NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087555

Metagenome Family F087555

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087555
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 51 residues
Representative Sequence MRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR
Number of Associated Samples 96
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 30.91 %
% of genes near scaffold ends (potentially truncated) 61.82 %
% of genes from short scaffolds (< 2000 bps) 72.73 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(40.909 % of family members)
Environment Ontology (ENVO) Unclassified
(47.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(65.455 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 76.92%    β-sheet: 0.00%    Coil/Unstructured: 23.08%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF09685DUF4870 60.00
PF00535Glycos_transf_2 14.55
PF00275EPSP_synthase 13.64
PF04226Transgly_assoc 5.45
PF00472RF-1 1.82
PF05175MTS 1.82
PF01197Ribosomal_L31 1.82
PF03462PCRF 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 5.45
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 2.73
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 2.73
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 1.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_2386233All Organisms → cellular organisms → Bacteria1251Open in IMG/M
2199352025|deepsgr__Contig_78304All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300000953|JGI11615J12901_11203981All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300001661|JGI12053J15887_10604829All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005167|Ga0066672_10006587All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5259Open in IMG/M
3300005167|Ga0066672_10080898All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300005167|Ga0066672_10270128All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005171|Ga0066677_10309360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes903Open in IMG/M
3300005175|Ga0066673_10031121All Organisms → cellular organisms → Bacteria2564Open in IMG/M
3300005176|Ga0066679_10974670All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005177|Ga0066690_10129575All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300005179|Ga0066684_10020144All Organisms → cellular organisms → Bacteria3453Open in IMG/M
3300005179|Ga0066684_10485695All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia829Open in IMG/M
3300005180|Ga0066685_10491257All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300005187|Ga0066675_10021095All Organisms → cellular organisms → Bacteria → Proteobacteria3677Open in IMG/M
3300005289|Ga0065704_10047624All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005290|Ga0065712_10101009All Organisms → cellular organisms → Bacteria2047Open in IMG/M
3300005294|Ga0065705_10232403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae1262Open in IMG/M
3300005338|Ga0068868_100014548All Organisms → cellular organisms → Bacteria5802Open in IMG/M
3300005364|Ga0070673_100048362All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3315Open in IMG/M
3300005434|Ga0070709_10083256All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300005434|Ga0070709_11539913All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005436|Ga0070713_100425014All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1244Open in IMG/M
3300005437|Ga0070710_11361361All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005445|Ga0070708_101707486All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005447|Ga0066689_10258758All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300005454|Ga0066687_10438470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes762Open in IMG/M
3300005459|Ga0068867_101060560All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005554|Ga0066661_10424576All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005554|Ga0066661_10680615All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium605Open in IMG/M
3300005560|Ga0066670_11047424All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300005569|Ga0066705_10940645All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005575|Ga0066702_10319978All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300005576|Ga0066708_10025686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales3081Open in IMG/M
3300005576|Ga0066708_10912263All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005598|Ga0066706_10760178All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006032|Ga0066696_10061264All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300006032|Ga0066696_10957653All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006034|Ga0066656_10559323All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006034|Ga0066656_10897422All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006175|Ga0070712_100639168All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria903Open in IMG/M
3300006796|Ga0066665_10561516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia926Open in IMG/M
3300006796|Ga0066665_11374061All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006797|Ga0066659_10361005All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300009012|Ga0066710_104251535All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010303|Ga0134082_10126304All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300010321|Ga0134067_10175353All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium776Open in IMG/M
3300010323|Ga0134086_10345630All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300010325|Ga0134064_10071397All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300012198|Ga0137364_10144676All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1714Open in IMG/M
3300012205|Ga0137362_10205330All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1696Open in IMG/M
3300012207|Ga0137381_10681532All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter894Open in IMG/M
3300012350|Ga0137372_10120776All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2172Open in IMG/M
3300012354|Ga0137366_10117399All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2011Open in IMG/M
3300012918|Ga0137396_10991572All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300012923|Ga0137359_10155432All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae2039Open in IMG/M
3300012923|Ga0137359_10770328All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter835Open in IMG/M
3300012930|Ga0137407_10080427All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae2744Open in IMG/M
3300012955|Ga0164298_11611203All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012958|Ga0164299_11241263All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012984|Ga0164309_10031276All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae2923Open in IMG/M
3300012984|Ga0164309_10403022All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1021Open in IMG/M
3300012986|Ga0164304_10293351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1111Open in IMG/M
3300013096|Ga0157307_1021799All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300013102|Ga0157371_10095563All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2106Open in IMG/M
3300015245|Ga0137409_10124370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2374Open in IMG/M
3300018000|Ga0184604_10000568All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus4278Open in IMG/M
3300018027|Ga0184605_10066643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1553Open in IMG/M
3300018073|Ga0184624_10483993All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300018433|Ga0066667_11565965All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300018482|Ga0066669_11029557All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300019881|Ga0193707_1085097All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia963Open in IMG/M
3300019887|Ga0193729_1017749All Organisms → cellular organisms → Bacteria3118Open in IMG/M
3300019887|Ga0193729_1027661All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2414Open in IMG/M
3300019887|Ga0193729_1106455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1060Open in IMG/M
3300020015|Ga0193734_1092379All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300020062|Ga0193724_1076768All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300020581|Ga0210399_11605239All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300021168|Ga0210406_10008070All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae10583Open in IMG/M
3300021413|Ga0193750_1007341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae2847Open in IMG/M
3300021559|Ga0210409_11357434All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300024288|Ga0179589_10084273All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300025898|Ga0207692_10491310All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300025916|Ga0207663_10015165All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus4244Open in IMG/M
3300026306|Ga0209468_1126984All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300026309|Ga0209055_1018622All Organisms → cellular organisms → Bacteria3383Open in IMG/M
3300026317|Ga0209154_1152183All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300026322|Ga0209687_1007180All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria3729Open in IMG/M
3300026324|Ga0209470_1231580All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300026328|Ga0209802_1041219All Organisms → cellular organisms → Bacteria2349Open in IMG/M
3300026330|Ga0209473_1012520All Organisms → cellular organisms → Bacteria4149Open in IMG/M
3300026332|Ga0209803_1341378All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300026333|Ga0209158_1148650All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300026335|Ga0209804_1011952All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus4678Open in IMG/M
3300026342|Ga0209057_1074215All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300026342|Ga0209057_1084084All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300026528|Ga0209378_1075019All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300026530|Ga0209807_1255064All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300026538|Ga0209056_10383203All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300026542|Ga0209805_1228970All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300026550|Ga0209474_10014892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus6145Open in IMG/M
3300026552|Ga0209577_10005461All Organisms → cellular organisms → Bacteria11853Open in IMG/M
3300026677|Ga0207600_101422All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027461|Ga0207601_106644All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027821|Ga0209811_10028452All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300028784|Ga0307282_10133649All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300028799|Ga0307284_10066956All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300028807|Ga0307305_10301865All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300028881|Ga0307277_10407897All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031474|Ga0170818_106783710All Organisms → cellular organisms → Bacteria500Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil40.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026677Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-A (SPAdes)EnvironmentalOpen in IMG/M
3300027461Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0649.000051302162886007Switchgrass RhizosphereLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
deepsgr_011092802199352025SoilMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
JGI11615J12901_1120398123300000953SoilVKHFMRPLYCLLLAIAIFETGCAAQQQAQNSDPMLQRSEQSKVHGEVGVAYGQSAR*
JGI12053J15887_1060482923300001661Forest SoilMRPLDCLLLALAIFETGCAAQQQASDPMLQRTEQAKVHGEVGVAYGQSTR*
Ga0066672_1000658753300005167SoilLLLAVAIFETGCAAQQEASDPMLQREDSKVHGEVGVAYGQGTIRTR*
Ga0066672_1008089833300005167SoilMNTNAEYFMRPLYCLLLAVAIFQTGCAAQQQAQNSDPMLQRTEQSKVHGEVGATYGQSAR
Ga0066672_1027012833300005167SoilLRNTNAEYFMPLFYYLLLVVAIFETGCAVQQQARNSDPMLQRPEQSKVHGEVGFAYGQSAH*
Ga0066677_1030936023300005171SoilMNTNAEYFMRPLYCLLLAVAIFQTGCAAQQQAQNADPMLQRTEQSKVHGEVGVAYGQSAR
Ga0066673_1003112153300005175SoilMNTNAEYFMRPLHCLLLALAVFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0066679_1097467013300005176SoilRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0066690_1012957533300005177SoilFETGCAAQQEASDPMLQREDSKVHGEVGVAYGQGTIRTR*
Ga0066684_1002014453300005179SoilYFMRPLYCLLLAVAIFQTGCAAQQQAQNSDPMLQRTERSKVHGEVGVAYGQSAR*
Ga0066684_1048569513300005179SoilMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAY
Ga0066685_1049125733300005180SoilLLAVAIFEIGCAAQQQAQNSDPILQRTEQSKVYGEVGVAYGQSTR*
Ga0066675_1002109563300005187SoilMKTNAEYFMRPLYCLLLAVAIFEIGCAAQQQAQNSDPILQRTEQSKVYGEVGVAYGQSTR
Ga0065704_1004762413300005289Switchgrass RhizosphereMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0065712_1010100933300005290Miscanthus RhizosphereLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0065705_1023240333300005294Switchgrass RhizosphereMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0068868_10001454873300005338Miscanthus RhizosphereMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVG
Ga0070673_10004836213300005364Switchgrass RhizosphereFLRNTNAEYFMRPLYCLLLALAIFETGCAAQPQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0070709_1008325623300005434Corn, Switchgrass And Miscanthus RhizosphereLLLALAIFETGCAAQQQAENSDPMLQRIEQSKVHGEVGVVYGQSAR*
Ga0070709_1153991323300005434Corn, Switchgrass And Miscanthus RhizosphereFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQQKVHGEVGVVYGQSAR*
Ga0070713_10042501433300005436Corn, Switchgrass And Miscanthus RhizosphereMRPLYCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSA
Ga0070710_1136136123300005437Corn, Switchgrass And Miscanthus RhizosphereFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0070708_10170748613300005445Corn, Switchgrass And Miscanthus RhizosphereLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0066689_1025875833300005447SoilLLLAVAIFETGCAAQQEASDPMLQRDDSKVHGEVGVAYGQGTIRTR*
Ga0066687_1043847023300005454SoilMNTNAEYFMRPLYCLLLAVAIFQTGCAAQQQAQNSDPILQRTEQSKVHGEVGATYGQITR
Ga0068867_10106056013300005459Miscanthus RhizospherePLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0066661_1042457633300005554SoilETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0066661_1068061513300005554SoilLLLAVAIFETGCAAQQEASDPMLQREDSKVHGEVGVAYGQ
Ga0066670_1104742413300005560SoilMNTNAEYFMRPLYCLLLAVAIFQTGCAAQQQAQNADPMLQRTEQSKVHGEVGVAYGQ
Ga0066705_1094064513300005569SoilYCLLLAVAIFQTGCAAQQQAQNSDPILQRTEQSKVHGEVGATYGQITR*
Ga0066702_1031997833300005575SoilIGLSFLRNTNAEYFVRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0066708_1002568623300005576SoilMRPLHCLLLALAIFEPGCAAHQQAENSDPMLQRIEQPKVHGEVGVVYGQSAH*
Ga0066708_1091226313300005576SoilLCCLLLAAAIFETGCATHEQTQNSDPMLQRTDQDWKVHGEVGVAYGQGTIRTR*
Ga0066706_1076017813300005598SoilLAVFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0066696_1006126443300006032SoilLLLAVAIFETGCAAQQEASDPMLQRDDSKVHGEVGVA*
Ga0066696_1095765313300006032SoilAEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0066656_1055932313300006034SoilAAQQQAQNSDPVLQRIEQPKVHGEVGVVYGQSAR*
Ga0066656_1089742223300006034SoilRNTNAEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0070712_10063916833300006175Corn, Switchgrass And Miscanthus RhizosphereRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0066665_1056151623300006796SoilMRPLHCLFLALAIFETGCAAQQQAENSDPVLQRTEQTKVHGEVGAAYG
Ga0066665_1137406113300006796SoilNTNAEYFMRPLHCLLLALAVFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0066659_1036100513300006797SoilTNAEYFMRPLYCLLLAVAIFEIGCAAQQQAQNSDPILQRTEQSKVYGEVGVAYGQSTR*
Ga0066710_10425153513300009012Grasslands SoilLYCLLLAVAIFETGCAAQQEASDPMLQRDDSKVHGEVGVAYGQGTIRTH
Ga0134082_1012630413300010303Grasslands SoilAEYFMRPLYCLLLAVAIFEIGCAAQQQAQNSDPILQRTEQSKVYGEVGVAYGQSTR*
Ga0134067_1017535323300010321Grasslands SoilLLLALAIFETGCAAHQQAENSDPMLQRIEQPKVHGEVGVAYWQSTR*
Ga0134086_1034563023300010323Grasslands SoilMNINAEYFMRPLHCLLLALAIFETGCAAHQQAENSDPMLQRIEQPKVHGEVGVVYGQSAH
Ga0134064_1007139713300010325Grasslands SoilSFLMNTNAEYFMRPLHCLLLALAIFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0137364_1014467623300012198Vadose Zone SoilLLLAIAIFETGCAAQQEASDPMLQRDDSKVHGEVGVAYGQGTIRTR*
Ga0137362_1020533023300012205Vadose Zone SoilMRPLHCLFLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGKVGVVYGQSAR*
Ga0137381_1068153223300012207Vadose Zone SoilMRPLHRLFLALAIFETGCAAQQQAQNSDPMLQRLEQPKVHGEVGVVYGQSAR*
Ga0137372_1012077633300012350Vadose Zone SoilLLLAIAIFETGCAAEQEASDPMLQRDDSKVHGEVGVAYGQGTIRTR*
Ga0137366_1011739933300012354Vadose Zone SoilLLLAIAIFETGCAAEQEASDPMLQRDDSKVHGEVGVAYGQGTIRTH*
Ga0137396_1099157213300012918Vadose Zone SoilPLYCLLLAVAILQTGCAAQQQAQNSDPMLQRTEQSKVHGEVGVAYGQSAH*
Ga0137359_1015543213300012923Vadose Zone SoilLAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0137359_1077032833300012923Vadose Zone SoilLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0137407_1008042743300012930Vadose Zone SoilAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0164298_1161120323300012955SoilLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0164299_1124126323300012958SoilAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0164309_1003127623300012984SoilMRPLHCLLLALAIFETGCAAQQQAQNSDPMLQRTEQSKVHGEVGVAYGQSTR*
Ga0164309_1040302233300012984SoilLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0164304_1029335133300012986SoilALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0157307_102179923300013096SoilMKTNAEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0157371_1009556333300013102Corn RhizosphereMRPLHCLLLAVAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR*
Ga0137409_1012437033300015245Vadose Zone SoilMRPLYCLLLAVAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR*
Ga0184604_1000056863300018000Groundwater SedimentLMNTNAEYFMRPLYCLLLAVAIFETGCATNQQVSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0184605_1006664333300018027Groundwater SedimentIFETGCATHEQASDPMLQRTEQDSKVHGEVGVAYGQGTR
Ga0184624_1048399323300018073Groundwater SedimentPLHCLLLALAIFETGCAAQQQAQNSDPMLQRTEQSKVHGEVGVAYGQSTR
Ga0066667_1156596513300018433Grasslands SoilRNTNAEYFMPLFYYLLLVVAIFETGCAVQQQARNSDPMLQRPEQSKVHGEVGFAYGQSAH
Ga0066669_1102955723300018482Grasslands SoilLAVAIFETGCAAQQEASDPMLQREDSEVHGEVGVAYGQGTIRTH
Ga0193707_108509713300019881SoilMRPLHCLLLALAIFETGCAAQQQAQNSDPKLQRTEQSKVHGEVGVAYG
Ga0193729_101774923300019887SoilMKTNAEYFMRPLYCLLLAVAIFETGCAAQQQAQNSDPMLQRTEQSKVHGEVGVAYGQSTR
Ga0193729_102766143300019887SoilMELSFRMKNNAEYFMRPLYCLLLAVAIFETGCAPQQQASDPMLQRTEQTKVHGEVGVAYGQSTR
Ga0193729_110645523300019887SoilMRLLYCLLLAVAIFETGCATHQQASDPMLQRTDTDTKVHGEVGVAYGQGTR
Ga0193734_109237913300020015SoilGCAAQQQAQSSDPMLQRTEEDSKVHGEVGVAYGQGTR
Ga0193724_107676823300020062SoilIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0210399_1160523913300020581SoilAEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRVEQPKVHGEVGAVYGQSAR
Ga0210406_1000807073300021168SoilMRPLYCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0193750_100734123300021413SoilMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVLYGQSAR
Ga0210409_1135743423300021559SoilLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVQGEVGVVYGQSTR
Ga0179589_1008427323300024288Vadose Zone SoilMRPLDCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0207692_1049131013300025898Corn, Switchgrass And Miscanthus RhizosphereGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0207663_1001516523300025916Corn, Switchgrass And Miscanthus RhizosphereMRPLHCLLLALAIFETGCAAQQQAENSDPMLKRIEQPKVHGEVGVVYGQSAR
Ga0209468_112698423300026306SoilMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAH
Ga0209055_101862263300026309SoilMRPLYCLLLAVAIFQTGCAAQQQAQNSDPMLQRTEQSKVHGEVGATYGQSAR
Ga0209154_115218313300026317SoilLFYYLLLVVAIFETGCAVQQQARNSDPMLQRPEQSKVHGEVGFAYGQSAH
Ga0209687_100718023300026322SoilMNTNAEYFIRPLHCLLLALAIFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209470_123158023300026324SoilMNTNAEYFMRPLHCLLLALAIFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209802_104121933300026328SoilMNTNAEYFMRPLHRLLLALAIFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209473_101252033300026330SoilMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0209803_134137813300026332SoilALAIFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209158_114865013300026333SoilYFVRPLHCLLLALAIFETGCAAQQQAENSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0209804_101195213300026335SoilRLLYCLLLAVAIFETGCAAQQEASDPMLQREDSKVHGEVGVAYGQGTIRTR
Ga0209057_107421533300026342SoilEYFMRPLHCLLLALAVFETGCAAQQQAQNSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209057_108408413300026342SoilFETGCATERQASDPMLQRPEQDSKVHGEVGVAYGQSAR
Ga0209378_107501933300026528SoilPLHCLFLALAIFETGCAAQQQAENSDPMLQRTEQTKVHGEVGAAYGQSAR
Ga0209807_125506423300026530SoilFETGCAAQQQAQNSDPMLQRTDQDWKVHGEVGAAYGQSTR
Ga0209056_1038320313300026538SoilRPLYCLLLAVAIFEIGCAAQQQAQNSDPILQRTEQSKVYGEVGVAYGQSTR
Ga0209805_122897023300026542SoilLGNSNAEYFMRPLHCLLLALAIFATGCAAPQQVENSDPMLQRTEQTKVHGEVGVAYGQST
Ga0209474_1001489283300026550SoilTNAKYFVRLLYCLLLAVAIFETGCAAQQEASDPMLQREDSKVHDEVGVAYGQGTIRTR
Ga0209577_1000546133300026552SoilMRPLYCLLLAVAIFQTGCAAQQQAQNSDPMLQRTEQSKVHGEVGVAYGQSAR
Ga0207600_10142223300026677SoilFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0207601_10664413300027461SoilECFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0209811_1002845233300027821Surface SoilFLRNTNAEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0307282_1013364933300028784SoilEYFVRPFHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0307284_1006695633300028799SoilLRNTNAEYFMRPLHCLLLTLAIFEAGCAAHQQAENSDPMLQRTEQSKVHGEVGVAYGQST
Ga0307305_1030186523300028807SoilEYFMRPLHCLLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR
Ga0307277_1040789723300028881SoilMNTNAEYFMRPLYCLLLAVAIFETGCATNQQVSDQMLQRTEQSKVHGEVGVAYGQSAR
Ga0170818_10678371023300031474Forest SoilLLALAIFETGCAAQQQAENSDPMLQRIEQPKVHGEVGVVYGQSAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.