| Basic Information | |
|---|---|
| Family ID | F088485 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LAGAGATGAAEERGSRVADALDVPLVDLRHAWETGLSRALGWEAS |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.743 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.927 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.028 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.18% β-sheet: 0.00% Coil/Unstructured: 80.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13522 | GATase_6 | 70.64 |
| PF13230 | GATase_4 | 11.93 |
| PF13537 | GATase_7 | 6.42 |
| PF00310 | GATase_2 | 5.50 |
| PF00551 | Formyl_trans_N | 0.92 |
| PF14684 | Tricorn_C1 | 0.92 |
| PF02769 | AIRS_C | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.74 % |
| Unclassified | root | N/A | 8.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT02HJ84W | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300000956|JGI10216J12902_106028253 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300002549|JGI24130J36418_10031780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1519 | Open in IMG/M |
| 3300003461|P42013CM_1052628 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300004006|Ga0055453_10181943 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300004024|Ga0055436_10210429 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300004157|Ga0062590_100621724 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005105|Ga0066812_1026008 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005182|Ga0069000_10086068 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005471|Ga0070698_102178667 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005536|Ga0070697_100783130 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005544|Ga0070686_100913199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300005719|Ga0068861_101474436 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005764|Ga0066903_108017791 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005841|Ga0068863_101805958 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005938|Ga0066795_10106668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 833 | Open in IMG/M |
| 3300006031|Ga0066651_10740189 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006059|Ga0075017_100650387 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006806|Ga0079220_11146840 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006871|Ga0075434_101012088 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300006881|Ga0068865_101180156 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300007004|Ga0079218_10781715 | Not Available | 913 | Open in IMG/M |
| 3300007769|Ga0102952_1231855 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009082|Ga0105099_11060809 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009101|Ga0105247_11160393 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009120|Ga0117941_1010787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2458 | Open in IMG/M |
| 3300009131|Ga0115027_10383904 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300009551|Ga0105238_12130943 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010045|Ga0126311_10541892 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010323|Ga0134086_10253227 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010323|Ga0134086_10255354 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010397|Ga0134124_11499720 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010399|Ga0134127_10869230 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300010400|Ga0134122_10605686 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300011119|Ga0105246_10865283 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012019|Ga0120139_1084689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300012202|Ga0137363_11321370 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012204|Ga0137374_10612934 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012683|Ga0137398_11166775 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012908|Ga0157286_10332944 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012911|Ga0157301_10327867 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012912|Ga0157306_10269024 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012915|Ga0157302_10560303 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012930|Ga0137407_10499659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300012955|Ga0164298_10733439 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300013307|Ga0157372_12313391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300014255|Ga0075320_1018663 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300014325|Ga0163163_10798391 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300014745|Ga0157377_10754806 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300014968|Ga0157379_12218899 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300015373|Ga0132257_102322489 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017939|Ga0187775_10392282 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300018465|Ga0190269_11803490 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018469|Ga0190270_13044014 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018476|Ga0190274_12176409 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300019362|Ga0173479_10744630 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300020215|Ga0196963_10151884 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300021080|Ga0210382_10034000 | Not Available | 1933 | Open in IMG/M |
| 3300022223|Ga0224501_10621024 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025313|Ga0209431_10217605 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300025495|Ga0207932_1052649 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300025556|Ga0210120_1084004 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025904|Ga0207647_10084488 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300025906|Ga0207699_10732110 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300025910|Ga0207684_10812177 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300025918|Ga0207662_10320429 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300025927|Ga0207687_10418562 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300025935|Ga0207709_11040815 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025961|Ga0207712_11375545 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025967|Ga0210136_1074691 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025972|Ga0207668_10577567 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300025986|Ga0207658_11821915 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026048|Ga0208915_1030954 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026088|Ga0207641_11973469 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026089|Ga0207648_10867384 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026271|Ga0209880_1089618 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027775|Ga0209177_10371587 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027843|Ga0209798_10057832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2012 | Open in IMG/M |
| 3300027894|Ga0209068_10834138 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300028380|Ga0268265_12356838 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300028381|Ga0268264_10361498 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300028587|Ga0247828_10432699 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300028608|Ga0247819_10621018 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300028708|Ga0307295_10194683 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028768|Ga0307280_10035140 | Not Available | 1516 | Open in IMG/M |
| 3300030336|Ga0247826_10742344 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300030336|Ga0247826_11695482 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300030491|Ga0302211_10032128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1495 | Open in IMG/M |
| 3300031671|Ga0307372_10326305 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031728|Ga0316578_10710243 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031901|Ga0307406_11147579 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031918|Ga0311367_10507825 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300031938|Ga0308175_103253480 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031965|Ga0326597_11957080 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031995|Ga0307409_100498424 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300032002|Ga0307416_101102311 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300032052|Ga0318506_10430321 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300032173|Ga0315268_10078388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3112 | Open in IMG/M |
| 3300032275|Ga0315270_10908228 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300033416|Ga0316622_102098217 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300033811|Ga0364924_000335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7047 | Open in IMG/M |
| 3300034164|Ga0364940_0043679 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300034692|Ga0373917_0086677 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.92% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.92% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.92% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.92% | |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.92% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300003461 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sample | Environmental | Open in IMG/M |
| 3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00804670 | 2124908016 | GGERLFVDLAGAGATGAAEERGSSVADAIDVGLVELIRAWEHGLPRALGWDEAGASVEGR | |
| 2ZMR_02067910 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | ELAAGVVAGSVEDRGGRVADALEVPLRDLRHAWEHGLDRALGWDA |
| JGI10216J12902_1060282532 | 3300000956 | Soil | TGAAEDRGSRVADALIVGLDELRHAWETGLSRALGWSAR* |
| JGI24130J36418_100317801 | 3300002549 | Arctic Peat Soil | ELVGEGATGAAEGRGVGVADALEGTLSDLRHAWEHGLPRALGEEA* |
| P42013CM_10526282 | 3300003461 | Ore Pile And Mine Drainage Contaminated Soil | AGSGATGAAEGRGSRVADAVDVPIADLRHAWEQGLARALGWEDA* |
| P52013CM_11067531 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | VIELTGAGATGAAEERGSRVADSIDVAVGDLERAWEHGLPRALGWDVPGQAGAAARAEGR |
| Ga0055453_101819431 | 3300004006 | Natural And Restored Wetlands | LAGEGATGAAEERGSRIADALEAPVDDLRHAWELGLPRALGWETTDVRGGGA* |
| Ga0055436_102104292 | 3300004024 | Natural And Restored Wetlands | VVELAGEGATGAAEERGSRVADALDVAVGELTHAWEQGLSRALGMEA* |
| Ga0062590_1006217242 | 3300004157 | Soil | AAEERGGSIADALEVPVADLRHAWEHGLSRALGWDDPATDAEGVR* |
| Ga0066812_10260082 | 3300005105 | Soil | AGLATGTVEDRGGGGRVADALEVPVRDLRHAWEHGLGRALGWDA* |
| Ga0069000_100860682 | 3300005182 | Natural And Restored Wetlands | SGATGAAEERGSRVADALEVRVSDLRHAWEHGLPRALGWEVHA* |
| Ga0070698_1021786671 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLVAASVTGAAEERGSRIADALDVRVADLRNAWTHGLERALGWDEPGMEVT* |
| Ga0070697_1007831301 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAGATGAAEERGSGVADAIDVALVDLTRAWEHGLPRALGWDDLVSAVEGR* |
| Ga0070686_1009131992 | 3300005544 | Switchgrass Rhizosphere | IELAGDGATGAAEERGSRVADALEVRVDDLRHAWEHGLPRALGLEEVGA* |
| Ga0068861_1014744362 | 3300005719 | Switchgrass Rhizosphere | LAGSGPTGAAEERGSRIADALEVPLADLRHAWEHGLARALGWEG* |
| Ga0066903_1080177911 | 3300005764 | Tropical Forest Soil | LEDESGDAPPPRLVVELHGAGATGSAEDRGSRVADALVVGLDELRHAWGGGLSRALGWEIR* |
| Ga0068863_1018059582 | 3300005841 | Switchgrass Rhizosphere | RLVVELTGSGASGAAEERGSGVADAIDVPLTNLRHAWEHGLARALGWESPAFASEGR* |
| Ga0066795_101066682 | 3300005938 | Soil | LVELVGEGATGAAEGRGVGVADALEVTLSDLRHAWEHGLPRALGEEA* |
| Ga0066651_107401892 | 3300006031 | Soil | DRGSRVADELIVGLDELRHAWDGGLARALGWEQR* |
| Ga0075017_1006503872 | 3300006059 | Watersheds | RLVIELGGRGVIGDAEERGPQGADALDVAVADLRHAWDHGLTRALGED* |
| Ga0079220_111468401 | 3300006806 | Agricultural Soil | EERGSRVADALDVAVRDLRHAWETGLNRSLGWENA* |
| Ga0075434_1010120881 | 3300006871 | Populus Rhizosphere | GAGATGAAEERGSSVADAIDVHLTDLTRAWERGLPRALGWDQASASLEGR* |
| Ga0068865_1011801562 | 3300006881 | Miscanthus Rhizosphere | GAGATGAAEERGSSVADAIDVALVDLVRAWEHGLPRALGWDVTSASVEGR* |
| Ga0079218_107817151 | 3300007004 | Agricultural Soil | ATGSAEDRGGSVADALEVPLRDLGHAWDHGLARALGWEG* |
| Ga0102952_12318551 | 3300007769 | Soil | TGAAEERGSRIADALEVPVADLRHAWEHGLPRALGLEDDA* |
| Ga0105099_110608092 | 3300009082 | Freshwater Sediment | LAGAGATGAAEGRGSRVADALDVALDDLRHAWERGLLRALGREDG* |
| Ga0105247_111603932 | 3300009101 | Switchgrass Rhizosphere | FGATGAAEDRGSRVADALIVGLDELRHAWEGGLSRALGWEQR* |
| Ga0117941_10107871 | 3300009120 | Lake Sediment | GEGATGAAEGRGARVADEVDVALADLRHAWEHGLPRALGVDG* |
| Ga0115027_103839042 | 3300009131 | Wetland | EGATGAAEERGARVADAIELGLVDLRHAWEHGLPRALGVEG* |
| Ga0105100_103944992 | 3300009166 | Freshwater Sediment | ATGAAEERGAGVADSIELDLADIRHAWDHGLPRALGVEGPA* |
| Ga0105238_121309431 | 3300009551 | Corn Rhizosphere | QRLVVELTGSGATGAAEERGSGVADAIDVPLANLRHAWEHGLARALGWENG* |
| Ga0126311_105418922 | 3300010045 | Serpentine Soil | VVELAGAGATGAAEERGSNVADSIDVSVRALERAWEHGLPRALGWDEPGQASAAASAEGR |
| Ga0134086_102532272 | 3300010323 | Grasslands Soil | DRGSRVADALIVGLDELRHAWDGGLERALGWERR* |
| Ga0134086_102553541 | 3300010323 | Grasslands Soil | RLLVELAGAGATGAAEERGSGVADAIDVALADLARAWEHGLPRALGWDTVG* |
| Ga0134124_114997201 | 3300010397 | Terrestrial Soil | IELTGAGATGAAEERGSRVADAVDVPVADLRHAWEHGLPRALGWDGIDGMEDLR* |
| Ga0134127_108692302 | 3300010399 | Terrestrial Soil | VELAGAGATGAAEERGSGVADAIDVAITALERAWEHGLPRALGWDEHGAGAAEGR* |
| Ga0134122_106056861 | 3300010400 | Terrestrial Soil | AEDRGSRIADALDVGLKELRHAWEGGLARALGWEAG* |
| Ga0105246_108652832 | 3300011119 | Miscanthus Rhizosphere | IELHGSGATGSAEDRGSRVADELIVGLDELRHAWEGGLSRALGWEG* |
| Ga0120139_10846893 | 3300012019 | Permafrost | LAGAGATGAAEERGSRVADALDVPLVDLRHAWETGLSRALGWEAS* |
| Ga0137363_113213701 | 3300012202 | Vadose Zone Soil | TLLIELHGSGATGSAEDRGSRVADELVVSLDELRHAWEGGLSRALGWEQR* |
| Ga0137374_106129342 | 3300012204 | Vadose Zone Soil | SRLVMELAGAGATGAADERGSRVADALDVPVADLRHAWEHGLSRALGWEER* |
| Ga0137398_111667751 | 3300012683 | Vadose Zone Soil | IELAGAGATGAAEERGSRVADALEVPLADLRHAWETGLSRALGWEAS* |
| Ga0157286_103329442 | 3300012908 | Soil | AAEERGSDVADELDVAIDDLCHAWEQGLARSLGWEAS* |
| Ga0157301_103278672 | 3300012911 | Soil | GAAEERGSDVADELDVAIDDLCHAWEQGLARSLGWEAS* |
| Ga0157306_102690242 | 3300012912 | Soil | VELVGEGATGAAEERGADIADPIEVELSSLHHAWAGGLPALFEGV* |
| Ga0157302_105603031 | 3300012915 | Soil | AIELTGAGATGAAEERGSRVADAVDVPVADLRHAWEHGLPRALGWDGIDGMEDLR* |
| Ga0137407_104996592 | 3300012930 | Vadose Zone Soil | LHGSGATGSAEDRGSRVADELTVSLDELRHAWEGGLSRALGWEQR* |
| Ga0164298_107334392 | 3300012955 | Soil | VVELRGAGATGAAEERGSRVADAIEVPLRDLRHAWEHGLGRALGWEG* |
| Ga0157372_123133912 | 3300013307 | Corn Rhizosphere | GNVEDRGGGVADALEVPLRDLRHAWDHGLARGLGWEG* |
| Ga0075320_10186632 | 3300014255 | Natural And Restored Wetlands | DRLVVELAGFGATGAAEERGSRIADALEVPLTDLRHAWEHGLSRALGWEG* |
| Ga0163163_107983911 | 3300014325 | Switchgrass Rhizosphere | EERGSRVADALDVAVKDLRHAWETGLNRAIGWENA* |
| Ga0157377_107548062 | 3300014745 | Miscanthus Rhizosphere | LTGAGATGAAEERGSDVADELDVAINNLRHAWEQGLARSLGWEAS* |
| Ga0157379_122188991 | 3300014968 | Switchgrass Rhizosphere | NAEDRGGGVADALEVPLRDLRHAWDHGLARGLGWEG* |
| Ga0173478_106081051 | 3300015201 | Soil | ATGAAEERGAGIADELDEPLTVLRDAWDRGLPRAMGERG* |
| Ga0132257_1023224892 | 3300015373 | Arabidopsis Rhizosphere | EERGSRVADAVDVPVASLRHAWEHGLPRALGWDDIDAMEDLR* |
| Ga0187775_103922822 | 3300017939 | Tropical Peatland | LAGQGATGAAEERGSRVADALDVPLDELRHAWEQGLARALGEDGSTGSLPEDR |
| Ga0190269_118034902 | 3300018465 | Soil | LVIELAGAGATGAAEERGSRVADALDVTLHELRHAWETGLPRALGWEMS |
| Ga0190270_130440142 | 3300018469 | Soil | EERGSRVADALEVPVVDLRHTWEHGLARALGWEGGA |
| Ga0190274_121764091 | 3300018476 | Soil | AGEGATGAAEERGSRIADAIDVAVADLRHAWEHGLSRSLGWEVPA |
| Ga0173479_107446301 | 3300019362 | Soil | GRGATGAAEERGSGIADALEVPVADLRHAWEHGLSRALGWDDAGAEGIR |
| Ga0196963_101518841 | 3300020215 | Soil | ATGAAEERGARVADAVDVPLSELRNAWEHGLARALGWEER |
| Ga0210382_100340003 | 3300021080 | Groundwater Sediment | ATGAAEERGSRVADALDVPLSELRHAWETGLSRALGWEGR |
| Ga0224501_106210241 | 3300022223 | Sediment | AGSGATGAAEERGSRVADALEVRVSDLRHAWEHGLPRALGWEVHA |
| Ga0209431_102176051 | 3300025313 | Soil | VIELAGAGATGAAEERGSRVADPIDLTIADLAHTWEHGLARALDWEAPAAAPEGR |
| Ga0207932_10526492 | 3300025495 | Arctic Peat Soil | GGPGLLVELVGEGATGAAEGRGVGVADALEVTLSDLRHAWEHGLPRALGEEA |
| Ga0210120_10840041 | 3300025556 | Natural And Restored Wetlands | VIELAGEGATGAAEERGSRIADALEAPVDDLRHAWELGLPRALGWETTDVRGGGA |
| Ga0207647_100844881 | 3300025904 | Corn Rhizosphere | VIALHGSGATGSAEDRGSRVADELIVGLDELRHAWEGGLSRALGWDQR |
| Ga0207699_107321101 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EDRGSRVADALIVTLDNLRHAWDGGLARALGWEIR |
| Ga0207684_108121772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GATGAAEERGSSVADAIDVALTDLTRAWEHGLPRALGWDEAG |
| Ga0207662_103204291 | 3300025918 | Switchgrass Rhizosphere | LAGAGATGAAEERGSSVADAIDVALVDLVRAWEHGLPRALGWDVASASVEGR |
| Ga0207687_104185622 | 3300025927 | Miscanthus Rhizosphere | DLAGAGATGAAEERGSSVADAIDVGLVELTRAWEHGLPRALGWDEASASQEGR |
| Ga0207706_112037831 | 3300025933 | Corn Rhizosphere | GGERLFVDLAGAGATGAAEERGSSVADAIDVSLIDLTRAWEHGLPRALGWDPAAASVEGR |
| Ga0207709_110408152 | 3300025935 | Miscanthus Rhizosphere | AIELTGAGATGAAEERGSRVADAVDVPVADLRHAWEHGLPRALGWDGIDGMEDLR |
| Ga0207712_113755452 | 3300025961 | Switchgrass Rhizosphere | GRLFVELAGAGATGAAEERGSGVADAIDVALHDLLRAWEHGLPRALGWDAPSASMEGR |
| Ga0210136_10746912 | 3300025967 | Natural And Restored Wetlands | AAEERGARVADEVDIPLADIVHAWEHGLPRALGEEG |
| Ga0207668_105775671 | 3300025972 | Switchgrass Rhizosphere | GAAEERGSDVADELDVAINNLRHAWEQGLARSLGWEAS |
| Ga0207658_118219152 | 3300025986 | Switchgrass Rhizosphere | QRLVVELTGSGATGAAEERGSGVADAIDVPLTNLRHAWEHGLARALGWESPAFASEGR |
| Ga0208915_10309541 | 3300026048 | Natural And Restored Wetlands | VVELTGQGATGAAEARGSRVADAIDVALADLRHAWEHGLARALGQDD |
| Ga0207641_119734691 | 3300026088 | Switchgrass Rhizosphere | RRLVVELTGSGATGAAEERGSGVADAIDVPLTNLRHAWEHGLARALGWESPAFASEGR |
| Ga0207648_108673842 | 3300026089 | Miscanthus Rhizosphere | GATGAAEDRGSRVADALIVGLDELRHAWEGGPSRALGWEVR |
| Ga0209880_10896181 | 3300026271 | Soil | DQLVIELAGEGATGAAEERGSGIADALEVALTDLRHAWEQGLPRALGWEGGG |
| Ga0209177_103715872 | 3300027775 | Agricultural Soil | GAAGTVEDRGSRVADTLDVPVADLRHAWEHGLARALGWEGE |
| Ga0209798_100578323 | 3300027843 | Wetland Sediment | AAEERGAGVADAVDVALANLGHAWEHGLPRALGVEA |
| Ga0209068_108341382 | 3300027894 | Watersheds | IELGGRGVIGDAEERGPQGADALDVAVADLRHAWDHGLARALGED |
| Ga0268265_123568382 | 3300028380 | Switchgrass Rhizosphere | ELTGSGATGAAEERGSGVADAIDVPLTNLRHAWEHGLARALGWESPAFASEGR |
| Ga0268264_103614982 | 3300028381 | Switchgrass Rhizosphere | TGAAEELGSDVADELDVAINNLRHAWEQGLARSLGWEAS |
| Ga0247828_104326992 | 3300028587 | Soil | ATGAAEERGSRVADAVDVPVADLRHAWEHGLPRALGWDGIDGMEDLR |
| Ga0247819_106210182 | 3300028608 | Soil | GASATGAAEERGSRVADEIDVALADLERAWEHGLPRALGWDA |
| Ga0307295_101946832 | 3300028708 | Soil | AGAGATGAAEERGSRVADSIDVARADLERAWQHGLPRALGWLELEQEGAR |
| Ga0307280_100351401 | 3300028768 | Soil | TGSAEDRGSRVADELSVSLDELRHAWEGGLSRALGWEQR |
| Ga0247826_107423441 | 3300030336 | Soil | GDRLAIELAGAGATGAAEERGSRVADAVDVPVASLRHAWEHGLPRALGWDDKDAVEGLR |
| Ga0247826_116954822 | 3300030336 | Soil | GRGATGAAEERVSGIADALEVPVADMRHAWEHGLSRALGWDDAGAEGIR |
| Ga0302211_100321281 | 3300030491 | Fen | AAEERGSRIADALEVTVADLQHAWEQGLPRALGWETGA |
| Ga0307372_103263052 | 3300031671 | Soil | LAGEGATGAAEARGSRIADAVDVAVADLRHAWEHGLPRALGLDA |
| Ga0316578_107102432 | 3300031728 | Rhizosphere | GEGATGAAEERGSRIADAIDVSVDDLRHAWEHGLPRALGWEPAD |
| Ga0307406_111475792 | 3300031901 | Rhizosphere | AEERGSRVADALEVPLADLRHAWEHGLPRALGWEG |
| Ga0311367_105078251 | 3300031918 | Fen | VGRGATGAAEERGTGLADEIDIAVTDLAHAREHGLPRALGEDG |
| Ga0308175_1015668131 | 3300031938 | Soil | GDRLVVELAGAGATGAAEERGSNVADSIDVGITDLERAWEAGLPRALGWDQDGAGATEGG |
| Ga0308175_1032534801 | 3300031938 | Soil | RLFVELAGAGATGAAEERGSGVADAIDVALADLTRAWERGLPRALGWDEQSAGVEGR |
| Ga0326597_119570801 | 3300031965 | Soil | VIDLAGAGATGAAEERGSRVADSLDLAVNELDRIWRTGLSRALGWDEAG |
| Ga0307409_1004984241 | 3300031995 | Rhizosphere | GAAEDRGSRVADALIVDLDELRHAWEGGLARALGWEAG |
| Ga0307416_1011023112 | 3300032002 | Rhizosphere | AAEARGSRVADAVDVAVADLRHAWETGLARSLGWEDA |
| Ga0318506_104303212 | 3300032052 | Soil | AAEERGARVADTLNVPLADLRHAWEHGLARALGWEGA |
| Ga0315268_100783881 | 3300032173 | Sediment | DLIGEGATGAAEERGARVADAVDLALVDLRHAWEQGLPRALGVEA |
| Ga0315270_109082282 | 3300032275 | Sediment | LVVELGGEGATGAAEERGSRVADALEVPVADLRHAWEHGLPRALGWESGA |
| Ga0316622_1020982172 | 3300033416 | Soil | ERGSRVADALDVSLGDLRHAWDHGLARALGLEGAR |
| Ga0364924_000335_3_176 | 3300033811 | Sediment | VDEIGTVGGDRLVIELARSGTGEERGSSGADAVDVALADVRHAWEHGLSRSLGWEVA |
| Ga0364940_0043679_2_142 | 3300034164 | Sediment | LTGAGATGAAEERGSRVADALDVPLDDLRRAWEHGLGRALGWDEAT |
| Ga0373917_0086677_3_140 | 3300034692 | Sediment Slurry | ELSGHGATGAAEARGSRVADALDVALVDLRHAWEHGLARALGEVA |
| ⦗Top⦘ |