Basic Information | |
---|---|
Family ID | F085746 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 111 |
Average Sequence Length | 45 residues |
Representative Sequence | LPSDPGALKTVFELTRSGTYSGKLGIRSNLDVTNVIGAFRVNLTL |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.50 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (97.297 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (25.225 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.135 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.658 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.11% β-sheet: 0.00% Coil/Unstructured: 95.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 10.81 |
PF04984 | Phage_sheath_1 | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 10.81 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000367|SS_2KS_010_SOILDRAFT_10196387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300002408|B570J29032_109121731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300002408|B570J29032_109935027 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
3300002835|B570J40625_101112784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300003394|JGI25907J50239_1115093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300004790|Ga0007758_10715170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300004795|Ga0007756_11509552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
3300005421|Ga0068882_1730210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
3300006378|Ga0075498_1362420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300006402|Ga0075511_1757415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300006875|Ga0075473_10396343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300007346|Ga0070753_1210884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300007521|Ga0105044_10871469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300007549|Ga0102879_1098305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300007622|Ga0102863_1056410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
3300008107|Ga0114340_1047905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1883 | Open in IMG/M |
3300008996|Ga0102831_1284389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300009049|Ga0102911_1048001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300009056|Ga0102860_1195092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300009984|Ga0105029_115756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300010293|Ga0116204_1119388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300010354|Ga0129333_10587994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300012012|Ga0153799_1080201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300012013|Ga0153805_1097089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300012212|Ga0150985_112405202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300012504|Ga0129347_1103872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300012706|Ga0157627_1060272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300012708|Ga0157595_1011108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300012759|Ga0157626_1055302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300012962|Ga0129335_1170338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
3300012962|Ga0129335_1215984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300012970|Ga0129338_1414341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300013087|Ga0163212_1033431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1786 | Open in IMG/M |
3300013092|Ga0163199_1225244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10220027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10841047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300013372|Ga0177922_11162723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10164300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10744286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300016686|Ga0180056_1013287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
3300016691|Ga0180055_1069095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300016743|Ga0182083_1409129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300017788|Ga0169931_10265115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1387 | Open in IMG/M |
3300017788|Ga0169931_10993034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300018424|Ga0181591_10247180 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
3300019201|Ga0180032_1131677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300019229|Ga0180116_1354451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
3300020074|Ga0194113_10274576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
3300020083|Ga0194111_10132915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1929 | Open in IMG/M |
3300020083|Ga0194111_10329813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
3300020196|Ga0194124_10063231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2246 | Open in IMG/M |
3300020220|Ga0194119_10485855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300020221|Ga0194127_10306013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300021091|Ga0194133_10065154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3007 | Open in IMG/M |
3300021963|Ga0222712_10068294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2580 | Open in IMG/M |
3300022176|Ga0212031_1044739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300024348|Ga0244776_10281660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300024480|Ga0255223_1100764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300024531|Ga0255228_1050237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300024536|Ga0256338_1043212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300024536|Ga0256338_1134491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300024537|Ga0255225_1052672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300024537|Ga0255225_1094399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300024537|Ga0255225_1094594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300024543|Ga0256348_1014343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
3300024549|Ga0256308_1024900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
3300024559|Ga0255284_1114679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300024562|Ga0256336_1083899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300024569|Ga0255243_1039276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
3300024572|Ga0255268_1035329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300024573|Ga0256337_1041952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300024573|Ga0256337_1082722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300024852|Ga0255295_1022498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
3300024852|Ga0255295_1120845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300024858|Ga0255286_1094103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300025655|Ga0208795_1078332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300025687|Ga0208019_1081422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300025732|Ga0208784_1226742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300026425|Ga0256300_1009177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
3300026564|Ga0256359_1030638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
3300026568|Ga0255240_1033123 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
3300026568|Ga0255240_1131384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300027241|Ga0208805_1088821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300027246|Ga0208931_1026127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
3300027305|Ga0208168_1046487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300027571|Ga0208897_1106973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300027608|Ga0208974_1059593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
3300027759|Ga0209296_1187936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300027782|Ga0209500_10391895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300028025|Ga0247723_1128280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300028089|Ga0255299_1024412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
3300028103|Ga0255172_1044752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300028112|Ga0256335_1163372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300028113|Ga0255234_1138995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300028271|Ga0255256_1101427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300028374|Ga0306906_1051426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300029697|Ga0256301_1015422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
3300029930|Ga0119944_1042839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300031857|Ga0315909_10195035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
3300031857|Ga0315909_10316577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300031857|Ga0315909_10614559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300033995|Ga0335003_0089292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
3300034063|Ga0335000_0004656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11161 | Open in IMG/M |
3300034071|Ga0335028_0095097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1958 | Open in IMG/M |
3300034093|Ga0335012_0097643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1643 | Open in IMG/M |
3300034095|Ga0335022_0425367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300034103|Ga0335030_0352050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300034106|Ga0335036_0577734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300034108|Ga0335050_0248200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300034121|Ga0335058_0450429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300034200|Ga0335065_0742170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 25.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.72% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.81% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.01% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.60% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.80% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.80% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.80% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.90% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.90% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.90% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.90% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.90% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.90% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.90% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.90% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.90% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.90% |
Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 0.90% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.90% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000367 | Alkaline soda soil microbial communities from Kulunda Steppe, Russia - 2KS_010_SOIL | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300016686 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024852 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024858 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026564 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027241 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028271 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028374 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2) | Environmental | Open in IMG/M |
3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
SS_2KS_010_SOILDRAFT_101963871 | 3300000367 | Alkaline Sediment | NFDDGLLSYMQLPSDPGAVKHVYELTKEGNYQGRLGIRANLDVENVLGAVRVNLTL* |
B570J29032_1091217311 | 3300002408 | Freshwater | LSYMQLPSDPGALKTVFELTRAGSFTGKLGIRSNLDVNNVIGAFRVNLTL* |
B570J29032_1099350276 | 3300002408 | Freshwater | DPGALKTVYELTRAGTFSGKLGIRANLDVNNVIGAFRVNLTL** |
B570J40625_1011127842 | 3300002835 | Freshwater | YMLLPSDPGALKEVFELTQSGPYQGKLGIRSNLDTANVVGAIRVSLTL* |
JGI25907J50239_11150931 | 3300003394 | Freshwater Lake | LPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL* |
Ga0007758_107151702 | 3300004790 | Freshwater Lake | DDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL* |
Ga0007756_115095522 | 3300004795 | Freshwater Lake | LSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL* |
Ga0068882_17302101 | 3300005421 | Freshwater Lake | MQLPSDPGALKTVYELTRSGSYSGKLGIRANLDVYNVIGAFRVNLTL* |
Ga0075498_13624201 | 3300006378 | Aqueous | LPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL* |
Ga0075511_17574151 | 3300006402 | Aqueous | DDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL* |
Ga0075473_103963431 | 3300006875 | Aqueous | SDPGALKTVYELTRTGTYSGKLGIRANLDVTNVIGAFRVNLTL* |
Ga0070753_12108841 | 3300007346 | Aqueous | KTVYELTRSGDYTGKLGIRANLDVNNVIGAFRVNLTL* |
Ga0105044_108714692 | 3300007521 | Freshwater | DGLLSYMQLPSDPGALKAVYELTRPGPFQGRLGIRKNLDVANVIGAFRAVLTLT* |
Ga0102879_10983052 | 3300007549 | Estuarine | TVYELTKAGPNSGKLGIRSNLDVTNVIGAFRVNLTL* |
Ga0102863_10564101 | 3300007622 | Estuarine | MQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL* |
Ga0114340_10479051 | 3300008107 | Freshwater, Plankton | KFATNFDDGLLSYMQLPSDPGALKTVFELTKSGAFQGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0102831_12843891 | 3300008996 | Estuarine | VYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL* |
Ga0102911_10480011 | 3300009049 | Estuarine | GALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL* |
Ga0102860_11950921 | 3300009056 | Estuarine | SYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVYNVIGAFRVNLTL* |
Ga0105029_1157562 | 3300009984 | Switchgrass Rhizosphere | SYMQLPSDPGALKLVYELTQSGPYQGKLGIRANLDVANVIGAVRVNLSL* |
Ga0116204_11193882 | 3300010293 | Anoxic Lake Water | GALKTVYELTRAGTFKGKLGIRANLDVNNVIGAFRVNLTL* |
Ga0129333_105879942 | 3300010354 | Freshwater To Marine Saline Gradient | DGLLSYMQLPSDPGALKTVFEITRSGTYSGKLGIRSNLDVHNVKGAFRVNLTL* |
Ga0153799_10802013 | 3300012012 | Freshwater | VFELTRSGSFSGKLGIRSNLDVTNVIGAFRVNLTL* |
Ga0153805_10970892 | 3300012013 | Surface Ice | SYMQLPSDPGALKTVYEITREGTYKNKLGIRSNLDVTNVVGAFRVNLTL* |
Ga0150985_1124052022 | 3300012212 | Avena Fatua Rhizosphere | SYMLLPSDPGALKTVYELTKWGQNTGKLGIRANLDVANVVGAMRAVLRA* |
Ga0129347_11038721 | 3300012504 | Aqueous | LKTVYELTRSGTYSGKLGIRANLDVNNVVGAFRVNLTL* |
Ga0157627_10602722 | 3300012706 | Freshwater | LPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL* |
Ga0157595_10111082 | 3300012708 | Freshwater | QLPSDPGALKTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL* |
Ga0157626_10553022 | 3300012759 | Freshwater | TVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL* |
Ga0129335_11703381 | 3300012962 | Aqueous | QLPTDPGARKTVYEITISGSYQGKLGIRSNLDVTNVVGAFRVNLTL* |
Ga0129335_12159842 | 3300012962 | Aqueous | SDPGALKTVFEITRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL* |
Ga0129338_14143412 | 3300012970 | Aqueous | LLSYMQLPSDPGALKTVYELTRTGAYNGKLGIRANLDVDHVIGAFRVNLTL* |
Ga0163212_10334313 | 3300013087 | Freshwater | PGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL* |
Ga0163199_12252442 | 3300013092 | Freshwater | FDDGLLSYMQLPSDPGALKTVYELTKTGTYSGKLGIRANLDVTNVIGAFRVNLTL* |
(restricted) Ga0172372_102200273 | 3300013132 | Freshwater | ALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL* |
(restricted) Ga0172375_108410471 | 3300013137 | Freshwater | DPGALKTVFELTRAGTFKGKLGIRSNLDVHNVVGAFRVNLTL* |
Ga0177922_111627231 | 3300013372 | Freshwater | VFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL* |
(restricted) Ga0172376_101643003 | 3300014720 | Freshwater | VFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL* |
(restricted) Ga0172376_107442862 | 3300014720 | Freshwater | PSDPGALKTVYELTRAGTFSGKLGIRANLDVNNVIGAFRVNLTL* |
Ga0180056_10132872 | 3300016686 | Freshwater | LPSDPGALKTVFELTRSGTYSGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0180055_10690952 | 3300016691 | Freshwater | PSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL |
Ga0182083_14091292 | 3300016743 | Salt Marsh | DDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL |
Ga0169931_102651152 | 3300017788 | Freshwater | GLLSYMQLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL |
Ga0169931_109930342 | 3300017788 | Freshwater | PSDPGALKTVYELTRSGSFNGKLGIRANLDVYNVIGAFRVNLTL |
Ga0181591_102471802 | 3300018424 | Salt Marsh | SDPGALADVYELTKSGPNQGKLGIRSNLDVADVVGAFRVLLTL |
Ga0180032_11316771 | 3300019201 | Estuarine | LPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL |
Ga0180116_13544512 | 3300019229 | Groundwater Sediment | EKFATNFDDGLLSYMQLPSDPGALKEVYSLTKPGTYNGKLGIRANLNVANVTGAIRVALT |
Ga0194113_102745762 | 3300020074 | Freshwater Lake | GALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL |
Ga0194111_101329151 | 3300020083 | Freshwater Lake | QLPSDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVVGAFRVNLTL |
Ga0194111_103298132 | 3300020083 | Freshwater Lake | PGALKTVFEITRSGTFSGKLGIRSNLDVHNVKGAFRVNLTL |
Ga0194124_100632311 | 3300020196 | Freshwater Lake | LSYMQLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL |
Ga0194119_104858552 | 3300020220 | Freshwater Lake | DGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0194127_103060132 | 3300020221 | Freshwater Lake | QLPSDPGALKTVYEITREGTFKNKLGIRSNLDVTNVVGAFRVNLTL |
Ga0194133_100651546 | 3300021091 | Freshwater Lake | GLLSYMQLPSDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0222712_100682941 | 3300021963 | Estuarine Water | SDPGALKTVFEVTRTGTYQGKLGIRSNLDVTNVLGAFRVNLTL |
Ga0212031_10447392 | 3300022176 | Aqueous | SMQLPSDPGALKTVFELTRSGAYSGKLGIRANLDVNNVIGAFRVNLTL |
Ga0244776_102816602 | 3300024348 | Estuarine | LLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0255223_11007642 | 3300024480 | Freshwater | QLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0255228_10502372 | 3300024531 | Freshwater | LLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIPSNLDVTNVLGAFRVNLTL |
Ga0256338_10432121 | 3300024536 | Freshwater | DPGALKTVFELTKSGTYQGKLGIRANLDVTNVIGAFRVSLSM |
Ga0256338_11344911 | 3300024536 | Freshwater | MQLPSDPGALKTVFEITRTGTYSGKLGIRSNLDVTNVLGAFRVNLTL |
Ga0255225_10526721 | 3300024537 | Freshwater | GALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL |
Ga0255225_10943992 | 3300024537 | Freshwater | SYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0255225_10945942 | 3300024537 | Freshwater | ALKTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0256348_10143431 | 3300024543 | Freshwater | SDPGALKTVYELTRSGAYSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0256308_10249002 | 3300024549 | Freshwater | DGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0255284_11146791 | 3300024559 | Freshwater | LLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0256336_10838992 | 3300024562 | Freshwater | SYMQLPSDPGALKEVYELTKTGPYQGKLGIRSNLDTANVVGAIRVSLTL |
Ga0255243_10392761 | 3300024569 | Freshwater | SYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL |
Ga0255268_10353292 | 3300024572 | Freshwater | KTVFEITRTATYSGKLGIRSNLDVTNVLGAFRVNLTL |
Ga0256337_10419522 | 3300024573 | Freshwater | VYELTREGSYKGKLGIRSNLDVTNVVGAFRVNLTL |
Ga0256337_10827221 | 3300024573 | Freshwater | LKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL |
Ga0255295_10224982 | 3300024852 | Freshwater | SDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0255295_11208452 | 3300024852 | Freshwater | QLPSDPGALKTVYELTRSGSYSVKLGIRANLDVYNVIGAFRVNLTL |
Ga0255286_10941031 | 3300024858 | Freshwater | VFELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0208795_10783321 | 3300025655 | Aqueous | KTVYELTRSGSYSGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0208019_10814222 | 3300025687 | Aqueous | GALKTVYELTRNGTYSGKLGIRANLDVDNVVGAFRVNLTL |
Ga0208784_12267422 | 3300025732 | Aqueous | SDPGALKTVYELTRTGTYSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0256300_10091771 | 3300026425 | Freshwater | NFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0256359_10306382 | 3300026564 | Freshwater | KTVYELTRSGAYSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0255240_10331232 | 3300026568 | Freshwater | KTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0255240_11313842 | 3300026568 | Freshwater | LSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0208805_10888212 | 3300027241 | Estuarine | LPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0208931_10261271 | 3300027246 | Estuarine | FDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0208168_10464872 | 3300027305 | Estuarine | DPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0208897_11069731 | 3300027571 | Estuarine | YMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0208974_10595931 | 3300027608 | Freshwater Lentic | EKFATNFDDGLLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLT |
Ga0209296_11879362 | 3300027759 | Freshwater Lake | GLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0209500_103918952 | 3300027782 | Freshwater Lake | PSDPGALKTVFELTRSGSFSGKLGIRSNLDVTNVIGAFRVNLTI |
Ga0247723_11282802 | 3300028025 | Deep Subsurface Sediment | LSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL |
Ga0255299_10244122 | 3300028089 | Freshwater | LLSYMQLPSDPGALKTVYEITREGTYKNKLGIRSNLDVTNVVGAFRVNLTL |
Ga0255172_10447521 | 3300028103 | Freshwater | KTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0256335_11633721 | 3300028112 | Freshwater | TNFDDGLLSYMQQPSDPGALKTVFELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0255234_11389951 | 3300028113 | Freshwater | SDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0255256_11014272 | 3300028271 | Freshwater | DDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL |
Ga0306906_10514261 | 3300028374 | Saline Lake | DGLLSYMQLPSDPGAVKEVYSITEAGTYQGKLGIRANLDKANVVGAFRVNLTL |
Ga0256301_10154221 | 3300029697 | Freshwater | DPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL |
Ga0119944_10428391 | 3300029930 | Aquatic | GALKTVFEVTRTGTYQGKLGIRSNLDVTNVLGAFRVNLTL |
Ga0315909_101950353 | 3300031857 | Freshwater | MQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVVGAFRVNLTL |
Ga0315909_103165771 | 3300031857 | Freshwater | SYMQLPSDPGALKTVFELTRSGTYSGKLGIRANLDVNNVIGAFRVNLTL |
Ga0315909_106145592 | 3300031857 | Freshwater | KEVYELTKTGPYSGKLGIRSNLDTANVVGAIRVSLTL |
Ga0335003_0089292_1487_1606 | 3300033995 | Freshwater | ALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0335000_0004656_2_181 | 3300034063 | Freshwater | FATNFDDGLLSYMQLPSDPGALKTVFELTRAGSFTGKLGIRSNLDVNNVIGAFRVNLTL |
Ga0335028_0095097_1821_1958 | 3300034071 | Freshwater | LPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0335012_0097643_1_108 | 3300034093 | Freshwater | VYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL |
Ga0335022_0425367_3_125 | 3300034095 | Freshwater | GALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL |
Ga0335030_0352050_3_161 | 3300034103 | Freshwater | GLLSYMQLPSDPGALKTVYELTRSGTYNGKLGIRANLDVDHVIGAFRVNLTL |
Ga0335036_0577734_1_135 | 3300034106 | Freshwater | PSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL |
Ga0335050_0248200_1_126 | 3300034108 | Freshwater | PGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL |
Ga0335058_0450429_2_121 | 3300034121 | Freshwater | ALKTVFELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL |
Ga0335065_0742170_448_555 | 3300034200 | Freshwater | VFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL |
⦗Top⦘ |