| Basic Information | |
|---|---|
| Family ID | F088998 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LLHLGTLLAAKLWQATGWSVSTPPTILAWDWTAIRRILPLEASSP |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 64.22 % |
| % of genes from short scaffolds (< 2000 bps) | 80.73 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.927 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.431 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.62% β-sheet: 0.00% Coil/Unstructured: 64.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01807 | zf-CHC2 | 33.03 |
| PF08275 | Toprim_N | 16.51 |
| PF13155 | Toprim_2 | 13.76 |
| PF13662 | Toprim_4 | 3.67 |
| PF00589 | Phage_integrase | 3.67 |
| PF02899 | Phage_int_SAM_1 | 2.75 |
| PF04390 | LptE | 0.92 |
| PF01649 | Ribosomal_S20p | 0.92 |
| PF00119 | ATP-synt_A | 0.92 |
| PF00768 | Peptidase_S11 | 0.92 |
| PF02666 | PS_Dcarbxylase | 0.92 |
| PF07927 | HicA_toxin | 0.92 |
| PF08530 | PepX_C | 0.92 |
| PF08240 | ADH_N | 0.92 |
| PF01695 | IstB_IS21 | 0.92 |
| PF13362 | Toprim_3 | 0.92 |
| PF02817 | E3_binding | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 49.54 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 2.75 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 2.75 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.92 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.92 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.92 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.92 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.92 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.92 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000733|JGI12408J11912_1000580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4000 | Open in IMG/M |
| 3300001083|JGI12678J13193_1004384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300002568|C688J35102_118277824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300005186|Ga0066676_10227859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300005332|Ga0066388_100884783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300005451|Ga0066681_10890147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005533|Ga0070734_10177520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300005556|Ga0066707_10116200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300005764|Ga0066903_102161958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300005937|Ga0081455_10800390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300006059|Ga0075017_100091400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2108 | Open in IMG/M |
| 3300006102|Ga0075015_100251685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300006354|Ga0075021_10017539 | All Organisms → cellular organisms → Bacteria | 3971 | Open in IMG/M |
| 3300006755|Ga0079222_11609282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300006844|Ga0075428_100933307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300006845|Ga0075421_101343999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300006904|Ga0075424_102364796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300009012|Ga0066710_100508483 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300009167|Ga0113563_12664180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300009522|Ga0116218_1021584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2865 | Open in IMG/M |
| 3300009524|Ga0116225_1485736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009552|Ga0116138_1180890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009632|Ga0116102_1201236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300009639|Ga0116122_1070030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1162 | Open in IMG/M |
| 3300009644|Ga0116121_1139087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300009665|Ga0116135_1016601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2557 | Open in IMG/M |
| 3300010048|Ga0126373_11959568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300010361|Ga0126378_10096898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2901 | Open in IMG/M |
| 3300010361|Ga0126378_11034916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300010362|Ga0126377_12489067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300010366|Ga0126379_10890036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300010373|Ga0134128_10436779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300010375|Ga0105239_10903304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300010376|Ga0126381_100052687 | All Organisms → cellular organisms → Bacteria | 4990 | Open in IMG/M |
| 3300010376|Ga0126381_104941629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010379|Ga0136449_100019223 | All Organisms → cellular organisms → Bacteria | 17601 | Open in IMG/M |
| 3300011269|Ga0137392_10238717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300011271|Ga0137393_11304545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012189|Ga0137388_11349603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300012202|Ga0137363_10872634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300012209|Ga0137379_10800743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300012209|Ga0137379_11166870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300012210|Ga0137378_11293733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300012357|Ga0137384_10437114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300012359|Ga0137385_11212967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300012923|Ga0137359_10055082 | All Organisms → cellular organisms → Bacteria | 3461 | Open in IMG/M |
| 3300012923|Ga0137359_10804475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300012944|Ga0137410_11657942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300014326|Ga0157380_10567966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300014838|Ga0182030_10198236 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
| 3300016294|Ga0182041_10779513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300016422|Ga0182039_10194717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1612 | Open in IMG/M |
| 3300017789|Ga0136617_10842040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300017940|Ga0187853_10536262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300017961|Ga0187778_11094080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018030|Ga0187869_10065784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
| 3300018033|Ga0187867_10341877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300018037|Ga0187883_10455159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300018038|Ga0187855_10028886 | All Organisms → cellular organisms → Bacteria | 3561 | Open in IMG/M |
| 3300018043|Ga0187887_10821260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300018060|Ga0187765_10610650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300019786|Ga0182025_1231612 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300021168|Ga0210406_10068430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3059 | Open in IMG/M |
| 3300021171|Ga0210405_10650249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300021171|Ga0210405_10876917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300021420|Ga0210394_11531528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300021478|Ga0210402_10864346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300021559|Ga0210409_10065266 | All Organisms → cellular organisms → Bacteria | 3393 | Open in IMG/M |
| 3300021861|Ga0213853_10989160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021861|Ga0213853_11310758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1625 | Open in IMG/M |
| 3300022557|Ga0212123_10733386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300022756|Ga0222622_10272113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300024288|Ga0179589_10581372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300025906|Ga0207699_11063894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300025915|Ga0207693_11356269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300027570|Ga0208043_1030892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1653 | Open in IMG/M |
| 3300027583|Ga0209527_1000612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 7629 | Open in IMG/M |
| 3300027853|Ga0209274_10413862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300027854|Ga0209517_10000180 | All Organisms → cellular organisms → Bacteria | 113506 | Open in IMG/M |
| 3300027874|Ga0209465_10410420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300027911|Ga0209698_10028814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5114 | Open in IMG/M |
| 3300027911|Ga0209698_10197378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1629 | Open in IMG/M |
| 3300027911|Ga0209698_10455847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300028010|Ga0265358_100004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3312 | Open in IMG/M |
| 3300030524|Ga0311357_11670815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300030617|Ga0311356_10997483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300030693|Ga0302313_10314435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300030706|Ga0310039_10002386 | All Organisms → cellular organisms → Bacteria | 12555 | Open in IMG/M |
| 3300031057|Ga0170834_105676427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300031128|Ga0170823_12741488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300031236|Ga0302324_100442487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1920 | Open in IMG/M |
| 3300031446|Ga0170820_16468808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300031524|Ga0302320_12127122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300031544|Ga0318534_10776141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031736|Ga0318501_10136161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300031753|Ga0307477_10250817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1226 | Open in IMG/M |
| 3300031754|Ga0307475_11387435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300031777|Ga0318543_10238304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300031945|Ga0310913_10858166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300031954|Ga0306926_12057931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300032025|Ga0318507_10140708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300032044|Ga0318558_10235012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300032076|Ga0306924_11953894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300032160|Ga0311301_10028700 | All Organisms → cellular organisms → Bacteria | 14647 | Open in IMG/M |
| 3300032174|Ga0307470_11679760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300032805|Ga0335078_10360384 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300033158|Ga0335077_11304200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300034354|Ga0364943_0175677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
| 3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Host-Associated | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12408J11912_10005804 | 3300000733 | Tropical Forest Soil | MGTLLAARLWQAVGWSAATSPTILAWDWTAIRRILPIEARSP* |
| JGI12678J13193_10043841 | 3300001083 | Forest Soil | DPSTVRRWAGRLLQLGTLLGAKLWQATSWSASTPPTILAWDWTAIRCILPIEARSP* |
| C688J35102_1182778241 | 3300002568 | Soil | DPSTVRRWAGRLLHVGTLVAAKLRQATGWSASAFPTILAWDWTTIRHILLIEARSP* |
| Ga0066676_102278591 | 3300005186 | Soil | VRRWAGRLLHWGALLAAKLWQATGWSASMTPTILAWDWTAIRRILPLEARSP* |
| Ga0066388_1008847832 | 3300005332 | Tropical Forest Soil | LLQLGTLVTVKLWEAVNWSPAMPPTILAWDWTAIRRILPMEANSP* |
| Ga0066681_108901472 | 3300005451 | Soil | ALLAAKLWQATGWSASTPPTILAWDWTAIRRILPIEARSP* |
| Ga0070734_101775203 | 3300005533 | Surface Soil | LLHLGTLLVAKLWQATGWGVSTAPTILAWDWTAIRRILPLEASSP* |
| Ga0066707_101162002 | 3300005556 | Soil | MAAKLWQATGWTASTFPTILAWDWTAIRRILPLEARSP* |
| Ga0066903_1021619583 | 3300005764 | Tropical Forest Soil | VRRWAGRLVHVGTLLATKLWQAAGWSAAMFPTILAWDWTAIRRILPIEARSP* |
| Ga0081455_108003901 | 3300005937 | Tabebuia Heterophylla Rhizosphere | STVRRWAGRLLQVGTLLAAKLWQAAGWSAAISPTILAWDWTAVRRILPIEARSP* |
| Ga0075017_1000914004 | 3300006059 | Watersheds | LLDLGTLLAVKLWQATGWSAATPPTILAWDWDAIRRILPIEASSP* |
| Ga0075015_1002516852 | 3300006102 | Watersheds | LLHLGTLLAAKLWQAVGWSVSISPTILAWDWTAIRRILLLEASSP* |
| Ga0075021_100175394 | 3300006354 | Watersheds | VRRWAGRLLQVGILLATKLWQAAGWSAAMSPTILAWDWTAIRRILPIEARSP* |
| Ga0079222_116092821 | 3300006755 | Agricultural Soil | VRRWAGRLLHVGSLLAAKLWQAVGCSAALSPTILAWDWTAIRRIL |
| Ga0075428_1009333072 | 3300006844 | Populus Rhizosphere | WARRLLHVGTLLAAKLWQAAGWNAATSPTILAWDWTTIRRILPIEARSP* |
| Ga0075421_1013439992 | 3300006845 | Populus Rhizosphere | VGTLLAAKLWQAAGWNAATSPTILAWDWTTIRRILPIEARSP* |
| Ga0075424_1023647962 | 3300006904 | Populus Rhizosphere | RWAGRLLNLGTLLMAKLWQAIHWRASMPPTILAWDWTAIRRILPLEAKSP* |
| Ga0066710_1005084831 | 3300009012 | Grasslands Soil | AGRLLNLGTLLMAKLWQATNWSASLPPTILAWDWTAIRRILPLEAKSP |
| Ga0113563_126641802 | 3300009167 | Freshwater Wetlands | AWRLLQLGALLGAKLWQATGWSASTPPTILAWDWSAIRRILPIEARSP* |
| Ga0116218_10215841 | 3300009522 | Peatlands Soil | LLHLGTLLAAKLWQATGWSVSTPPTILAWDWTAIRRILPLEASSP* |
| Ga0116225_14857361 | 3300009524 | Peatlands Soil | LLAAKLWQAAGGSLSISPTILAWDWTAIRRILLLEASSP* |
| Ga0116138_11808901 | 3300009552 | Peatland | LGTLLAAKLWQATGFSSSTPPTILAWDWAAIHRILPSEASSP* |
| Ga0116102_12012361 | 3300009632 | Peatland | GRLLHLGTLLATKLWQTIGWSVSMVPTILAWDWTAIRRILLLEASSP* |
| Ga0116122_10700302 | 3300009639 | Peatland | LLHLGTLLAITLWQAAGWSVSISPTILAWDWTAIRRILLLEASSP* |
| Ga0116121_11390872 | 3300009644 | Peatland | LLHLGTLLAAKLWQATGWSVSISPTILAWDWTAIRRILLLEASSP* |
| Ga0116135_10166014 | 3300009665 | Peatland | LLHLGTLLAAKLWQAAGWSISISPTILAWDWTAIRRILLLEASSP* |
| Ga0126373_119595681 | 3300010048 | Tropical Forest Soil | VGTLLATKLWQAAGWSAAMSPTILAWDRTTIRRILPIEASSP* |
| Ga0126378_100968981 | 3300010361 | Tropical Forest Soil | RLLHVATLLATKLWQAAGWSAAISPTILAWDWITIGRILPIEARSP* |
| Ga0126378_110349162 | 3300010361 | Tropical Forest Soil | GLLLHVGILLATKLWQAAGWSAATLPTILAWDWNAIRRILPIEARSP* |
| Ga0126377_124890672 | 3300010362 | Tropical Forest Soil | MGTLLATKLWQAVDWNVSILPTMLAWDWTALRRILLLEASSP* |
| Ga0126379_108900362 | 3300010366 | Tropical Forest Soil | LHLAALLAAMLWQATGWSVAISPTILAWDWNAIRRILPIEARSP* |
| Ga0134128_104367792 | 3300010373 | Terrestrial Soil | MGTLLATKLWQAVDWNFSISPTILTWDWTVVRRILLSEASSP* |
| Ga0105239_109033041 | 3300010375 | Corn Rhizosphere | KFWQAAGWSAATSPTILAWDWTAIRRILPIEARGP* |
| Ga0126381_1000526875 | 3300010376 | Tropical Forest Soil | VTVKLWEAVNWSPAMPPTILAWDWTAIRRILPMEANSP* |
| Ga0126381_1049416292 | 3300010376 | Tropical Forest Soil | MGTLLATKLWQAVDWNVSISPTILAWDWTALRRILLLEASSP* |
| Ga0136449_1000192234 | 3300010379 | Peatlands Soil | LLHLGTLLAAKLWQAAGWSVSISPTILAWDWTAIRRILLLEASSP* |
| Ga0137392_102387173 | 3300011269 | Vadose Zone Soil | GTLLAAKLWQTTGWSVSTSPTILAWDWTAIRRILPLEARSP* |
| Ga0137393_113045452 | 3300011271 | Vadose Zone Soil | GRLLHWAALLAAKLWQATGWSASTPPTILAWDWTAIRRILPLEARSP* |
| Ga0137388_113496032 | 3300012189 | Vadose Zone Soil | RSPDPSTVRQWAGRLVHLGALLAAKLWQATDWSASTPPTILAWDWTAIRRILPLEARSP* |
| Ga0137363_108726342 | 3300012202 | Vadose Zone Soil | MRLGTLLVAKLWQATHWSASTSPTILAWDWTAIRRILPLEARSP* |
| Ga0137379_108007431 | 3300012209 | Vadose Zone Soil | LLNLGTLLMAKLWQAINWRASMPPTILAWDWTAIRR |
| Ga0137379_111668702 | 3300012209 | Vadose Zone Soil | WAGRLLNLGTLLMAKLWQAINWRASMPPTILAWDWTAIRRILPLEAKSP* |
| Ga0137378_112937332 | 3300012210 | Vadose Zone Soil | LLAAKLWQASGWSVSTSPTILAWDWIAVRRILPLEARSP* |
| Ga0137384_104371141 | 3300012357 | Vadose Zone Soil | LLNLGTLLMAKLWQAINWRASMPPTILAWDWTAIRRILPLEAKSP* |
| Ga0137385_112129671 | 3300012359 | Vadose Zone Soil | LLHLGTLLAAQLWQTTGWSVSTLPTILAWDWTAIRRILPWEASSP* |
| Ga0137359_100550825 | 3300012923 | Vadose Zone Soil | LLNLGTLLMAKLWQATNWSASLPPTILAWDWTAIRRILPLEAKSP* |
| Ga0137359_108044751 | 3300012923 | Vadose Zone Soil | MRLGTLLVAKLWQATNWSASTSPTFLAWDWTAIRRILPLEAKSP* |
| Ga0137410_116579421 | 3300012944 | Vadose Zone Soil | VRRWAGRLLLWSTLVSAKLWQATGCSTSTFPTILAWDWTAI |
| Ga0157380_105679661 | 3300014326 | Switchgrass Rhizosphere | AARLLHVGTLLAAKFWQAAGWSAALPPTILAWDWTAIRRILPIEARSP* |
| Ga0182030_101982362 | 3300014838 | Bog | MHLGTLLTVKLWKAADWRASNPPTILAWDWDAIRRILPLEARSP* |
| Ga0182041_107795132 | 3300016294 | Soil | VRRWAGRLVHVGTLLATKLWPAAGWSAEMFPTILAWDWTANRLILPIEARSP |
| Ga0182040_107449622 | 3300016387 | Soil | QLFCLWILLAAKLWQSTGCSIFSPSTILAWDWSAIRLILPVEVNSP |
| Ga0182039_101947173 | 3300016422 | Soil | RWAGRLLHVGSLLTAKLWQAAGWSAAMSHTIVAWDWTTIRRILPIEARSP |
| Ga0136617_108420401 | 3300017789 | Polar Desert Sand | LLQLGSLLAAKFWQAAGWSASVSPTILAWDWISIRRILPIEARSP |
| Ga0187853_105362621 | 3300017940 | Peatland | HLGTLLAAKLWQATGFSSSTPPTILAWDWAAIHRILPSEASSP |
| Ga0187778_110940802 | 3300017961 | Tropical Peatland | TLVTVKLWEAVNWSPAMPPTILAWDWTAIRRILPMEARSP |
| Ga0187869_100657844 | 3300018030 | Peatland | GRLLHLGTLLAAKLWQAAGWSISISPTILAWDWTAIRRILPMEARSP |
| Ga0187867_103418771 | 3300018033 | Peatland | AWASRLVNLGTLLTVKLREAAAWRASTSPTILAWDWSAIRRILPVEARSP |
| Ga0187883_104551591 | 3300018037 | Peatland | WAGRLLHLGILLTTLLWRAIGWSISMAPTILAWDWSAIRRILLLEASSP |
| Ga0187855_100288865 | 3300018038 | Peatland | LLHLGILLATKLRQAAGWSISTAPTILAWDWTAIRRILLLEA |
| Ga0187887_108212601 | 3300018043 | Peatland | RRWAGRLLHLGTLLAITLWQAAGWSVSIAPTILAWDWTAIRRILLLEASSP |
| Ga0187765_106106502 | 3300018060 | Tropical Peatland | VGTLLAAKLWQAAGWSAAISPTILAWDWTAIRRMLPIEARSP |
| Ga0182025_12316125 | 3300019786 | Permafrost | LLHLGTLLATMLWQATGWSAAMATTILAWDWTAIRRILLLEASSP |
| Ga0210406_100684304 | 3300021168 | Soil | RLLHLGTLLAAQLWQTTGWSVSTSPTILAWDWTAIRRILSWEASSP |
| Ga0210405_106502492 | 3300021171 | Soil | LLHLGTLLATKLWQATGWSILMAPTILAWDWTAIRRILLLEASSP |
| Ga0210405_108769171 | 3300021171 | Soil | GTLLMAKLWQAINWSASTAPTILAWDWTAIRRILPLEARSP |
| Ga0210394_115315281 | 3300021420 | Soil | LLYLGTLLAAKIRQTTGWTFSTSPTILAWDWMAIRRILPLEASSP |
| Ga0210402_108643461 | 3300021478 | Soil | PDPSTVRRWAGRLLQLGTLLATKLWQATGWSVSISPTILAWDWTAIRRILPVEARSP |
| Ga0210409_100652661 | 3300021559 | Soil | DPSTVRRWAGRLLHLGTLLAATLWLATGCSTSTPPTILAWDWTAMRRILPLEAGSP |
| Ga0213853_109891601 | 3300021861 | Watersheds | TLLAAKLWQATGWSVSISPTILAWDWTAIRRILLLEASSP |
| Ga0213853_113107582 | 3300021861 | Watersheds | LDLGTLLAVKLWQATGWSAATPPTILAWDWDAIRRIL |
| Ga0212123_107333862 | 3300022557 | Iron-Sulfur Acid Spring | SPDPSTVRRWAGRLLHVGSLLVTKLWQAAGWGVSMAPTILAWDWTAIRRILLLEESSP |
| Ga0222622_102721132 | 3300022756 | Groundwater Sediment | LLHLGTLLAAKLWRATGCSPSTVPTILAWDWTAIRLILPLEVSSP |
| Ga0179589_105813721 | 3300024288 | Vadose Zone Soil | PDPSTVRRWAGRLLALGTLLAAKLWQATDCSASMFPTILAWDWTAIRRILPLEARSP |
| Ga0207699_110638942 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHVGTLLAAKLWQAAAWSVSIAPTILAWDWSAVRRILLLEASSP |
| Ga0207693_113562692 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LATKLWQAVDWNFSISPTILTWDWTVVRRILLSEASSP |
| Ga0208043_10308923 | 3300027570 | Peatlands Soil | VRRWAGRLLHLGTLLAAKLWQATGCSTSTPPTILAWDWTAIRRILPLEASSP |
| Ga0209527_10006129 | 3300027583 | Forest Soil | AKLWQAAGWSISISPTILAWDWTAIRRILLLEASSP |
| Ga0209274_104138622 | 3300027853 | Soil | AWASRLVHLGTLLTLKLREAAGWRTSTSPTILAWDWSAIRRILPVEARSP |
| Ga0209517_10000180104 | 3300027854 | Peatlands Soil | LLHLGTLLAAKLWQATGWSVSTPPTILAWDWTAIRRILPLEASSP |
| Ga0209465_104104201 | 3300027874 | Tropical Forest Soil | AGTLLATKLWQAAGWSAAMSPTILAWDWTAIRRILPIEASSP |
| Ga0209698_100288141 | 3300027911 | Watersheds | LLHLGTLLAAKLWQAGWSVSISSTILAWDWTAIRRILLLE |
| Ga0209698_101973783 | 3300027911 | Watersheds | LLHLGTLLAAKLWQAAGWSISISPTILAWDWTAIRRILLLEASSP |
| Ga0209698_104558472 | 3300027911 | Watersheds | LLHLGTLLAAKLWQAVGWSVSISPTILAWDWTAIRRILLLEASSP |
| Ga0265358_1000044 | 3300028010 | Rhizosphere | LLHLGTLLAAQLWQAAGWSLSISPTILAWDWTAIRRILLLEASSP |
| Ga0311357_116708152 | 3300030524 | Palsa | LLHLGILLATKLRQAAGWSISTAPTILAWDWTAIRRILLLEASSP |
| Ga0311356_109974832 | 3300030617 | Palsa | LGILLATKLRQAAGWSISTAPTILAWDWTAIRRILLLEANSP |
| Ga0302313_103144351 | 3300030693 | Palsa | GRLLVVGTALAIKLWQAIGRSRAILPTILAWDWTAIRRILLLEASSP |
| Ga0310039_100023869 | 3300030706 | Peatlands Soil | LHLGTLLAAKLWQATGWSVSISPTILAWDWTAIRRILQLEASSP |
| Ga0170834_1056764271 | 3300031057 | Forest Soil | LGTLLAAKLWRATGCSPSTVPTILAWDWTAIRLILPLEASSP |
| Ga0170823_127414882 | 3300031128 | Forest Soil | LQLGTLLAAKFWQATGWNTSTPPTILAWDWTSISRILPLEARSP |
| Ga0302324_1004424871 | 3300031236 | Palsa | LLHLGTLLATMLWQATGWSAAMAPTILAWDWTAIRRILLLEASSP |
| Ga0170820_164688081 | 3300031446 | Forest Soil | LLRLGTLLTIALWRATGWSLSTSPTILAWDWTMIRRILPLE |
| Ga0302320_121271221 | 3300031524 | Bog | VRRWAGRLLHLGTLLATMLWRAIGWSISISPTILAWDWTAIRRILLLEVSSP |
| Ga0318534_107761411 | 3300031544 | Soil | VGTLLAAKLWQAAGWSAAISPTILAWDWTAVRRILPIEARSP |
| Ga0318501_101361613 | 3300031736 | Soil | VGSLLTAKLWQAAGWSAAMSPTIVAWDWTTIRRILPLEARSP |
| Ga0307477_102508171 | 3300031753 | Hardwood Forest Soil | VRRWAGRLLQVGLLLAAKLWQAAGWSAAMSPTILAWDWTAIHRILPIEARSP |
| Ga0307475_113874351 | 3300031754 | Hardwood Forest Soil | TLLMAKLWQASNWRASMPPTILAWDWPAIRRILPLEAKSP |
| Ga0318543_102383041 | 3300031777 | Soil | LLATKLWPAAGWSAEMFPTILAWDWTAIRLILPIEARSP |
| Ga0310913_108581661 | 3300031945 | Soil | RWAGRLLHLGTLLAAKLWQAAGWSAALSPTILAWDWTAIRRILPIEASSP |
| Ga0306926_120579311 | 3300031954 | Soil | CDAGSDVCWVGNLAGKLWQDAGWRAAMSPTILAWDWTAIRCILPNEARSP |
| Ga0318507_101407082 | 3300032025 | Soil | GSLLTAKLWQAAGWSAAMSPTIVAWDWTTIRRILPLEARSP |
| Ga0318558_102350122 | 3300032044 | Soil | AGRLLHVATLLATKLWQAAGLSAAISPTILAWDWITIGRILPIEARSP |
| Ga0306924_119538941 | 3300032076 | Soil | LLQVGTLLAAKLWQAAGWSAAMSPTILAWDWTAIRRILPIEARS |
| Ga0311301_100287003 | 3300032160 | Peatlands Soil | LLHLGTLLAAKLWQAAGWSVSISPTILAWDWTAIRRILLLEASSP |
| Ga0307470_116797602 | 3300032174 | Hardwood Forest Soil | LHWGTLLAAKFWQVVSWSAAISPTILAWDWTAIRRILPIEARSP |
| Ga0335078_103603843 | 3300032805 | Soil | RLLHLGTLLAAKLWQAAGWSISTSPTILAWDWTALRRILLLEASSP |
| Ga0335077_113042001 | 3300033158 | Soil | VRRWAGRLLQLGTMLAVKLWQAVGWSPALAPTIFAWDWRAIRRILPLEARSP |
| Ga0364943_0175677_1_159 | 3300034354 | Sediment | VRRWGGRLLHLGTLVAAKLWRATGCSPSTVPTILAWDWTAIRLILPLEVSSP |
| ⦗Top⦘ |