NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085746

Metagenome / Metatranscriptome Family F085746

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085746
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 45 residues
Representative Sequence LPSDPGALKTVFELTRSGTYSGKLGIRSNLDVTNVIGAFRVNLTL
Number of Associated Samples 98
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.50 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (97.297 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(25.225 % of family members)
Environment Ontology (ENVO) Unclassified
(35.135 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(57.658 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.11%    β-sheet: 0.00%    Coil/Unstructured: 95.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF05065Phage_capsid 10.81
PF04984Phage_sheath_1 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 10.81
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000367|SS_2KS_010_SOILDRAFT_10196387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300002408|B570J29032_109121731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300002408|B570J29032_109935027All Organisms → cellular organisms → Bacteria3289Open in IMG/M
3300002835|B570J40625_101112784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300003394|JGI25907J50239_1115093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300004790|Ga0007758_10715170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300004795|Ga0007756_11509552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300005421|Ga0068882_1730210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1245Open in IMG/M
3300006378|Ga0075498_1362420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300006402|Ga0075511_1757415All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage852Open in IMG/M
3300006875|Ga0075473_10396343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300007346|Ga0070753_1210884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300007521|Ga0105044_10871469All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300007549|Ga0102879_1098305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage912Open in IMG/M
3300007622|Ga0102863_1056410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1148Open in IMG/M
3300008107|Ga0114340_1047905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1883Open in IMG/M
3300008996|Ga0102831_1284389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300009049|Ga0102911_1048001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1251Open in IMG/M
3300009056|Ga0102860_1195092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300009984|Ga0105029_115756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300010293|Ga0116204_1119388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage900Open in IMG/M
3300010354|Ga0129333_10587994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300012012|Ga0153799_1080201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300012013|Ga0153805_1097089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300012212|Ga0150985_112405202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300012504|Ga0129347_1103872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300012706|Ga0157627_1060272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300012708|Ga0157595_1011108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage984Open in IMG/M
3300012759|Ga0157626_1055302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300012962|Ga0129335_1170338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1322Open in IMG/M
3300012962|Ga0129335_1215984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300012970|Ga0129338_1414341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300013087|Ga0163212_1033431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1786Open in IMG/M
3300013092|Ga0163199_1225244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage727Open in IMG/M
(restricted) 3300013132|Ga0172372_10220027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1419Open in IMG/M
(restricted) 3300013137|Ga0172375_10841047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300013372|Ga0177922_11162723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
(restricted) 3300014720|Ga0172376_10164300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1458Open in IMG/M
(restricted) 3300014720|Ga0172376_10744286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300016686|Ga0180056_1013287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1214Open in IMG/M
3300016691|Ga0180055_1069095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1145Open in IMG/M
3300016743|Ga0182083_1409129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300017788|Ga0169931_10265115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1387Open in IMG/M
3300017788|Ga0169931_10993034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300018424|Ga0181591_10247180All Organisms → Viruses → Predicted Viral1382Open in IMG/M
3300019201|Ga0180032_1131677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300019229|Ga0180116_1354451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1235Open in IMG/M
3300020074|Ga0194113_10274576All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1294Open in IMG/M
3300020083|Ga0194111_10132915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1929Open in IMG/M
3300020083|Ga0194111_10329813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300020196|Ga0194124_10063231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2246Open in IMG/M
3300020220|Ga0194119_10485855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300020221|Ga0194127_10306013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1073Open in IMG/M
3300021091|Ga0194133_10065154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3007Open in IMG/M
3300021963|Ga0222712_10068294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2580Open in IMG/M
3300022176|Ga0212031_1044739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300024348|Ga0244776_10281660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300024480|Ga0255223_1100764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300024531|Ga0255228_1050237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300024536|Ga0256338_1043212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300024536|Ga0256338_1134491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300024537|Ga0255225_1052672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300024537|Ga0255225_1094399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300024537|Ga0255225_1094594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300024543|Ga0256348_1014343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1310Open in IMG/M
3300024549|Ga0256308_1024900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1308Open in IMG/M
3300024559|Ga0255284_1114679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300024562|Ga0256336_1083899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300024569|Ga0255243_1039276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1218Open in IMG/M
3300024572|Ga0255268_1035329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1251Open in IMG/M
3300024573|Ga0256337_1041952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1163Open in IMG/M
3300024573|Ga0256337_1082722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300024852|Ga0255295_1022498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1225Open in IMG/M
3300024852|Ga0255295_1120845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300024858|Ga0255286_1094103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300025655|Ga0208795_1078332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300025687|Ga0208019_1081422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1033Open in IMG/M
3300025732|Ga0208784_1226742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300026425|Ga0256300_1009177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1306Open in IMG/M
3300026564|Ga0256359_1030638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1041Open in IMG/M
3300026568|Ga0255240_1033123All Organisms → Viruses → Predicted Viral1205Open in IMG/M
3300026568|Ga0255240_1131384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300027241|Ga0208805_1088821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300027246|Ga0208931_1026127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1187Open in IMG/M
3300027305|Ga0208168_1046487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300027571|Ga0208897_1106973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300027608|Ga0208974_1059593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1079Open in IMG/M
3300027759|Ga0209296_1187936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300027782|Ga0209500_10391895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300028025|Ga0247723_1128280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300028089|Ga0255299_1024412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1117Open in IMG/M
3300028103|Ga0255172_1044752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300028112|Ga0256335_1163372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300028113|Ga0255234_1138995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300028271|Ga0255256_1101427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300028374|Ga0306906_1051426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300029697|Ga0256301_1015422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1254Open in IMG/M
3300029930|Ga0119944_1042839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300031857|Ga0315909_10195035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1612Open in IMG/M
3300031857|Ga0315909_10316577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300031857|Ga0315909_10614559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300033995|Ga0335003_0089292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1608Open in IMG/M
3300034063|Ga0335000_0004656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11161Open in IMG/M
3300034071|Ga0335028_0095097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1958Open in IMG/M
3300034093|Ga0335012_0097643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1643Open in IMG/M
3300034095|Ga0335022_0425367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300034103|Ga0335030_0352050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage970Open in IMG/M
3300034106|Ga0335036_0577734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300034108|Ga0335050_0248200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage885Open in IMG/M
3300034121|Ga0335058_0450429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300034200|Ga0335065_0742170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater25.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.72%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.81%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.90%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.90%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.90%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.90%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.90%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.90%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.90%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.90%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.90%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.90%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment0.90%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000367Alkaline soda soil microbial communities from Kulunda Steppe, Russia - 2KS_010_SOILEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005421Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009984Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaGHost-AssociatedOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300016686Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016691Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016743Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024531Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024537Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024543Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024569Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024858Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026564Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027241Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027305Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028089Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028112Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028271Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028374Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2)EnvironmentalOpen in IMG/M
3300029697Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SS_2KS_010_SOILDRAFT_1019638713300000367Alkaline SedimentNFDDGLLSYMQLPSDPGAVKHVYELTKEGNYQGRLGIRANLDVENVLGAVRVNLTL*
B570J29032_10912173113300002408FreshwaterLSYMQLPSDPGALKTVFELTRAGSFTGKLGIRSNLDVNNVIGAFRVNLTL*
B570J29032_10993502763300002408FreshwaterDPGALKTVYELTRAGTFSGKLGIRANLDVNNVIGAFRVNLTL**
B570J40625_10111278423300002835FreshwaterYMLLPSDPGALKEVFELTQSGPYQGKLGIRSNLDTANVVGAIRVSLTL*
JGI25907J50239_111509313300003394Freshwater LakeLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL*
Ga0007758_1071517023300004790Freshwater LakeDDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL*
Ga0007756_1150955223300004795Freshwater LakeLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL*
Ga0068882_173021013300005421Freshwater LakeMQLPSDPGALKTVYELTRSGSYSGKLGIRANLDVYNVIGAFRVNLTL*
Ga0075498_136242013300006378AqueousLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL*
Ga0075511_175741513300006402AqueousDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL*
Ga0075473_1039634313300006875AqueousSDPGALKTVYELTRTGTYSGKLGIRANLDVTNVIGAFRVNLTL*
Ga0070753_121088413300007346AqueousKTVYELTRSGDYTGKLGIRANLDVNNVIGAFRVNLTL*
Ga0105044_1087146923300007521FreshwaterDGLLSYMQLPSDPGALKAVYELTRPGPFQGRLGIRKNLDVANVIGAFRAVLTLT*
Ga0102879_109830523300007549EstuarineTVYELTKAGPNSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0102863_105641013300007622EstuarineMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL*
Ga0114340_104790513300008107Freshwater, PlanktonKFATNFDDGLLSYMQLPSDPGALKTVFELTKSGAFQGKLGIRSNLDVTNVIGAFRVNLTL
Ga0102831_128438913300008996EstuarineVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0102911_104800113300009049EstuarineGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0102860_119509213300009056EstuarineSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVYNVIGAFRVNLTL*
Ga0105029_11575623300009984Switchgrass RhizosphereSYMQLPSDPGALKLVYELTQSGPYQGKLGIRANLDVANVIGAVRVNLSL*
Ga0116204_111938823300010293Anoxic Lake WaterGALKTVYELTRAGTFKGKLGIRANLDVNNVIGAFRVNLTL*
Ga0129333_1058799423300010354Freshwater To Marine Saline GradientDGLLSYMQLPSDPGALKTVFEITRSGTYSGKLGIRSNLDVHNVKGAFRVNLTL*
Ga0153799_108020133300012012FreshwaterVFELTRSGSFSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0153805_109708923300012013Surface IceSYMQLPSDPGALKTVYEITREGTYKNKLGIRSNLDVTNVVGAFRVNLTL*
Ga0150985_11240520223300012212Avena Fatua RhizosphereSYMLLPSDPGALKTVYELTKWGQNTGKLGIRANLDVANVVGAMRAVLRA*
Ga0129347_110387213300012504AqueousLKTVYELTRSGTYSGKLGIRANLDVNNVVGAFRVNLTL*
Ga0157627_106027223300012706FreshwaterLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157595_101110823300012708FreshwaterQLPSDPGALKTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157626_105530223300012759FreshwaterTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0129335_117033813300012962AqueousQLPTDPGARKTVYEITISGSYQGKLGIRSNLDVTNVVGAFRVNLTL*
Ga0129335_121598423300012962AqueousSDPGALKTVFEITRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0129338_141434123300012970AqueousLLSYMQLPSDPGALKTVYELTRTGAYNGKLGIRANLDVDHVIGAFRVNLTL*
Ga0163212_103343133300013087FreshwaterPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL*
Ga0163199_122524423300013092FreshwaterFDDGLLSYMQLPSDPGALKTVYELTKTGTYSGKLGIRANLDVTNVIGAFRVNLTL*
(restricted) Ga0172372_1022002733300013132FreshwaterALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
(restricted) Ga0172375_1084104713300013137FreshwaterDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVVGAFRVNLTL*
Ga0177922_1116272313300013372FreshwaterVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL*
(restricted) Ga0172376_1016430033300014720FreshwaterVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
(restricted) Ga0172376_1074428623300014720FreshwaterPSDPGALKTVYELTRAGTFSGKLGIRANLDVNNVIGAFRVNLTL*
Ga0180056_101328723300016686FreshwaterLPSDPGALKTVFELTRSGTYSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0180055_106909523300016691FreshwaterPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0182083_140912923300016743Salt MarshDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL
Ga0169931_1026511523300017788FreshwaterGLLSYMQLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0169931_1099303423300017788FreshwaterPSDPGALKTVYELTRSGSFNGKLGIRANLDVYNVIGAFRVNLTL
Ga0181591_1024718023300018424Salt MarshSDPGALADVYELTKSGPNQGKLGIRSNLDVADVVGAFRVLLTL
Ga0180032_113167713300019201EstuarineLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0180116_135445123300019229Groundwater SedimentEKFATNFDDGLLSYMQLPSDPGALKEVYSLTKPGTYNGKLGIRANLNVANVTGAIRVALT
Ga0194113_1027457623300020074Freshwater LakeGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0194111_1013291513300020083Freshwater LakeQLPSDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVVGAFRVNLTL
Ga0194111_1032981323300020083Freshwater LakePGALKTVFEITRSGTFSGKLGIRSNLDVHNVKGAFRVNLTL
Ga0194124_1006323113300020196Freshwater LakeLSYMQLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0194119_1048585523300020220Freshwater LakeDGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194127_1030601323300020221Freshwater LakeQLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0194133_1006515463300021091Freshwater LakeGLLSYMQLPSDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVIGAFRVNLTL
Ga0222712_1006829413300021963Estuarine WaterSDPGALKTVFEVTRTGTYQGKLGIRSNLDVTNVLGAFRVNLTL
Ga0212031_104473923300022176AqueousSMQLPSDPGALKTVFELTRSGAYSGKLGIRANLDVNNVIGAFRVNLTL
Ga0244776_1028166023300024348EstuarineLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL
Ga0255223_110076423300024480FreshwaterQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255228_105023723300024531FreshwaterLLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIPSNLDVTNVLGAFRVNLTL
Ga0256338_104321213300024536FreshwaterDPGALKTVFELTKSGTYQGKLGIRANLDVTNVIGAFRVSLSM
Ga0256338_113449113300024536FreshwaterMQLPSDPGALKTVFEITRTGTYSGKLGIRSNLDVTNVLGAFRVNLTL
Ga0255225_105267213300024537FreshwaterGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0255225_109439923300024537FreshwaterSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255225_109459423300024537FreshwaterALKTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0256348_101434313300024543FreshwaterSDPGALKTVYELTRSGAYSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0256308_102490023300024549FreshwaterDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255284_111467913300024559FreshwaterLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0256336_108389923300024562FreshwaterSYMQLPSDPGALKEVYELTKTGPYQGKLGIRSNLDTANVVGAIRVSLTL
Ga0255243_103927613300024569FreshwaterSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0255268_103532923300024572FreshwaterKTVFEITRTATYSGKLGIRSNLDVTNVLGAFRVNLTL
Ga0256337_104195223300024573FreshwaterVYELTREGSYKGKLGIRSNLDVTNVVGAFRVNLTL
Ga0256337_108272213300024573FreshwaterLKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0255295_102249823300024852FreshwaterSDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255295_112084523300024852FreshwaterQLPSDPGALKTVYELTRSGSYSVKLGIRANLDVYNVIGAFRVNLTL
Ga0255286_109410313300024858FreshwaterVFELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL
Ga0208795_107833213300025655AqueousKTVYELTRSGSYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0208019_108142223300025687AqueousGALKTVYELTRNGTYSGKLGIRANLDVDNVVGAFRVNLTL
Ga0208784_122674223300025732AqueousSDPGALKTVYELTRTGTYSGKLGIRANLDVTNVIGAFRVNLTL
Ga0256300_100917713300026425FreshwaterNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0256359_103063823300026564FreshwaterKTVYELTRSGAYSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255240_103312323300026568FreshwaterKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255240_113138423300026568FreshwaterLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0208805_108882123300027241EstuarineLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0208931_102612713300027246EstuarineFDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0208168_104648723300027305EstuarineDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0208897_110697313300027571EstuarineYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0208974_105959313300027608Freshwater LenticEKFATNFDDGLLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLT
Ga0209296_118793623300027759Freshwater LakeGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0209500_1039189523300027782Freshwater LakePSDPGALKTVFELTRSGSFSGKLGIRSNLDVTNVIGAFRVNLTI
Ga0247723_112828023300028025Deep Subsurface SedimentLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0255299_102441223300028089FreshwaterLLSYMQLPSDPGALKTVYEITREGTYKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0255172_104475213300028103FreshwaterKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0256335_116337213300028112FreshwaterTNFDDGLLSYMQQPSDPGALKTVFELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL
Ga0255234_113899513300028113FreshwaterSDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0255256_110142723300028271FreshwaterDDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL
Ga0306906_105142613300028374Saline LakeDGLLSYMQLPSDPGAVKEVYSITEAGTYQGKLGIRANLDKANVVGAFRVNLTL
Ga0256301_101542213300029697FreshwaterDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0119944_104283913300029930AquaticGALKTVFEVTRTGTYQGKLGIRSNLDVTNVLGAFRVNLTL
Ga0315909_1019503533300031857FreshwaterMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVVGAFRVNLTL
Ga0315909_1031657713300031857FreshwaterSYMQLPSDPGALKTVFELTRSGTYSGKLGIRANLDVNNVIGAFRVNLTL
Ga0315909_1061455923300031857FreshwaterKEVYELTKTGPYSGKLGIRSNLDTANVVGAIRVSLTL
Ga0335003_0089292_1487_16063300033995FreshwaterALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL
Ga0335000_0004656_2_1813300034063FreshwaterFATNFDDGLLSYMQLPSDPGALKTVFELTRAGSFTGKLGIRSNLDVNNVIGAFRVNLTL
Ga0335028_0095097_1821_19583300034071FreshwaterLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL
Ga0335012_0097643_1_1083300034093FreshwaterVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0335022_0425367_3_1253300034095FreshwaterGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL
Ga0335030_0352050_3_1613300034103FreshwaterGLLSYMQLPSDPGALKTVYELTRSGTYNGKLGIRANLDVDHVIGAFRVNLTL
Ga0335036_0577734_1_1353300034106FreshwaterPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL
Ga0335050_0248200_1_1263300034108FreshwaterPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0335058_0450429_2_1213300034121FreshwaterALKTVFELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0335065_0742170_448_5553300034200FreshwaterVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.