Metagenome Family F087925

Basic Information
Family ID	F087925
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	41 residues
Representative Sequence	GVSLMTATPKPTEHLTVDVEDPRTLTAAQRSSTIEEKWR
Number of Associated Samples	93
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	5.45 %
% of genes near scaffold ends (potentially truncated)	90.91 %
% of genes from short scaffolds (< 2000 bps)	99.09 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Bacteria (95.455 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.455 % of family members)
Environment Ontology (ENVO)	Unclassified (32.727 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.182 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF00664	ABC_membrane	44.55
PF08402	TOBE_2	5.45
PF00005	ABC_tran	3.64
PF02615	Ldh_2	2.73
PF02776	TPP_enzyme_N	2.73
PF01663	Phosphodiest	1.82
PF01425	Amidase	0.91
PF07883	Cupin_2	0.91
PF00069	Pkinase	0.91
PF12681	Glyoxalase_2	0.91
PF04909	Amidohydro_2	0.91
PF03328	HpcH_HpaI	0.91
PF05988	DUF899	0.91
PF00211	Guanylate_cyc	0.91
PF00848	Ring_hydroxyl_A	0.91
PF13620	CarboxypepD_reg	0.91
PF02900	LigB	0.91
PF00486	Trans_reg_C	0.91
PF05378	Hydant_A_N	0.91
PF04392	ABC_sub_bind	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.64
COG2055	Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family	Energy production and conversion [C]	2.73
COG0145	N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit	Amino acid transport and metabolism [E]	1.82
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.82
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.91
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.91
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.91
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.91
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.91
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.91
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.45 %
Unclassified	root	N/A	4.55 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.45 %
Unclassified	root	N/A	4.55 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.45 %
Unclassified	root	N/A	4.55 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	60.91 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	7.27 %
Unclassified	root	N/A	4.55 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	33.64 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	7.27 %
Unclassified	root	N/A	4.55 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.91 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	25.45 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	7.27 %
Unclassified	root	N/A	4.55 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3.64 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.73 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	25.45 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	6.36 %
Unclassified	root	N/A	4.55 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	3.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.82 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.91 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.91 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	25.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	6.36 %
Unclassified	root	N/A	4.55 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	2.73 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.91 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.91 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.91 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.91 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	25.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	6.36 %
Unclassified	root	N/A	4.55 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	2.73 %
unclassified Burkholderia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia	0.91 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.91 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.91 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.91 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	25.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	6.36 %
Unclassified	root	N/A	4.55 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	2.73 %
Burkholderia sp. AU4i	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. AU4i	0.91 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.91 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.91 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000561\|F21B_10694009	Not Available	563	Open in IMG/M
3300001431\|F14TB_100236530	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	598	Open in IMG/M
3300004463\|Ga0063356_105520692	All Organisms → cellular organisms → Bacteria → Proteobacteria	543	Open in IMG/M
3300005186\|Ga0066676_10585053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	756	Open in IMG/M
3300005332\|Ga0066388_102602016	All Organisms → cellular organisms → Bacteria	922	Open in IMG/M
3300005436\|Ga0070713_101943621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	571	Open in IMG/M
3300005467\|Ga0070706_101935515	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300005529\|Ga0070741_10980732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	726	Open in IMG/M
3300005554\|Ga0066661_10562279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	681	Open in IMG/M
3300005614\|Ga0068856_102600760	All Organisms → cellular organisms → Bacteria → Proteobacteria	512	Open in IMG/M
3300005713\|Ga0066905_102064926	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300005764\|Ga0066903_101619163	Not Available	1229	Open in IMG/M
3300005764\|Ga0066903_102198636	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
3300005764\|Ga0066903_102257105	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M
3300005764\|Ga0066903_102695810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	964	Open in IMG/M
3300005764\|Ga0066903_105603698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	661	Open in IMG/M
3300005764\|Ga0066903_105925778	All Organisms → cellular organisms → Bacteria → Proteobacteria	641	Open in IMG/M
3300005891\|Ga0075283_1103595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	535	Open in IMG/M
3300006032\|Ga0066696_10094990	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300006034\|Ga0066656_10680578	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	662	Open in IMG/M
3300006800\|Ga0066660_10171008	All Organisms → cellular organisms → Bacteria	1629	Open in IMG/M
3300006853\|Ga0075420_101238946	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300007265\|Ga0099794_10660159	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300009038\|Ga0099829_10598020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	917	Open in IMG/M
3300009089\|Ga0099828_12014180	All Organisms → cellular organisms → Bacteria → Proteobacteria	505	Open in IMG/M
3300009090\|Ga0099827_11302390	All Organisms → cellular organisms → Bacteria → Proteobacteria	632	Open in IMG/M
3300009100\|Ga0075418_11839627	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	659	Open in IMG/M
3300009162\|Ga0075423_12044819	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300009444\|Ga0114945_10128627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1441	Open in IMG/M
3300010046\|Ga0126384_11819502	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	579	Open in IMG/M
3300010047\|Ga0126382_10365551	All Organisms → cellular organisms → Bacteria → Proteobacteria	1112	Open in IMG/M
3300010335\|Ga0134063_10619956	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300010343\|Ga0074044_10414556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. AU4i	882	Open in IMG/M
3300010358\|Ga0126370_12381266	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300010359\|Ga0126376_10289917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1417	Open in IMG/M
3300010360\|Ga0126372_10837607	All Organisms → cellular organisms → Bacteria → Proteobacteria	915	Open in IMG/M
3300010360\|Ga0126372_11157891	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300010361\|Ga0126378_12155822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	636	Open in IMG/M
3300010362\|Ga0126377_12460786	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	596	Open in IMG/M
3300010362\|Ga0126377_12626504	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300010366\|Ga0126379_13537218	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	523	Open in IMG/M
3300010376\|Ga0126381_104343142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	549	Open in IMG/M
3300010398\|Ga0126383_11079733	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300010398\|Ga0126383_13259024	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	530	Open in IMG/M
3300012199\|Ga0137383_10931801	All Organisms → cellular organisms → Bacteria → Proteobacteria	634	Open in IMG/M
3300012212\|Ga0150985_102151548	All Organisms → cellular organisms → Bacteria → Proteobacteria	740	Open in IMG/M
3300012361\|Ga0137360_10592168	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	949	Open in IMG/M
3300012362\|Ga0137361_11172560	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300012469\|Ga0150984_109440301	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300012532\|Ga0137373_10417114	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
3300012925\|Ga0137419_10475609	Not Available	988	Open in IMG/M
3300012925\|Ga0137419_11380655	All Organisms → cellular organisms → Bacteria → Proteobacteria	594	Open in IMG/M
3300012929\|Ga0137404_11986701	All Organisms → cellular organisms → Bacteria → Proteobacteria	542	Open in IMG/M
3300012971\|Ga0126369_10576462	All Organisms → cellular organisms → Bacteria → Proteobacteria	1193	Open in IMG/M
3300012971\|Ga0126369_11508808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	762	Open in IMG/M
3300015053\|Ga0137405_1141775	Not Available	1745	Open in IMG/M
3300016319\|Ga0182033_10936919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	768	Open in IMG/M
3300016319\|Ga0182033_11207980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	677	Open in IMG/M
3300016341\|Ga0182035_11180667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683	Open in IMG/M
3300016387\|Ga0182040_10775330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	788	Open in IMG/M
3300016445\|Ga0182038_11169963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	685	Open in IMG/M
3300017973\|Ga0187780_10759330	All Organisms → cellular organisms → Bacteria → Proteobacteria	701	Open in IMG/M
3300017975\|Ga0187782_10957796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	665	Open in IMG/M
3300020580\|Ga0210403_10855529	All Organisms → cellular organisms → Bacteria → Proteobacteria	720	Open in IMG/M
3300021441\|Ga0213871_10038721	All Organisms → cellular organisms → Bacteria → Proteobacteria	1274	Open in IMG/M
3300021560\|Ga0126371_11985356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	699	Open in IMG/M
3300022563\|Ga0212128_10831581	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300026328\|Ga0209802_1256093	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300026358\|Ga0257166_1005404	All Organisms → cellular organisms → Bacteria	1452	Open in IMG/M
3300026550\|Ga0209474_10039078	All Organisms → cellular organisms → Bacteria	3485	Open in IMG/M
3300027681\|Ga0208991_1140680	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300027842\|Ga0209580_10147371	All Organisms → cellular organisms → Bacteria → Proteobacteria	1157	Open in IMG/M
3300027855\|Ga0209693_10143366	All Organisms → cellular organisms → Bacteria → Proteobacteria	1180	Open in IMG/M
3300027907\|Ga0207428_10934180	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300031236\|Ga0302324_101853428	All Organisms → cellular organisms → Bacteria → Proteobacteria	764	Open in IMG/M
3300031236\|Ga0302324_103326734	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300031241\|Ga0265325_10390159	All Organisms → cellular organisms → Bacteria → Proteobacteria	611	Open in IMG/M
3300031545\|Ga0318541_10260743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	964	Open in IMG/M
3300031546\|Ga0318538_10600662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300031561\|Ga0318528_10078978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1704	Open in IMG/M
3300031573\|Ga0310915_10704536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	713	Open in IMG/M
3300031573\|Ga0310915_11114592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300031720\|Ga0307469_11579777	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300031723\|Ga0318493_10562868	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300031744\|Ga0306918_10259496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1329	Open in IMG/M
3300031765\|Ga0318554_10821657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300031770\|Ga0318521_10112920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1510	Open in IMG/M
3300031792\|Ga0318529_10407866	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300031805\|Ga0318497_10270703	All Organisms → cellular organisms → Bacteria	943	Open in IMG/M
3300031846\|Ga0318512_10633152	Not Available	546	Open in IMG/M
3300031897\|Ga0318520_10243639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1071	Open in IMG/M
3300031910\|Ga0306923_10668417	All Organisms → cellular organisms → Bacteria	1159	Open in IMG/M
3300031942\|Ga0310916_10328247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1298	Open in IMG/M
3300031945\|Ga0310913_10495830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	867	Open in IMG/M
3300031945\|Ga0310913_10532789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	834	Open in IMG/M
3300031947\|Ga0310909_10772563	All Organisms → cellular organisms → Bacteria → Proteobacteria	795	Open in IMG/M
3300031954\|Ga0306926_10318481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1924	Open in IMG/M
3300031954\|Ga0306926_12968522	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300031962\|Ga0307479_10788727	All Organisms → cellular organisms → Bacteria → Proteobacteria	926	Open in IMG/M
3300032035\|Ga0310911_10297432	All Organisms → cellular organisms → Bacteria	929	Open in IMG/M
3300032054\|Ga0318570_10090715	All Organisms → cellular organisms → Bacteria	1325	Open in IMG/M
3300032065\|Ga0318513_10130685	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300032068\|Ga0318553_10766066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	505	Open in IMG/M
3300032076\|Ga0306924_10987841	All Organisms → cellular organisms → Bacteria → Proteobacteria	925	Open in IMG/M
3300032089\|Ga0318525_10207930	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300032091\|Ga0318577_10537853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300032091\|Ga0318577_10565460	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300032094\|Ga0318540_10447862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	624	Open in IMG/M
3300032094\|Ga0318540_10650780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	508	Open in IMG/M
3300033290\|Ga0318519_10952478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	532	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.91%
Host-Associated	Host-Associated	9.09%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	89.09%
Plants	Host-Associated → Plants	9.09%
Aquatic	Environmental → Aquatic	1.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	87.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.73%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.82%
Peat	Environmental → Terrestrial → Peat	1.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.91%
Loam	Environmental → Terrestrial → Soil → Loam	12.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.64%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.82%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	36.36%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.18%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.09%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.64%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	1.82%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	25.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.09%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.36%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.64%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	1.82%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.82%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.82%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.82%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.82%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.91%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.91%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000561	Amended soil microbial communities from Kansas Great Prairies, USA - acetate DNA F2.1B clc assemly	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005891	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Host-Associated	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Host-Associated	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087925

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F21B_106940091	3300000561	Soil	RFHSPEGVGLMTATPKPTEHLTVDVEDPRTLTAPQLSKTIEEKWR*
F14TB_1002365301	3300001431	Soil	VSLMTATPKPTEHLTVDVEDPRSLTKSQLSGNVEEKWR*
Ga0063356_1055206921	3300004463	Arabidopsis Thaliana Rhizosphere	GVCLMTATPKPTEHLTVDVEDPRTLTETQRTGATEQKWR*
Ga0066676_105850532	3300005186	Soil	HAPEGVTVVTATPKPTEHLTVDVEDPRTLTAAQRSNAVEEKWR*
Ga0066388_1026020161	3300005332	Tropical Forest Soil	GVSLMTATPKPTEHLTVDVEDPRTLTAAQRSSTIEEKWR*
Ga0070713_1019436211	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	APNGVSIVTATPRPTEHLTVDVEDPRRLSDAERAANSEEKVR*
Ga0070706_1019355152	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	SPEGVSLVTATPKPTEHLTVDVEDPRTLTSAQLSNTIEEKWR*
Ga0070741_109807321	3300005529	Surface Soil	APNGVSIVTATPRPTEHLTVDVADPRTLSDAERAANSEEKVR*
Ga0066661_105622791	3300005554	Soil	VTVVTATPKPTEHLTVDVEDPRTLTAAQLSNAVEEKWR*
Ga0068856_1026007601	3300005614	Corn Rhizosphere	SIVTATPRPTEHLTVDVADPRTLSDAERASNSEAKTH*
Ga0066905_1020649261	3300005713	Tropical Forest Soil	PEGVSLMTATPKPTEHLTVDVDDPRTLTQSQLSGNVEEKWR*
Ga0066903_1016191631	3300005764	Tropical Forest Soil	VTLMTATPKPTEHLTVDVDDPRTLTAAQRSNTTEEKWR*
Ga0066903_1021986361	3300005764	Tropical Forest Soil	PEGVSLMTATPKPTEHLTVDVEDPRTLTKSQLSSNTEEKWR*
Ga0066903_1022571053	3300005764	Tropical Forest Soil	EGVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0066903_1026958101	3300005764	Tropical Forest Soil	VTATPRPTEHLTIDVEDPRTLSDTERSANSEEKVR*
Ga0066903_1056036981	3300005764	Tropical Forest Soil	MTATPKPTEHLTVDVEDPRTLTATELPRNIEGKWR*
Ga0066903_1059257782	3300005764	Tropical Forest Soil	FHSPEGVSVMTATPKPTEHLTVDVEDPRTLTRSQLSGNVEEKWR*
Ga0075283_11035951	3300005891	Rice Paddy Soil	APNGVSIVTVTPRPTEHLTVDVEDPRTLSDDERAANSEAKVR*
Ga0066696_100949903	3300006032	Soil	TWHRFHAPEGVSLLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR*
Ga0066656_106805781	3300006034	Soil	LTATPKPTEHLTVDVEDPRTLTAAQLPDAIEEKWR*
Ga0066660_101710081	3300006800	Soil	RFHAPEGVSLLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR*
Ga0075420_1012389463	3300006853	Populus Rhizosphere	TATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0099794_106601591	3300007265	Vadose Zone Soil	LMTATPKPTEHLTVDVEDPRTLTAAQKSDATEEKWR*
Ga0099829_105980202	3300009038	Vadose Zone Soil	NGVSLVTATPKPTEHLTVDIEDPRTLTSAQLSDTIEEKWR*
Ga0099828_120141801	3300009089	Vadose Zone Soil	VCLITATPKPTEHLTVTVEDPRTLTAAQQSGATEEKWR*
Ga0099827_113023902	3300009090	Vadose Zone Soil	APDGVCLMTATPKPTEHLTVDVEDPRTLSAEQQSGATEEQWR*
Ga0075418_118396273	3300009100	Populus Rhizosphere	GLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0075423_120448192	3300009162	Populus Rhizosphere	MTATPKPTEHLTVDVEDPRTLTVAQLSNTIEEKWR*
Ga0114945_101286271	3300009444	Thermal Springs	LMTATPKPTEHLTVDVGDPRSLSAGQLSGSTEEKWR*
Ga0126384_118195021	3300010046	Tropical Forest Soil	PDGVSVVTATPKPTEHLTVDVEDPRTLTTVQLSNTIEEKWR*
Ga0126382_103655511	3300010047	Tropical Forest Soil	QGVSLMTATPKPTEHLTVDVEDPRTLTKSQLSSNTEEKWR*
Ga0134063_106199562	3300010335	Grasslands Soil	MTVPGVSLMTATPKPTEHLTVDIEDPRTLTDAQRAGNTEEKWR*
Ga0074044_104145562	3300010343	Bog Forest Soil	VGIVTATPRPTEHLTIDVEDPRTLSDAQRAANSEEKVR*
Ga0126370_123812663	3300010358	Tropical Forest Soil	GVSLVTATPKPTEHLTVDVEDPRTLSGAHLSGNIEEKWR*
Ga0126376_102899173	3300010359	Tropical Forest Soil	VTATPKPTEHLTVDVADPGTLSGAERSSHTEEKWR*
Ga0126372_108376071	3300010360	Tropical Forest Soil	GVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0126372_111578911	3300010360	Tropical Forest Soil	HSPEGVSLMTATPKPTEHLTVDVDDPRTLTKTQLSNNTEEKWR*
Ga0126378_121558221	3300010361	Tropical Forest Soil	GVTLMTATPKPTEHLTVDIADPRALDAAKLSGNVEAKWR*
Ga0126377_124607863	3300010362	Tropical Forest Soil	LMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0126377_126265042	3300010362	Tropical Forest Soil	LVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA*
Ga0126379_135372181	3300010366	Tropical Forest Soil	HSPEGVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR*
Ga0126381_1043431422	3300010376	Tropical Forest Soil	VSLVTATPKPTEHLTADVEDPRTLTAAQLSGNIEEKWR*
Ga0126383_110797332	3300010398	Tropical Forest Soil	VTATPKPTEHLTVDVDDPRALTAAQLSNTIEEEWR*
Ga0126383_132590241	3300010398	Tropical Forest Soil	PEGVTLITATPKPTEHLTVDVDDPQALTAAQLSNTIEEKWR*
Ga0137383_109318011	3300012199	Vadose Zone Soil	LMTATPKPTEHLTADVEDPRTLTAAQQSGATEEKWR*
Ga0150985_1021515482	3300012212	Avena Fatua Rhizosphere	FESPEGVCLMTATPKPTEHLTVNVADPRTLEAERLQGSVEEKWR*
Ga0137360_105921681	3300012361	Vadose Zone Soil	GGVSLMTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR*
Ga0137361_111725602	3300012362	Vadose Zone Soil	MTATPKPTEHLTVEVEDPRTLTAAQKSDATEEKWR*
Ga0150984_1094403011	3300012469	Avena Fatua Rhizosphere	GVSLITATPKPTEHLTVDVADPRTLTDTEHSEEKWR*
Ga0137373_104171143	3300012532	Vadose Zone Soil	VSLLTATPKPTEHLTVDVEDPRSLTAAQLPNSIEEKWR*
Ga0137419_104756091	3300012925	Vadose Zone Soil	RFHAPEGVTVVTATPKPTEHLTVDVEDPRTLTAAQRSNAVEEKWR*
Ga0137419_113806551	3300012925	Vadose Zone Soil	MTATPKPTEHLTVDVEDPRTLSAAQQSGATEEKWR*
Ga0137404_119867011	3300012929	Vadose Zone Soil	PDGVCLMTATPKPTEHLTVDVEDPRTLTAAQKSDATEEKWR*
Ga0126369_105764621	3300012971	Tropical Forest Soil	HAPNGVSIITATPRPTEHLTVDVEDPRTLSDAERAANSEEKIH*
Ga0126369_115088082	3300012971	Tropical Forest Soil	LVTATPKPTEHLTVDVEDPRSLEGVQLSGSIEEKWR*
Ga0137405_11417754	3300015053	Vadose Zone Soil	FHSPGGVSLMTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR*
Ga0182033_109369191	3300016319	Soil	VIGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR
Ga0182033_112079802	3300016319	Soil	FKSADGVTLITATPKSTEHLTVDVADPRTLTAAQLSGNTEEKWR
Ga0182035_111806672	3300016341	Soil	TLITATPKPTEHLTVDVEDPRTLSAAQRAGNTEEKWR
Ga0182040_107753302	3300016387	Soil	VSLVTATPKPTEHLTVDVEDPRTLKGAQLSGNVEEKWR
Ga0182038_111699632	3300016445	Soil	APNGVSVVTATPRPTEHLTVDVEDPRTLSDAERAANSEEKVR
Ga0187780_107593302	3300017973	Tropical Peatland	NGVSIVTATPRPTEHLTVDVEDPRTLSDVERAGNSEEKWR
Ga0187782_109577961	3300017975	Tropical Peatland	VMTATPKPTEHLTVDVADPRTLTAEQLSGNVEEKWR
Ga0210403_108555292	3300020580	Soil	FHAPNGVSIVTATPRPTEHLTVNVEDPRTLSNAERAANSEEKVR
Ga0213871_100387211	3300021441	Rhizosphere	PDGVALMTATPKPTEHLTVDVADPRTLTRTQLPRNIEEKWR
Ga0126371_119853561	3300021560	Tropical Forest Soil	DGVGLMTATPKPTEHLTVDVADPRALDEAQLPGNIEQKWR
Ga0212128_108315812	3300022563	Thermal Springs	LMTATPKPTEHLTVDVGDPRSLSAGQLSGSTEEKWR
Ga0209802_12560932	3300026328	Soil	PGGVSLMTATPKPTEHLTVDVEDPRTLTTAQLSNTIEEKWR
Ga0257166_10054042	3300026358	Soil	MTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR
Ga0209474_100390784	3300026550	Soil	LLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR
Ga0208991_11406802	3300027681	Forest Soil	LVTATPKPTEHLTVDVDDPRTLTAAQLSNTIEEKWR
Ga0209580_101473711	3300027842	Surface Soil	SADGVCLMTATPKPTEHLTVDVADPRTLSEAQRGGNTEEKWR
Ga0209693_101433661	3300027855	Soil	HAPEGVSIVTATPRPTEHLTVDVDDPRTLTEAQRTGNTEEKWG
Ga0207428_109341802	3300027907	Populus Rhizosphere	TWHRFHSPDGVSLVTATPKPTEHLTVDVEDPRQLTSAELSGNTEEKWR
Ga0302324_1018534282	3300031236	Palsa	FHAPDGVSIITATPRPTEHLTVDVEDPRVLSDAERAANSEEKVR
Ga0302324_1033267341	3300031236	Palsa	FSAPNGVSIVTATPRPTEHLTVDVEDPRVLSDGERAANSEEKVR
Ga0265325_103901592	3300031241	Rhizosphere	NTWHRFHAPNGVGIVTATPRPTEHLTVDVADPRTLSDMERAANSEEKVR
Ga0318541_102607433	3300031545	Soil	PDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0318538_106006622	3300031546	Soil	RFHAPNGVSVVTATLRPTEHLTVDVEDPRTLSDAERAANSEEKVR
Ga0318528_100789781	3300031561	Soil	VSLMTATPKPTEHLTVDVADPRALDAAQLPGNIEEKWR
Ga0310915_107045362	3300031573	Soil	MTATPKPTEHLTVDVADPRTLDAAQLSGNTEAKWR
Ga0310915_111145921	3300031573	Soil	NGVSIVTATPRPTEHLTVDVEDPRTLTDNERSAHSEEKVR
Ga0307469_115797772	3300031720	Hardwood Forest Soil	SLLTATPKPTEHLTVDVDDPRTLTSAQRSSATEEKWR
Ga0318493_105628682	3300031723	Soil	TWHRFHSPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV
Ga0306918_102594961	3300031744	Soil	ESPDGVSLMTATPKPTEHLTVDVADPRALDAAQLPGNIEEKWR
Ga0318554_108216571	3300031765	Soil	HRFRAPIGVSIVTATPRPTEHLTIDVEDPRTLSDAERGANSEQKVR
Ga0318521_101129202	3300031770	Soil	TGVTVMTATPKPTEHLTVDVEDPRTLTATQLSGTIEEKWR
Ga0318529_104078661	3300031792	Soil	LVTAAPKPTEHLTVGVEDPRTLTDGQRAAATEHKWR
Ga0318497_102707031	3300031805	Soil	SPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA
Ga0318512_106331521	3300031846	Soil	VVVVPQNMWHRFYAPEGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0318520_102436392	3300031897	Soil	TWHRFRAPIGVSIVTATPRPTEHLTIDVEDPRTLSDAERGANSEQKVR
Ga0306923_106684173	3300031910	Soil	MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0310916_103282472	3300031942	Soil	FESVNGVTLITATPKPTEHLTVDVEDPRTLTAAELSGTIEEKWR
Ga0310913_104958301	3300031945	Soil	ITATPKPTEHLTVDVEDPRTLTAAELSGTIEEKWR
Ga0310913_105327892	3300031945	Soil	APNGVSVVTATPRPTEHLTVDVEDPRTLSEAERAANSEEKVR
Ga0310909_107725631	3300031947	Soil	GVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0306926_103184811	3300031954	Soil	IAAAPYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0306926_129685221	3300031954	Soil	MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHK
Ga0307479_107887272	3300031962	Hardwood Forest Soil	LITATPKPTEHLTVDVEDPRTLSDPQRSGNTEEKWR
Ga0310911_102974324	3300032035	Soil	MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRGAATEHKWR
Ga0318570_100907151	3300032054	Soil	PEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV
Ga0318513_101306853	3300032065	Soil	VTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV
Ga0318553_107660661	3300032068	Soil	HRFHAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR
Ga0306924_109878411	3300032076	Soil	QNMWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR
Ga0318525_102079303	3300032089	Soil	TWHRFRSPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA
Ga0318577_105378532	3300032091	Soil	VDGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR
Ga0318577_105654601	3300032091	Soil	SPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV
Ga0318540_104478622	3300032094	Soil	DGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR
Ga0318540_106507801	3300032094	Soil	FHAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR
Ga0318519_109524781	3300033290	Soil	HAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign