLTQKIKMTEGEKGFGSPLSRPTPRVDAEDDEPHD
Ga0207703_110969602	3300026035	Switchgrass Rhizosphere	VDTNLKIKHTLAMTEGERTASSPTTRPTPRVDAEDDEPQL
Ga0207641_104443931	3300026088	Switchgrass Rhizosphere	EKELVLTDTSLKIKHSIPMSEGDKTAGGPLSRPTPRVDAEDDEP
Ga0207648_103530121	3300026089	Miscanthus Rhizosphere	TSISDKELVLTDTTLKIKHTIAMSEGDKGAGGPLSRPTPRVDAEDDEP
Ga0207674_121043672	3300026116	Corn Rhizosphere	LVVVDTSLKIKHILPMTEGDKTAGGPMSRPTPRVDSEDDEP
Ga0207675_1015518042	3300026118	Switchgrass Rhizosphere	LTDTSLKIKHTIAMTESDKGSGPLSRPTPRVDSEDDEP
Ga0207675_1024524011	3300026118	Switchgrass Rhizosphere	VLTDTTLKIKHTIAMSEPDKGSGPLSRPTPRVDAEDDEP
Ga0209485_11021572	3300027691	Agricultural Soil	ISDKELVLMDSNLKIQHKLAMSEGDKGFGSPLSRPTPRVDAEDDEP
Ga0209795_100388811	3300027718	Agave	LVLVDTSLKIKHVLPMTESDKGSGPLSRPTPRVDAEDDEP
Ga0209795_101931181	3300027718	Agave	SDKELVLTDTTLKIKHSIAMSEGDKGAGPLTRPTPRVDAEDDEP
Ga0268265_120348731	3300028380	Switchgrass Rhizosphere	DTSLKIKHILPMTEGDKTAGGPLARPTPRVDSEDDEP
Ga0268264_111278041	3300028381	Switchgrass Rhizosphere	VFLDANLKIKHTLAMTEGEKVSGAPLGRPTPRVDAEDDEP
Ga0268264_117012671	3300028381	Switchgrass Rhizosphere	DTSLKIKHSIPMSEGDKTAGGPLSRPTPRVDAEDDEP
Ga0268241_101319311	3300030511	Soil	KELVMTDTTLKIKHTLAMTEGDKNAGNPLTRPTPRVESEDDEP
Ga0310907_107313711	3300031847	Soil	LDATLKIQHKITMSEGDKSLGSPLTRPTPRVDAEDDEP
Ga0310900_118762872	3300031908	Soil	TDTSLKIKHTLAMSEGDKTASGLTARPTPRVDAEDDEP
Ga0307412_106163101	3300031911	Rhizosphere	TTLKIKHTIAMSEGDKAGGPLTRPTPRVDAEDDEP
Ga0310891_100419611	3300031913	Soil	TDTTLKLMHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPLN
Ga0310891_103432202	3300031913	Soil	DKEIVFTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPLN
Ga0310897_105080431	3300032003	Soil	LLDATLKIQHKITMSEGDKSLGSPLTRPTPRVDAEDDEP
Ga0310902_107117261	3300032012	Soil	ELVLVDTSLKIKHTIPMSEGEKGGGPLSRPTPRVDSEDDEP
Ga0310896_104157492	3300032211	Soil	FTDTTLKLTHKIKMTEGEKGFGSPLSRPTPRVDAEDDEPLN
Ga0310810_110160591	3300033412	Soil	KELVVMDATLKITHKLTMSEGDKSLGSPLARPTPRVDSEDDEP
Ga0310810_114915511	3300033412	Soil	VLVDTTLKIKHSLTMSEGDKNPTSPLNRPTPKVDAEDDEP