| Basic Information | |
|---|---|
| Family ID | F085321 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVVLISGPLVDRLLARKR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.73 % |
| % of genes near scaffold ends (potentially truncated) | 17.12 % |
| % of genes from short scaffolds (< 2000 bps) | 68.47 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.586 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.76% β-sheet: 0.00% Coil/Unstructured: 39.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00873 | ACR_tran | 34.23 |
| PF13416 | SBP_bac_8 | 10.81 |
| PF13343 | SBP_bac_6 | 1.80 |
| PF02803 | Thiolase_C | 0.90 |
| PF05199 | GMC_oxred_C | 0.90 |
| PF07963 | N_methyl | 0.90 |
| PF13618 | Gluconate_2-dh3 | 0.90 |
| PF14492 | EFG_III | 0.90 |
| PF08402 | TOBE_2 | 0.90 |
| PF07676 | PD40 | 0.90 |
| PF00246 | Peptidase_M14 | 0.90 |
| PF00005 | ABC_tran | 0.90 |
| PF00528 | BPD_transp_1 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.90 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.59 % |
| Unclassified | root | N/A | 14.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_673539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 812 | Open in IMG/M |
| 3300000787|JGI11643J11755_10821491 | Not Available | 518 | Open in IMG/M |
| 3300002124|C687J26631_10065804 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300002243|C687J29039_10267770 | Not Available | 592 | Open in IMG/M |
| 3300003319|soilL2_10084593 | All Organisms → cellular organisms → Bacteria | 4966 | Open in IMG/M |
| 3300004019|Ga0055439_10023062 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300004114|Ga0062593_100011503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4178 | Open in IMG/M |
| 3300004114|Ga0062593_100171384 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300004114|Ga0062593_100205708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1573 | Open in IMG/M |
| 3300004463|Ga0063356_100409464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1748 | Open in IMG/M |
| 3300004463|Ga0063356_100722307 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300004463|Ga0063356_100905750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1246 | Open in IMG/M |
| 3300004480|Ga0062592_100006082 | All Organisms → cellular organisms → Bacteria | 4351 | Open in IMG/M |
| 3300004480|Ga0062592_101697788 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 614 | Open in IMG/M |
| 3300004643|Ga0062591_101524702 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 669 | Open in IMG/M |
| 3300004643|Ga0062591_102083034 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005295|Ga0065707_10880387 | Not Available | 573 | Open in IMG/M |
| 3300005367|Ga0070667_100903150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 822 | Open in IMG/M |
| 3300005438|Ga0070701_10339469 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005444|Ga0070694_100288136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1254 | Open in IMG/M |
| 3300005445|Ga0070708_100086884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2841 | Open in IMG/M |
| 3300005467|Ga0070706_100616067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1008 | Open in IMG/M |
| 3300005467|Ga0070706_101343509 | Not Available | 655 | Open in IMG/M |
| 3300005467|Ga0070706_101624669 | Not Available | 589 | Open in IMG/M |
| 3300005468|Ga0070707_100194230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1979 | Open in IMG/M |
| 3300005468|Ga0070707_100280237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1620 | Open in IMG/M |
| 3300005471|Ga0070698_100058874 | All Organisms → cellular organisms → Bacteria | 3882 | Open in IMG/M |
| 3300005471|Ga0070698_101574938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
| 3300005518|Ga0070699_100000140 | All Organisms → cellular organisms → Bacteria | 67871 | Open in IMG/M |
| 3300005518|Ga0070699_101901414 | Not Available | 544 | Open in IMG/M |
| 3300005518|Ga0070699_102158447 | Not Available | 508 | Open in IMG/M |
| 3300005540|Ga0066697_10141213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1419 | Open in IMG/M |
| 3300005546|Ga0070696_101769975 | Not Available | 533 | Open in IMG/M |
| 3300005617|Ga0068859_100280303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1759 | Open in IMG/M |
| 3300005836|Ga0074470_10767059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1550 | Open in IMG/M |
| 3300006844|Ga0075428_100125941 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300006845|Ga0075421_100544597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1372 | Open in IMG/M |
| 3300006854|Ga0075425_100031556 | All Organisms → cellular organisms → Bacteria | 5881 | Open in IMG/M |
| 3300006854|Ga0075425_100036723 | All Organisms → cellular organisms → Bacteria | 5456 | Open in IMG/M |
| 3300006854|Ga0075425_101445886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 777 | Open in IMG/M |
| 3300006871|Ga0075434_100222769 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300006914|Ga0075436_100661632 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300009012|Ga0066710_100210621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2776 | Open in IMG/M |
| 3300009095|Ga0079224_104291981 | Not Available | 560 | Open in IMG/M |
| 3300009147|Ga0114129_10019744 | All Organisms → cellular organisms → Bacteria | 9592 | Open in IMG/M |
| 3300009162|Ga0075423_11003578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 887 | Open in IMG/M |
| 3300009687|Ga0116144_10082561 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300009873|Ga0131077_10004446 | All Organisms → cellular organisms → Bacteria | 34957 | Open in IMG/M |
| 3300009873|Ga0131077_10007897 | All Organisms → cellular organisms → Bacteria | 26664 | Open in IMG/M |
| 3300010356|Ga0116237_10153600 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300010356|Ga0116237_11672332 | Not Available | 519 | Open in IMG/M |
| 3300010391|Ga0136847_11842118 | All Organisms → cellular organisms → Bacteria | 24664 | Open in IMG/M |
| 3300010391|Ga0136847_13367892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 775 | Open in IMG/M |
| 3300010399|Ga0134127_11276012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 803 | Open in IMG/M |
| 3300011419|Ga0137446_1004675 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300011428|Ga0137456_1120381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 691 | Open in IMG/M |
| 3300011433|Ga0137443_1037432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1294 | Open in IMG/M |
| 3300011433|Ga0137443_1156339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 676 | Open in IMG/M |
| 3300011444|Ga0137463_1194229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 761 | Open in IMG/M |
| 3300012040|Ga0137461_1009084 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300012360|Ga0137375_10202594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1876 | Open in IMG/M |
| 3300012922|Ga0137394_11579079 | Not Available | 513 | Open in IMG/M |
| 3300012976|Ga0134076_10560799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300013503|Ga0120127_10159214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 544 | Open in IMG/M |
| 3300014884|Ga0180104_1237738 | Not Available | 543 | Open in IMG/M |
| 3300015248|Ga0180079_1059145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 576 | Open in IMG/M |
| 3300018056|Ga0184623_10274453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 766 | Open in IMG/M |
| 3300018063|Ga0184637_10110672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1692 | Open in IMG/M |
| 3300018075|Ga0184632_10359447 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
| 3300018079|Ga0184627_10029110 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
| 3300018084|Ga0184629_10014449 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
| 3300018422|Ga0190265_11167983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 889 | Open in IMG/M |
| 3300018469|Ga0190270_10772018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 964 | Open in IMG/M |
| 3300018476|Ga0190274_11627144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 739 | Open in IMG/M |
| 3300019458|Ga0187892_10004454 | All Organisms → cellular organisms → Bacteria | 23474 | Open in IMG/M |
| 3300019458|Ga0187892_10517216 | Not Available | 547 | Open in IMG/M |
| 3300019458|Ga0187892_10525709 | Not Available | 540 | Open in IMG/M |
| 3300020057|Ga0163151_10012300 | All Organisms → cellular organisms → Bacteria | 8571 | Open in IMG/M |
| 3300025146|Ga0209322_10053843 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300025160|Ga0209109_10013980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4319 | Open in IMG/M |
| 3300025910|Ga0207684_10096453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2524 | Open in IMG/M |
| 3300025922|Ga0207646_10161403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2023 | Open in IMG/M |
| 3300025922|Ga0207646_10183372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1890 | Open in IMG/M |
| 3300025922|Ga0207646_10218443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1722 | Open in IMG/M |
| 3300025922|Ga0207646_10884196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 793 | Open in IMG/M |
| 3300026016|Ga0208779_1001911 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300026116|Ga0207674_11462414 | Not Available | 653 | Open in IMG/M |
| 3300026725|Ga0207474_100371 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300026763|Ga0207568_101557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 756 | Open in IMG/M |
| 3300027682|Ga0209971_1064427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 888 | Open in IMG/M |
| 3300027691|Ga0209485_1033593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1248 | Open in IMG/M |
| 3300027880|Ga0209481_10013898 | All Organisms → cellular organisms → Bacteria | 3498 | Open in IMG/M |
| 3300027964|Ga0256864_1101922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300028380|Ga0268265_10110763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2241 | Open in IMG/M |
| 3300028381|Ga0268264_10453675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1243 | Open in IMG/M |
| 3300030606|Ga0299906_10000160 | All Organisms → cellular organisms → Bacteria | 67636 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1000528 | All Organisms → cellular organisms → Bacteria | 6064 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1143372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300031455|Ga0307505_10016588 | All Organisms → cellular organisms → Bacteria | 3489 | Open in IMG/M |
| 3300031548|Ga0307408_100106525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2145 | Open in IMG/M |
| 3300031716|Ga0310813_10044576 | All Organisms → cellular organisms → Bacteria | 3233 | Open in IMG/M |
| 3300031716|Ga0310813_10084732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2428 | Open in IMG/M |
| 3300031716|Ga0310813_10342812 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300031965|Ga0326597_10214807 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300032017|Ga0310899_10576266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300032163|Ga0315281_10985223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 856 | Open in IMG/M |
| 3300032205|Ga0307472_101054503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 766 | Open in IMG/M |
| 3300033407|Ga0214472_10328634 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300033433|Ga0326726_10020727 | All Organisms → cellular organisms → Bacteria | 5715 | Open in IMG/M |
| 3300033811|Ga0364924_040791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 972 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.01% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.01% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 8.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.60% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.80% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.80% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.80% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.90% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.90% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026016 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026725 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026763 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0866.00007300 | 2162886013 | Switchgrass Rhizosphere | MSTFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR |
| JGI11643J11755_108214912 | 3300000787 | Soil | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLXXKR* |
| C687J26631_100658042 | 3300002124 | Soil | MRVFGIVFATLGAGMVLFALFYLNALLFALVNSMVLLMAGPLVDRFLARKR* |
| C687J29039_102677702 | 3300002243 | Soil | MRVFGVVFAMLGAGMVLFALVYLNALLFGLVTSMVALMAGPLVDRFLARKR* |
| soilL2_100845936 | 3300003319 | Sugarcane Root And Bulk Soil | MRTFGIVFASLGAGMVLFALLFLNGLLFGLVNSMVALMSGPVIDKFLARRKR* |
| Ga0055439_100230622 | 3300004019 | Natural And Restored Wetlands | MKIFGIVFASLGAGMVLFALVYLNGLLFGLVNSMVTLMAGPLVDRILARRKQ* |
| Ga0062593_1000115032 | 3300004114 | Soil | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLMDRLLAKKQR* |
| Ga0062593_1001713842 | 3300004114 | Soil | MRIFGIVFATLGAGMILFALTFVTLMVGGLVNGMVVLMAGPLVDRLLAKKR* |
| Ga0062593_1002057083 | 3300004114 | Soil | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMDVLISGPVVDKLLEKKR* |
| Ga0063356_1004094642 | 3300004463 | Arabidopsis Thaliana Rhizosphere | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLKEKR* |
| Ga0063356_1007223073 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLMDRLLAKKQR* |
| Ga0063356_1009057501 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MELFGRIFAALGAGMILFALTYVTLLVGALVHGMVALISGPVIDRIVEKKR* |
| Ga0062592_1000060825 | 3300004480 | Soil | METFGRIFAALGAGMILFALTYVTLLVGALVNGMVVLMAGPVIDKMAARKR* |
| Ga0062592_1016977881 | 3300004480 | Soil | MSTFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR* |
| Ga0062591_1015247021 | 3300004643 | Soil | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLEKKR* |
| Ga0062591_1020830341 | 3300004643 | Soil | METFVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLVARKR* |
| Ga0065707_108803872 | 3300005295 | Switchgrass Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRLLSKQSKPGRPA* |
| Ga0070667_1009031502 | 3300005367 | Switchgrass Rhizosphere | METIVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLLAKKR* |
| Ga0070701_103394692 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTFAIIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR* |
| Ga0070694_1002881362 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLDKKR* |
| Ga0070708_1000868843 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | METFVVVFAALGAGMILFALTYVTLLVGGIVNAMVVLISGPVVDRLVAKRR* |
| Ga0070706_1006160672 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAFWILFAILGAAMVLFALTYVTLLIGGLVNAMVVLISGPLVDRLLAKKR* |
| Ga0070706_1013435092 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRLLSKRSKPGRPA* |
| Ga0070706_1016246691 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVFGVVFATLGAGMILFALTYVTLVVGGLVNAMVVLMAGPLVDRLLARKR* |
| Ga0070707_1001942302 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRMLARKNRQ* |
| Ga0070707_1002802373 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIFARVFAALGAGMILFALTFVTLLIGALVNSMVVLMAGPLIDRFLTPKR* |
| Ga0070698_1000588743 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRLLAKKPKPGRPA* |
| Ga0070698_1015749382 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFAILGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRMLARKNRQ |
| Ga0070699_10000014050 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | METFGVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPLVDKLVDRKR* |
| Ga0070699_1019014142 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRLLAKQSKPGRPA* |
| Ga0070699_1021584471 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVFGVVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRMLARKNRQ* |
| Ga0066697_101412132 | 3300005540 | Soil | MEIFARVFAGLGAGMILFALTFVTLLIGGLVNSMVVLISGPLVDRLLAKKR* |
| Ga0070696_1017699751 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLMDRLLAKKQR* |
| Ga0068859_1002803033 | 3300005617 | Switchgrass Rhizosphere | MSTFAIIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLVARKR* |
| Ga0074470_107670593 | 3300005836 | Sediment (Intertidal) | FATLGAGMILFALTYVTLLVGGLVNAMVVLMAGPLMDRLLARKN* |
| Ga0075428_1001259412 | 3300006844 | Populus Rhizosphere | METFGRIFAALGAGMILFALTYVTLLVGALVNGMVVLMAGPVIDKLAARKR* |
| Ga0075421_1005445972 | 3300006845 | Populus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNAMVVLMAGPLVDRLLARKR* |
| Ga0075425_1000315566 | 3300006854 | Populus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVVLISGPLVDRLLARKR* |
| Ga0075425_1000367233 | 3300006854 | Populus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLISGPLVDRLLSKKSPPRGA* |
| Ga0075425_1014458861 | 3300006854 | Populus Rhizosphere | MRIFGIVFAIAGAGMILFALTYVTLAVGGLVNAMVVLMSGPLIDKFLARKKR* |
| Ga0075434_1002227693 | 3300006871 | Populus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVALISGPLVDRLLARKR* |
| Ga0075436_1006616321 | 3300006914 | Populus Rhizosphere | CLTKAGAMRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVVLISGPLVDRLLARKR* |
| Ga0066710_1002106213 | 3300009012 | Grasslands Soil | MEIFARVFAGLGAGMILFALTFVTLLIGGLVNSMVVLISGPLVDRLLAKKR |
| Ga0079224_1042919811 | 3300009095 | Agricultural Soil | MLNLFGMVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPLIDRFVKEQPAG* |
| Ga0114129_100197443 | 3300009147 | Populus Rhizosphere | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLGKKR* |
| Ga0075423_110035782 | 3300009162 | Populus Rhizosphere | MRIFGIVFAIAGAGMILFALTYVTLAVGGLVNAMVVLMSGPLIDKFLAR |
| Ga0116144_100825613 | 3300009687 | Anaerobic Digestor Sludge | MWNSIGIVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPVIDRFVKE* |
| Ga0131077_1000444625 | 3300009873 | Wastewater | MWSTIGIVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPVIDRFVKE* |
| Ga0131077_1000789710 | 3300009873 | Wastewater | MLNTIGTIFAALGAGMILFALTYVTLLVGAIVHAMAILMAGPLIDRFVKE* |
| Ga0116237_101536001 | 3300010356 | Anaerobic Digestor Sludge | MWNTIGIVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPVVDRFVKE* |
| Ga0116237_116723322 | 3300010356 | Anaerobic Digestor Sludge | MWNSIGIVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPVVD |
| Ga0136847_1184211812 | 3300010391 | Freshwater Sediment | MELFGRIFATLGAGMILFALIFVTLLVGALVNAMVVLMSGPLIDRIAARKR* |
| Ga0136847_133678922 | 3300010391 | Freshwater Sediment | METFGVIFAALGAGMILFALVFVTLLVGGLVNGMVVLISGPVVDKLLDKKR* |
| Ga0134127_112760122 | 3300010399 | Terrestrial Soil | METFVRIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR* |
| Ga0137446_10046754 | 3300011419 | Soil | MELFGVIFATLGAGMILFALIYVTLLVGALVNGMVVLMSGPLIDKLVDRKR* |
| Ga0137456_11203811 | 3300011428 | Soil | METFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKL |
| Ga0137443_10374322 | 3300011433 | Soil | MSAFGVIFATLGAGMILFALTYVTLLVGAIVNAMVVLMSGPLIDRLVARKR* |
| Ga0137443_11563392 | 3300011433 | Soil | METFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR* |
| Ga0137463_11942292 | 3300011444 | Soil | METFVVVFAALGAGMILFALTYVTLLVGGIVNAMVVLISGPVVDKLVARRR* |
| Ga0137461_10090844 | 3300012040 | Soil | MALLGVIFATLGAGMILFALTYVTLLVGAIVNAMVVLMSGPLIDRLAARKR* |
| Ga0137375_102025943 | 3300012360 | Vadose Zone Soil | MVIFARVFAGLGAGMILFALTYVTLLIGGLVNAMVVLMSGPLVDRLFARKR* |
| Ga0137394_115790791 | 3300012922 | Vadose Zone Soil | MLAIFGVVFATLGAALILFALTFVSLLIGAIITAMIVLISGQLIDG |
| Ga0134076_105607992 | 3300012976 | Grasslands Soil | MEIFARVFAGLGAGMILFALTFVTLLIGVLVNCMVALISGPLVDRLLAKKR* |
| Ga0120127_101592142 | 3300013503 | Permafrost | METIVRIFAALGAGMILFALTYVTLLVGEIVNAMVVLISGPVVDKLVARKR* |
| Ga0180104_12377382 | 3300014884 | Soil | METFAVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLKEKR* |
| Ga0180079_10591451 | 3300015248 | Soil | METFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR |
| Ga0180089_11123391 | 3300015254 | Soil | METFAVIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGP |
| Ga0184623_102744532 | 3300018056 | Groundwater Sediment | METFGAIFAALGAGMILFALVFVTLLVGGLVNGMVVLISGPVVDKLLAKRR |
| Ga0184637_101106722 | 3300018063 | Groundwater Sediment | METFGVVFAALGAGMILFALVFVTLLVGGLVNGMVVLIAGPVVDKLLDKKR |
| Ga0184632_103594472 | 3300018075 | Groundwater Sediment | METFGAIFAALGAGMILFALVFVTLLVGGLVNGMVVLISGPVVDKLLDKKR |
| Ga0184627_100291103 | 3300018079 | Groundwater Sediment | METFGVIFAALGAGMILFALVFVTLLVGGLVNGMVVLIAGPVVDKLLDKKR |
| Ga0184629_100144493 | 3300018084 | Groundwater Sediment | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLDKKR |
| Ga0190265_111679832 | 3300018422 | Soil | METIVVLFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVLDRFLDKKR |
| Ga0190270_107720183 | 3300018469 | Soil | METFGVIFAALGAGMILFALVFVSLLVGGLVNGMVVLISGPVVDKLLKEKR |
| Ga0190274_116271441 | 3300018476 | Soil | VIFAALGAGMILFALTYVTLLVGALVNGMVVLMSGPLIDKIADRKKR |
| Ga0187892_100044545 | 3300019458 | Bio-Ooze | VKVFGVVFATLGAGMVLFALVYLNALLFGLVNSMVVLMAGPLVDKFLARKR |
| Ga0187892_105172161 | 3300019458 | Bio-Ooze | TLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDKLMARREARRARR |
| Ga0187892_105257092 | 3300019458 | Bio-Ooze | MRIFGIVFAALGAGMVLFALLYLNALLFGLVNSMVALMAGPLVDRFLARKR |
| Ga0163151_100123003 | 3300020057 | Freshwater Microbial Mat | MWNTIGIVFAALGAGMILFALTYVTLLVGAIVNAMVVLMAGPIIDRFVKE |
| Ga0209322_100538432 | 3300025146 | Soil | MRVFGVVFAMLGAGMVLFALVYLNALLFGLVTSMVALMAGPLVDRFLARKR |
| Ga0209109_100139802 | 3300025160 | Soil | MRVFGIVFATLGAGMVLFALFYLNALLFALVNSMVLLMAGPLVDRFLARKR |
| Ga0207684_100964532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAFWILFAILGAAMVLFALTYVTLLIGGLVNAMVVLISGPLVDRLLAKKR |
| Ga0207646_101614033 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRMLARKNRQ |
| Ga0207646_101833723 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTFAIIFAALGAGMILFALTYVTLLVGAIVNGMVVLISGPVIDKLVARKR |
| Ga0207646_102184433 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNAMVVLISGPLVDRLLARKR |
| Ga0207646_108841962 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIFARVFAALGAGMILFALTFVTLLIGALVNSMVVLMAGPLIDRFLTPKR |
| Ga0208779_10019112 | 3300026016 | Natural And Restored Wetlands | MKIFGIVFASLGAGMVLFALVYLNGLLFGLVNSMVTLMAGPLVDRILARRKQ |
| Ga0207674_114624142 | 3300026116 | Corn Rhizosphere | MRIFGIVFATLGAGMILFALTFVTLMVGGLVNGMVVLMAGPLVDRLLAKKR |
| Ga0207474_1003713 | 3300026725 | Soil | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLMDRLLAKKQR |
| Ga0207568_1015572 | 3300026763 | Soil | METFGRIFAALGAGMILFALTYVTLLVGALVNGMVVLMAGPVI |
| Ga0209971_10644271 | 3300027682 | Arabidopsis Thaliana Rhizosphere | LFGVVFATLGAGMILFALTFVTLLVGALVNGMVVLMSGPLIDKLVARKR |
| Ga0209485_10335931 | 3300027691 | Agricultural Soil | VVFATLGAGMILFALTFVTLLVGALVNGMVVLMSGPLIDKLVARKR |
| Ga0209481_100138983 | 3300027880 | Populus Rhizosphere | METFGRIFAALGAGMILFALTYVTLLVGALVNGMVVLMAGPVIDKLAARKR |
| Ga0256864_11019222 | 3300027964 | Soil | MLQTVTVLFAGLGATMIIFALAFVTLLVGALVNAMVVLIAGPILDRFVKEPASPSAG |
| Ga0268265_101107632 | 3300028380 | Switchgrass Rhizosphere | METFVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLVARKR |
| Ga0268264_104536753 | 3300028381 | Switchgrass Rhizosphere | METIVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLLAKKR |
| Ga0299906_1000016030 | 3300030606 | Soil | MLQTVTVLFAGLGATMIIFALAFVTLLVGALVNAMVVLIAGPILDRFVKEPAPPSAG |
| (restricted) Ga0255311_10005288 | 3300031150 | Sandy Soil | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLMAGPLVDRLLAKKQRPGRAA |
| (restricted) Ga0255311_11433722 | 3300031150 | Sandy Soil | VELFGRIFASLGAGMILFALVFVTLLVGALVNAMVALMSGPLIDRLVTRKR |
| Ga0307505_100165884 | 3300031455 | Soil | MLNLIGTVLAVLGAGMILFALTYVTLLVGALVNAMVVLMAGPVIDRFVKD |
| Ga0307408_1001065254 | 3300031548 | Rhizosphere | MELFGVVFATLGAGMILFALTFVTHLVGALVNGLVVLMSGPLIDKLVAR |
| Ga0310813_100445764 | 3300031716 | Soil | MRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVALISGPLVDRLLARKR |
| Ga0310813_100847323 | 3300031716 | Soil | MRIFGIVFATLGAGMILFALTYVTLVVGGLVNGMVVLISGPLVDRLLSKKSRPRGA |
| Ga0310813_103428121 | 3300031716 | Soil | MRIFGIVFATLGAGMILFALTYVTLLVGGLVNAMVALISGPLV |
| Ga0326597_102148072 | 3300031965 | Soil | MRIFGIIFATLGAGMILFALTYVTLVVGGLVNGMVALMAGPLIDKLIAKRARK |
| Ga0310899_105762662 | 3300032017 | Soil | IPEGTMETFVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDKLVARKR |
| Ga0315281_109852232 | 3300032163 | Sediment | MQLFGIVFAILGAGMILFALTYVTLVVGGLVNGMVVLMAGPLIDKFLAKRSQRAPRR |
| Ga0307472_1010545032 | 3300032205 | Hardwood Forest Soil | MQAFWILLAILGAAMILFALTYVTLLIGGLVNAMVVLISGPLVDRLLARKR |
| Ga0214472_103286341 | 3300033407 | Soil | RGGAMRVFGVVFAMLGAGMVIFALLYLNALLFGLVNSMVVLMAGPLVDRFLARKR |
| Ga0326726_100207274 | 3300033433 | Peat Soil | METIVRIFAALGAGMILFALTYVTLLVGGIVNGMVVLISGPLVDRLVARKR |
| Ga0364924_040791_232_387 | 3300033811 | Sediment | MELFGIIFATLGAGMILFALTFVTLLVGALVNAMVVLMAGPLIDRIAARKR |
| ⦗Top⦘ |