NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088662

Metagenome Family F088662

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088662
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 46 residues
Representative Sequence MMTVAKRARYPREMLRAPERGSGDVMADKNFTDLNFAGLLAFDRAKR
Number of Associated Samples 99
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 27.52 %
% of genes near scaffold ends (potentially truncated) 48.62 %
% of genes from short scaffolds (< 2000 bps) 95.41 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.165 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(22.936 % of family members)
Environment Ontology (ENVO) Unclassified
(33.945 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.459 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.00%    β-sheet: 0.00%    Coil/Unstructured: 76.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF13432TPR_16 42.20
PF13414TPR_11 33.94
PF14559TPR_19 6.42
PF00009GTP_EFTU 2.75
PF00348polyprenyl_synt 1.83
PF13181TPR_8 0.92
PF12034DUF3520 0.92
PF00814TsaD 0.92
PF00892EamA 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 1.83
COG0533tRNA A37 threonylcarbamoyltransferase TsaDTranslation, ribosomal structure and biogenesis [J] 0.92
COG1214tRNA A37 threonylcarbamoyladenosine modification protein TsaBTranslation, ribosomal structure and biogenesis [J] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.17 %
UnclassifiedrootN/A1.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1092354All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300002245|JGIcombinedJ26739_101606849All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300002915|JGI25387J43893_1055157All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300004643|Ga0062591_101228373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium732Open in IMG/M
3300005171|Ga0066677_10354137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium841Open in IMG/M
3300005175|Ga0066673_10165588All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1240Open in IMG/M
3300005175|Ga0066673_10324512All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005176|Ga0066679_10301546All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300005178|Ga0066688_10213067All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300005179|Ga0066684_10253659All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300005179|Ga0066684_10288277All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300005187|Ga0066675_10569549All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300005290|Ga0065712_10323594All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium824Open in IMG/M
3300005294|Ga0065705_10048674All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300005333|Ga0070677_10119836All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300005340|Ga0070689_100241853All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300005347|Ga0070668_100004715All Organisms → cellular organisms → Bacteria10106Open in IMG/M
3300005434|Ga0070709_10460561All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005434|Ga0070709_11527533All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005434|Ga0070709_11664324All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300005439|Ga0070711_100540467All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300005445|Ga0070708_101301374All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005447|Ga0066689_10200083All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300005451|Ga0066681_10122801All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300005467|Ga0070706_100834438All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300005540|Ga0066697_10325783All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005575|Ga0066702_10804422All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium559Open in IMG/M
3300005576|Ga0066708_10197200All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300005587|Ga0066654_10286438All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005718|Ga0068866_10511972All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300006032|Ga0066696_10177346All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1346Open in IMG/M
3300006046|Ga0066652_100892156All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300006791|Ga0066653_10064371All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300006794|Ga0066658_10411203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium735Open in IMG/M
3300007255|Ga0099791_10024072All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300007788|Ga0099795_10259888All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300009098|Ga0105245_12763154All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300009137|Ga0066709_104659487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300009143|Ga0099792_10280088All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300010304|Ga0134088_10653565All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300010322|Ga0134084_10071640All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300010323|Ga0134086_10452681All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium524Open in IMG/M
3300010326|Ga0134065_10043882All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300010333|Ga0134080_10009408All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3452Open in IMG/M
3300010399|Ga0134127_11355048All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300010400|Ga0134122_10673305All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300011119|Ga0105246_12013508All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium557Open in IMG/M
3300012199|Ga0137383_10464016All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300012201|Ga0137365_10565299All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium834Open in IMG/M
3300012202|Ga0137363_10894910All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300012285|Ga0137370_10009023All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae4684Open in IMG/M
3300012285|Ga0137370_10179536All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300012349|Ga0137387_11103557All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012683|Ga0137398_11043014All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012924|Ga0137413_11715532All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012955|Ga0164298_10236147All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1093Open in IMG/M
3300012961|Ga0164302_11523994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300012976|Ga0134076_10397721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium613Open in IMG/M
3300012985|Ga0164308_10351326All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300012986|Ga0164304_11385470All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium577Open in IMG/M
3300012989|Ga0164305_10877735All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300013102|Ga0157371_11036438All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300013297|Ga0157378_11812070All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300015077|Ga0173483_10024225Not Available2167Open in IMG/M
3300015373|Ga0132257_102780627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium638Open in IMG/M
3300017654|Ga0134069_1218164All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia655Open in IMG/M
3300017792|Ga0163161_11495757All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300018071|Ga0184618_10291266All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300018433|Ga0066667_10426932All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300018433|Ga0066667_11837078All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium550Open in IMG/M
3300018482|Ga0066669_10132986All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300018482|Ga0066669_11990331All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300019868|Ga0193720_1019919All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium949Open in IMG/M
3300019872|Ga0193754_1032724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300019872|Ga0193754_1033372All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium546Open in IMG/M
3300019879|Ga0193723_1194184All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300019881|Ga0193707_1124225All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300019882|Ga0193713_1117319All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300020018|Ga0193721_1078916All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300021411|Ga0193709_1119523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300021411|Ga0193709_1122123All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300021413|Ga0193750_1064059All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300025898|Ga0207692_10093296Not Available1637Open in IMG/M
3300025899|Ga0207642_10522939All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300025905|Ga0207685_10143927All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300025906|Ga0207699_10097616All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300025915|Ga0207693_11237052All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300025915|Ga0207693_11387521All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025916|Ga0207663_10256590All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300025929|Ga0207664_10876983All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300025960|Ga0207651_10222588All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300025972|Ga0207668_10175499All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300026078|Ga0207702_11718229All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026308|Ga0209265_1125682All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium647Open in IMG/M
3300026312|Ga0209153_1025443All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300026316|Ga0209155_1142354All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300026322|Ga0209687_1112608All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300026328|Ga0209802_1155119All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300026330|Ga0209473_1089428All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300026331|Ga0209267_1327314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300026342|Ga0209057_1149401All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300026530|Ga0209807_1184591All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300026550|Ga0209474_10755747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300026557|Ga0179587_10167540All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300026743|Ga0207613_101100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium599Open in IMG/M
3300027461|Ga0207601_101274All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300028814|Ga0307302_10551118All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031446|Ga0170820_12683980All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300031547|Ga0310887_10859413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.01%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026743Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027461Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes)EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_109235423300000881SoilMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR*
JGIcombinedJ26739_10160684913300002245Forest SoilQMMTVAKSARYPRDMLRLPERGSGGVRADEIFMDLDFAGLLALDRAKR*
JGI25387J43893_105515713300002915Grasslands SoilARYPREMLRVPEPGSGAVMADKNFTDLDFAGLLAFDRAKG*
Ga0062591_10122837323300004643SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR*
Ga0066677_1035413723300005171SoilMMTVAKSARYPREMLRPPERGPDEVMADKNFTDLDFAGLLTFDRAKG*
Ga0066673_1016558833300005175SoilMMTVAKSARYPREMLRPPERAPGEVMADKNFTDLDFAGLLAFDRAKG*
Ga0066673_1032451213300005175SoilMMTVAKSARYPREMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG*
Ga0066679_1030154623300005176SoilDGSDQMMTVAKRARYPREMLRAPERGSGNVMADKNFTDKNFAGLLASDRAKR*
Ga0066688_1021306723300005178SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFMDLNFAGLLAFDRAKR*
Ga0066684_1025365913300005179SoilVAKRARYPREMLRVPEPGSGAVMADKNFTDLDFAGLLAFDRAKG*
Ga0066684_1028827723300005179SoilMMMVAKRARYPREMLPAPDRGSGDVMADKNFMDLNFAGLLAFDRAKR*
Ga0066675_1056954913300005187SoilKSDGSDQMMTVAKRARYPREMLRVPEPGSGAVMADKNFTDLDFAGLLAFDRAKG*
Ga0065712_1032359423300005290Miscanthus RhizosphereMITVAKSARYPREMLRVPERGSGDVKGDKNFTDLNFAGLLAFDRAKR*
Ga0065705_1004867413300005294Switchgrass RhizosphereMMTVAKSARYPREMLRVPERGSGDVKGDKNFTDLDFAGLLAFDRAKR*
Ga0070677_1011983623300005333Miscanthus RhizosphereVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR*
Ga0070689_10024185323300005340Switchgrass RhizosphereMITVAKSARYPREMLRVPERGAGDVMADKNFTDLNFAGLLAFDRAKR*
Ga0070668_10000471523300005347Switchgrass RhizosphereMMTVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR*
Ga0070709_1046056113300005434Corn, Switchgrass And Miscanthus RhizosphereKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR*
Ga0070709_1152753313300005434Corn, Switchgrass And Miscanthus RhizosphereMMTVAKSARYPREMLCVPDGGAGDVMADKNFTDLDFAGLLAFDRAKG*
Ga0070709_1166432413300005434Corn, Switchgrass And Miscanthus RhizosphereMITVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR*
Ga0070711_10054046723300005439Corn, Switchgrass And Miscanthus RhizosphereTVAKSARYPREMLCVPDGGAGDVMADKNFTDLDFAGLLAFDRAKG*
Ga0070708_10130137413300005445Corn, Switchgrass And Miscanthus RhizosphereSDQMMTVAKRARYPREMLRAPDRGSGDVRADKNFTDLNFAGLLAFDRAKR*
Ga0066689_1020008333300005447SoilSDGSDQMITVAKSARYPREMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG*
Ga0066681_1012280113300005451SoilMMMVAKRARYPREMLPAPDRGSGDVMADKNFMDLNFAGLL
Ga0070706_10083443823300005467Corn, Switchgrass And Miscanthus RhizosphereMTVAKSARYPREMLRPPERGPGDVIADKSFTDLDFAGLLAFDRAKR*
Ga0066697_1032578323300005540SoilMMTVAKSARYPREMLRPAEHGPADVMADKNFTDLNFAGLLAFDRAKR*
Ga0066702_1080442213300005575SoilMMTVAKRARYPREMLRAPEGGSGDLMADKNFTGLNFAGLLAFDRAKR*
Ga0066708_1019720033300005576SoilDQMMTVAKSARYPREMLRPPERGPDEVMADKNFTDLDFAGLLTFDRAKG*
Ga0066654_1028643813300005587SoilWKSDGSDQMITVAKSARYPREMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG*
Ga0068866_1051197223300005718Miscanthus RhizosphereGSDQMMTVAKRARYPREMLPAPDRGSGDVMADKNFTALNFAGLLAFDRAKR*
Ga0066696_1017734623300006032SoilMLPAPDRGSGDVMADKNFMDLNFAGLLAFDRAKR*
Ga0066652_10089215613300006046SoilTVAKSARYPREMLRPPERGLGDVMADKNSTDLNFAGLLAFDRAKR*
Ga0066653_1006437123300006791SoilMMTVAKRARYPREMLPALDRGSGDVMADKNFMDLNFAGLLAFDRAKR*
Ga0066658_1041120313300006794SoilSDGSDQMITVAKSARYPREMLRPPERGLGDMMADKNFTDLNFAGLLAFDRAKR*
Ga0099791_1002407243300007255Vadose Zone SoilMMTVAKSARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR*
Ga0099795_1025988823300007788Vadose Zone SoilMMTVAKSARYRREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR*
Ga0105245_1276315423300009098Miscanthus RhizosphereMITVAKSARYPREMLCVPDGGAGDVMADKNFTDLDFAGLLAFDRAKG*
Ga0066709_10465948723300009137Grasslands SoilGSDQMMTVAKSARYPREMLRPPERGPDEVMADKNFTDLDFAGLLTFDRAKG*
Ga0099792_1028008823300009143Vadose Zone SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKRMLSKEEP*
Ga0134088_1065356513300010304Grasslands SoilEMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG*
Ga0134084_1007164023300010322Grasslands SoilMMTVAKRATYPREMLRAPEGGSGDLMADKNFTGLNFAGLLAFDRAKR*
Ga0134086_1045268123300010323Grasslands SoilEMLRPPERGPGDVMADKNFTDSNFAGLLAFDRAKR*
Ga0134065_1004388243300010326Grasslands SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFVDLNFAGLLAFDRAKR*
Ga0134080_1000940823300010333Grasslands SoilMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG*
Ga0134127_1135504823300010399Terrestrial SoilVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR*
Ga0134122_1067330513300010400Terrestrial SoilSDQMITVVEGARYPREMVLVADGGSGDVMADKNFTRCSVDGLVADDRAKR*
Ga0105246_1201350823300011119Miscanthus RhizosphereMMTVAKSARYPREMLRVPERGSGDVKGDKNFTDLNFAGLLAFDRAKR*
Ga0137383_1046401623300012199Vadose Zone SoilMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR*
Ga0137365_1056529923300012201Vadose Zone SoilMMTVAKSARYPREMLRPAEHGPGDVMADKNFTDLNFAGLLAFDRAKR*
Ga0137363_1089491013300012202Vadose Zone SoilNWKRDGSDQMMTVAKRARYPREMLRAPERGSGDVMADKNFTDLNFAGLLASDRAKR*
Ga0137370_1000902323300012285Vadose Zone SoilMMFFLKSASYPREMLRPPERGPDEVMADKNFTDLDFAGLLTFDRAKG*
Ga0137370_1017953633300012285Vadose Zone SoilRYPREMLRPAERGPADVMADKNFTDLNFAGLLAFDRAKR*
Ga0137387_1110355723300012349Vadose Zone SoilMMPVAKSARYPREMLRPAEHGPGDVMADKNFTDLNFAGLLAFDRAKG*
Ga0137398_1104301423300012683Vadose Zone SoilDQMITVAKSARYPRETLRVPERGSGDVKADKNFTDLNFAGLLAFDRAKR*
Ga0137413_1171553223300012924Vadose Zone SoilMMTVAKSARYPREMLRVPERGSGDVKADKNFTDLNFAGLLAFDRAKR*
Ga0164298_1023614723300012955SoilMMTVAKRARYPREMLRVPERGSGDVMADKNLTELNFAGLLAFDRAKR*
Ga0164302_1152399423300012961SoilMLPAPDRGSGDVMVDKNFKDLNFAGLLAFDRAKR*
Ga0134076_1039772123300012976Grasslands SoilMMTVAKSARYPREMLRPPERGPGDVMADKIFTDLDFAGLMAFDRAKG*
Ga0164308_1035132623300012985SoilYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR*
Ga0164304_1138547013300012986SoilQMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR*
Ga0164305_1087773523300012989SoilMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR*
Ga0157371_1103643823300013102Corn RhizosphereKRARYPRETLPAPDRVSGDVMEDKNFTDLDFAGLLAFDRAKR*
Ga0157378_1181207013300013297Miscanthus RhizosphereKRDGSDQMMTVAKRARYPREMLLAPDLGSGDVMADKNFTDLDFAGLLAFDRAKG*
Ga0173483_1002422513300015077SoilMTVARSAKYPREMLRVPERGSGDVKGDKNFTDLNFAGLLAFDRAKR*
Ga0132257_10278062723300015373Arabidopsis RhizosphereMMTVAKRARYPREMFRAPERGSGDVMSDKIFTDLNFAGLLAFDRAKG*
Ga0134069_121816413300017654Grasslands SoilMMTVAKRARYPREMLPALDRGSGDVMADKNFMDLNFA
Ga0163161_1149575723300017792Switchgrass RhizosphereMITVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR
Ga0184618_1029126623300018071Groundwater SedimentMMTVAKSARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLALDRAKR
Ga0066667_1042693223300018433Grasslands SoilMMTVAKSARYPREMLRPPERGPGDVMADKIFTDLDFAGLVAFDRAKG
Ga0066667_1183707813300018433Grasslands SoilMMTVAKRARYPREMLRVAEPGSGDVTADKNFTELNFAGLLAFDRAKR
Ga0066669_1013298623300018482Grasslands SoilMMTVAKRARYPREMLPALDRGSGDVMADKNFMDLNFAGLLAFDRAKR
Ga0066669_1199033123300018482Grasslands SoilMMTVAKSARYPREMLRPAEHGPADVMADKNFTDLNFAGLLAFDRAKR
Ga0193720_101991923300019868SoilMMTVAKRARYPREMLRAPERGSGGMIADKNFTVLNFAGLLAFDRAKR
Ga0193754_103272413300019872SoilWKSDGSDQMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0193754_103337223300019872SoilMMTVAQRARYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0193723_119418413300019879SoilMMTVAKSARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR
Ga0193707_112422523300019881SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0193713_111731923300019882SoilTAAKRARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR
Ga0193721_107891623300020018SoilMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR
Ga0193709_111952323300021411SoilWKSDGSDQMMTVAKRARYPREMLRVPKPGSGDVMADKNFTELNFAGLLAFDRAKR
Ga0193709_112212323300021411SoilTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0193750_106405923300021413SoilREMLRVPERGSGDVKADKNFTDLNFAGLLAFDRAKR
Ga0207692_1009329613300025898Corn, Switchgrass And Miscanthus RhizosphereEMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR
Ga0207642_1052293923300025899Miscanthus RhizosphereSDQMMTVAKRARYPRETLPAPDRVSGDVMEDKNFTDLNFAGLLAFDRAKR
Ga0207685_1014392723300025905Corn, Switchgrass And Miscanthus RhizosphereMMTVAKSARYPREMLCVPDGGAGDVMADKNFTDLDFAGLLAFDRAKG
Ga0207699_1009761613300025906Corn, Switchgrass And Miscanthus RhizosphereSDQMMTVAKRARYPREMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR
Ga0207693_1123705223300025915Corn, Switchgrass And Miscanthus RhizosphereNWKRDGSDQMMTVAKRARYPREMLPAPDRGSGDAMADKNFMDLNFAGLLAFDRAKR
Ga0207693_1138752123300025915Corn, Switchgrass And Miscanthus RhizosphereNWKRDGSDQMMTVAKRARYPREMLPAPDRGSGEAMADKNFMDLNFAGLLAFDRAKR
Ga0207663_1025659033300025916Corn, Switchgrass And Miscanthus RhizosphereNWKSDGSDQMITVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR
Ga0207664_1087698313300025929Agricultural SoilARYPREMLPAPDRGSGDVMADKNFTDLNFAGFLAFDRAKR
Ga0207651_1022258813300025960Switchgrass RhizosphereYPRETLPAPDRVSGDVMEDKNFTDLNFAGLLAFDRAKR
Ga0207668_1017549933300025972Switchgrass RhizosphereMMTVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR
Ga0207702_1171822923300026078Corn RhizosphereMITVAKSARYPREMLRVPERSSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0209265_112568213300026308SoilPREMLRAPEGGSGDLMADKNFTGLNFAGLLAFDRAKR
Ga0209153_102544343300026312SoilMMTVAKSARYPREMLRPPERGPDEVMADKNFTDLDFAGLLTFDRAKG
Ga0209155_114235423300026316SoilGSDQMMTVAKSARYPREMLRPPERAPGEVMADKNFTDLDFAGLLAFDRAKG
Ga0209687_111260813300026322SoilEMLRVAEPGSGDVTADKNFTELNFAGLLAFDRAKR
Ga0209802_115511923300026328SoilMMTVAKRARYPREMLRAPERGSGDVMADKNFTDLNFAGLLAFDRAKR
Ga0209473_108942833300026330SoilMMMVAKRARYPREMLPAPDRGSGDVMADKNFVDLNFAGLLAFDRAKR
Ga0209267_132731413300026331SoilMMTVAKSARYPREMLRVPERASGDLIADKNFTDLNFAGLLAFDRAKR
Ga0209057_114940123300026342SoilITVAKSARYPREMLRPPERGLGDVMADKNFTDLNFAGLLAFDRAKR
Ga0209807_118459123300026530SoilMMTVAKRARYPREMLRVPEPGSGDVTADKNFTELNFAGLLAFDRAKR
Ga0209474_1075574723300026550SoilMMTVAKRARYPREMLRAPERGSGNVMADKNFTDKNFAGLLASDRAKR
Ga0179587_1016754013300026557Vadose Zone SoilWKRDGSDQMMTVAKSARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLAFDRAKR
Ga0207613_10110023300026743SoilMITVAKSARYPREMLRVPERGSGGEMADKNFTDLNFAGLLAFDRAKR
Ga0207601_10127433300027461SoilGSDQMITVAKSARYPREMLRVPERGSGDVKGDKNFTELNFAGLLAFDRAKR
Ga0307302_1055111813300028814SoilAKRARYPREMLPAPDRGSGDVMADKNFTDLDFAGLLALDRAKR
Ga0170820_1268398023300031446Forest SoilMITVAKSARYPREMLRVSERGSGDAKGDKYFTELNFAGLLAFDRAKR
Ga0310887_1085941323300031547SoilMMTVAKRARYPREMLPTPARGSGDVMADKNFTDLNFAGLLAFDRAKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.