Basic Information | |
---|---|
Family ID | F085262 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 111 |
Average Sequence Length | 47 residues |
Representative Sequence | MSNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.88 % |
% of genes near scaffold ends (potentially truncated) | 16.22 % |
% of genes from short scaffolds (< 2000 bps) | 72.97 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.450 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.820 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.351 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.865 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 14.41 |
PF09360 | zf-CDGSH | 0.90 |
PF00534 | Glycos_transf_1 | 0.90 |
PF13640 | 2OG-FeII_Oxy_3 | 0.90 |
PF04820 | Trp_halogenase | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.45 % |
All Organisms | root | All Organisms | 49.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002161|JGI24766J26685_10002192 | Not Available | 5798 | Open in IMG/M |
3300002161|JGI24766J26685_10004583 | All Organisms → Viruses → Predicted Viral | 3965 | Open in IMG/M |
3300002408|B570J29032_109527352 | Not Available | 839 | Open in IMG/M |
3300002408|B570J29032_109751438 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
3300002835|B570J40625_100046345 | Not Available | 6310 | Open in IMG/M |
3300002835|B570J40625_100213272 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
3300003413|JGI25922J50271_10126678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300003430|JGI25921J50272_10019965 | All Organisms → Viruses → Predicted Viral | 1820 | Open in IMG/M |
3300003430|JGI25921J50272_10113449 | Not Available | 571 | Open in IMG/M |
3300003497|JGI25925J51416_10068876 | Not Available | 894 | Open in IMG/M |
3300003650|SLW30_104939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2666 | Open in IMG/M |
3300003653|SLW02_100744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3154 | Open in IMG/M |
3300004096|Ga0066177_10109016 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
3300004096|Ga0066177_10528167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300004112|Ga0065166_10053698 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
3300005517|Ga0070374_10152316 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300005517|Ga0070374_10252879 | Not Available | 900 | Open in IMG/M |
3300005517|Ga0070374_10465168 | Not Available | 633 | Open in IMG/M |
3300005527|Ga0068876_10548210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300005528|Ga0068872_10210818 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
3300005662|Ga0078894_10220799 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
3300005662|Ga0078894_10236781 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
3300005662|Ga0078894_11118100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300005662|Ga0078894_11210603 | Not Available | 639 | Open in IMG/M |
3300005662|Ga0078894_11434417 | Not Available | 575 | Open in IMG/M |
3300006875|Ga0075473_10131223 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
3300007363|Ga0075458_10150900 | Not Available | 719 | Open in IMG/M |
3300007516|Ga0105050_10242402 | Not Available | 1115 | Open in IMG/M |
3300007559|Ga0102828_1075066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300007708|Ga0102859_1035891 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
3300008055|Ga0108970_10348568 | All Organisms → Viruses → Predicted Viral | 2532 | Open in IMG/M |
3300008107|Ga0114340_1000593 | Not Available | 42788 | Open in IMG/M |
3300008107|Ga0114340_1052952 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
3300008107|Ga0114340_1063354 | All Organisms → Viruses → Predicted Viral | 2410 | Open in IMG/M |
3300008107|Ga0114340_1135804 | Not Available | 928 | Open in IMG/M |
3300008110|Ga0114343_1166704 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
3300008113|Ga0114346_1003437 | Not Available | 15900 | Open in IMG/M |
3300008113|Ga0114346_1007389 | Not Available | 6521 | Open in IMG/M |
3300008114|Ga0114347_1003283 | Not Available | 9673 | Open in IMG/M |
3300008116|Ga0114350_1007630 | Not Available | 8237 | Open in IMG/M |
3300008116|Ga0114350_1040732 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
3300008116|Ga0114350_1074678 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300008262|Ga0114337_1023661 | Not Available | 5699 | Open in IMG/M |
3300008962|Ga0104242_1024824 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
3300008996|Ga0102831_1058761 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
3300009059|Ga0102830_1065032 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
3300009059|Ga0102830_1230229 | Not Available | 542 | Open in IMG/M |
3300009082|Ga0105099_10208943 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
3300009164|Ga0114975_10061126 | All Organisms → Viruses → Predicted Viral | 2207 | Open in IMG/M |
3300009180|Ga0114979_10485496 | Not Available | 715 | Open in IMG/M |
3300009194|Ga0114983_1067477 | Not Available | 818 | Open in IMG/M |
3300010388|Ga0136551_1065492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300010965|Ga0138308_197029 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
3300011268|Ga0151620_1014079 | Not Available | 2827 | Open in IMG/M |
3300012663|Ga0157203_1052419 | Not Available | 552 | Open in IMG/M |
3300012665|Ga0157210_1009600 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
3300013004|Ga0164293_10863130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300013005|Ga0164292_10774443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300013005|Ga0164292_10895560 | Not Available | 557 | Open in IMG/M |
3300019784|Ga0181359_1006895 | All Organisms → Viruses → Predicted Viral | 3829 | Open in IMG/M |
3300020141|Ga0211732_1201841 | All Organisms → Viruses → Predicted Viral | 2679 | Open in IMG/M |
3300020141|Ga0211732_1276589 | Not Available | 973 | Open in IMG/M |
3300020141|Ga0211732_1371119 | Not Available | 9683 | Open in IMG/M |
3300020151|Ga0211736_10086948 | Not Available | 564 | Open in IMG/M |
3300020151|Ga0211736_10785365 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
3300020159|Ga0211734_10337103 | Not Available | 3753 | Open in IMG/M |
3300020162|Ga0211735_11180347 | Not Available | 883 | Open in IMG/M |
3300020541|Ga0208359_1000608 | Not Available | 6519 | Open in IMG/M |
3300020549|Ga0207942_1033229 | Not Available | 645 | Open in IMG/M |
3300020562|Ga0208597_1060457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300020572|Ga0207909_1007342 | All Organisms → Viruses → Predicted Viral | 2323 | Open in IMG/M |
3300021140|Ga0214168_1026913 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300021519|Ga0194048_10077093 | Not Available | 1304 | Open in IMG/M |
3300021519|Ga0194048_10133461 | Not Available | 940 | Open in IMG/M |
3300021961|Ga0222714_10009473 | Not Available | 8552 | Open in IMG/M |
3300021961|Ga0222714_10227840 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300021963|Ga0222712_10396451 | Not Available | 840 | Open in IMG/M |
3300023174|Ga0214921_10007473 | Not Available | 14563 | Open in IMG/M |
3300023174|Ga0214921_10011400 | Not Available | 10810 | Open in IMG/M |
3300023184|Ga0214919_10175712 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
3300024343|Ga0244777_10880838 | Not Available | 524 | Open in IMG/M |
3300024346|Ga0244775_10014706 | Not Available | 7289 | Open in IMG/M |
3300024346|Ga0244775_10611103 | Not Available | 884 | Open in IMG/M |
3300024346|Ga0244775_11389334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027193|Ga0208800_1039269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300027278|Ga0208439_1056372 | Not Available | 748 | Open in IMG/M |
3300027365|Ga0209300_1019939 | Not Available | 1510 | Open in IMG/M |
3300027734|Ga0209087_1185674 | Not Available | 808 | Open in IMG/M |
3300027764|Ga0209134_10019962 | All Organisms → Viruses → Predicted Viral | 2113 | Open in IMG/M |
3300027769|Ga0209770_10143792 | Not Available | 964 | Open in IMG/M |
3300027769|Ga0209770_10387119 | Not Available | 519 | Open in IMG/M |
3300027792|Ga0209287_10226448 | Not Available | 714 | Open in IMG/M |
3300027805|Ga0209229_10001843 | Not Available | 8714 | Open in IMG/M |
3300027836|Ga0209230_10006559 | Not Available | 5059 | Open in IMG/M |
3300027892|Ga0209550_10415175 | Not Available | 829 | Open in IMG/M |
3300031758|Ga0315907_10215054 | Not Available | 1606 | Open in IMG/M |
3300031758|Ga0315907_10393772 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
3300031758|Ga0315907_10502186 | Not Available | 959 | Open in IMG/M |
3300031787|Ga0315900_11016686 | Not Available | 543 | Open in IMG/M |
3300031857|Ga0315909_10590495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300031963|Ga0315901_10400831 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300032093|Ga0315902_11273339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300033992|Ga0334992_0317336 | Not Available | 724 | Open in IMG/M |
3300034020|Ga0335002_0225013 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
3300034020|Ga0335002_0503890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300034093|Ga0335012_0183432 | Not Available | 1119 | Open in IMG/M |
3300034093|Ga0335012_0409286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300034102|Ga0335029_0091986 | All Organisms → Viruses → Predicted Viral | 2153 | Open in IMG/M |
3300034106|Ga0335036_0869821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300034121|Ga0335058_0694841 | Not Available | 561 | Open in IMG/M |
3300034279|Ga0335052_0178611 | Not Available | 1235 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.51% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.21% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.31% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.31% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.60% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.70% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.70% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.80% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.80% |
Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 1.80% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.80% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.90% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.90% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
3300003653 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24766J26685_1000219211 | 3300002161 | Freshwater And Sediment | MSNFYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
JGI24766J26685_1000458318 | 3300002161 | Freshwater And Sediment | MNNLYSILSERHPDGDFNEMDLWEAIAXSEGLELNEIMDGDLTEYL* |
B570J29032_1095273522 | 3300002408 | Freshwater | MSNLYSILAEMYPGGDFNETDLWEAIAEAEGVDVNEIMDGDLTEYL* |
B570J29032_1097514385 | 3300002408 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL* |
B570J40625_1000463454 | 3300002835 | Freshwater | MDNLYSILSEWYPDGNYSEQELWDAIAESQGVDVYSIMDGDLTEYL* |
B570J40625_1002132727 | 3300002835 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
JGI25922J50271_101266781 | 3300003413 | Freshwater Lake | WTTMSNLYSILSEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL* |
JGI25921J50272_100199654 | 3300003430 | Freshwater Lake | MDNLYSILSERHPEGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
JGI25921J50272_101134491 | 3300003430 | Freshwater Lake | MSNLYSILSEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL* |
JGI25925J51416_100688763 | 3300003497 | Freshwater Lake | MSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTDYL* |
SLW30_1049396 | 3300003650 | Subglacial Freshwater | MNRSLEAVLSDWYPEGDFTEEELWDAIAESEGVDLNEIMDGNLEDYL* |
SLW02_1007448 | 3300003653 | Subglacial Freshwater | MNSLNTILADWYPDGNFTEDELWYAIAESEGVDPCEIMDGDITDYL* |
Ga0066177_101090161 | 3300004096 | Freshwater Lake | MNSLYSILAEWYPDGNYSEEELWDAIAESQGVDVYSIMDGDLTDYL*FLSHQ* |
Ga0066177_105281671 | 3300004096 | Freshwater Lake | TRGGLLMNNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0065166_100536983 | 3300004112 | Freshwater Lake | MDNLYSILAEWYPDGNYSEQELWDAIAESEGVDVYSIMDGDLTEYL* |
Ga0070374_101523162 | 3300005517 | Freshwater Lake | MNSLYSILAEWYPDGNYSEEELWDAIAESQGVDVYSIMDGDLTDYL* |
Ga0070374_102528793 | 3300005517 | Freshwater Lake | MSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTEYL* |
Ga0070374_104651682 | 3300005517 | Freshwater Lake | MSNLYSILAESHPDGDFTESDLWDAIAESEGVDVYSIMDGDLTDYL* |
Ga0068876_105482103 | 3300005527 | Freshwater Lake | MSNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0068872_102108183 | 3300005528 | Freshwater Lake | MDNLYSILAELHPNGDFTESDLWEAIAESHGVDVNEIMDQDLTEYL* |
Ga0078894_102207993 | 3300005662 | Freshwater Lake | MENLYSILSERHPDGDFSEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0078894_102367816 | 3300005662 | Freshwater Lake | MNNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0078894_111181001 | 3300005662 | Freshwater Lake | MENLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTDYL* |
Ga0078894_112106032 | 3300005662 | Freshwater Lake | MNNLYSILSERHPDGNFGEMDLWEAIADSEGLELYEIMDGDLTEYL* |
Ga0078894_114344172 | 3300005662 | Freshwater Lake | MSNLYSILQEMHPGGDFNEFELWEAIAEAEGVDVYDIMDGDLTEYL* |
Ga0075473_101312231 | 3300006875 | Aqueous | GYHRRTTMSNVYEILAEWHPEGDFTESDLWDAIAESEGVDVSEIMDGDLTDYL* |
Ga0075458_101509001 | 3300007363 | Aqueous | MLGYHRWTTMSNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0105050_102424024 | 3300007516 | Freshwater | MKMNRSLTTILSDWYPEGDFTEEELWDAIAESEGVDLNEIMDGNL |
Ga0102828_10750662 | 3300007559 | Estuarine | MSNLYSILAEWHPDGDFNESDLWDAIAESEGVDVSSIMDGDLTDYL* |
Ga0102859_10358912 | 3300007708 | Estuarine | MSNLYSILSEWYPDGNYSEQELWDAVAESQGVDVYSIMDGDLTDYL* |
Ga0108970_103485683 | 3300008055 | Estuary | MNNLYSILSERHPDGDFGEMDLWEAIADSEGLELYEIMDGDLTEYL* |
Ga0114340_100059323 | 3300008107 | Freshwater, Plankton | MDNLYSILAERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0114340_10529523 | 3300008107 | Freshwater, Plankton | MDNLYSILSERHPDGDFSEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0114340_10633545 | 3300008107 | Freshwater, Plankton | MNNLYSILSERHPEGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL* |
Ga0114340_11358043 | 3300008107 | Freshwater, Plankton | MSNLYSILAEWYPDGNYSEQELWDAVAESQGVDVYSIMDGDLTDYL* |
Ga0114343_11667044 | 3300008110 | Freshwater, Plankton | MENLYSILSERHPDGDFGEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0114346_100343717 | 3300008113 | Freshwater, Plankton | MSNLYSILSEMHPDGNFNEMDLWDAIAEAEGVDVNEIMDGDLTEYL* |
Ga0114346_100738912 | 3300008113 | Freshwater, Plankton | MSNLYSILQEMHPSGDFTEADLWEAIAESEGVDVYEIMDGDLTEYL* |
Ga0114347_100328321 | 3300008114 | Freshwater, Plankton | MNNLYSILSERYPEGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL* |
Ga0114350_10076306 | 3300008116 | Freshwater, Plankton | MDNLYSILSEWYPEGEFSESELWDAIAESEGVEVSEIMDGDLIEYL* |
Ga0114350_10407326 | 3300008116 | Freshwater, Plankton | MSNLYSILSEWHPDGDFTEEDLWEAIAESEGVDMNSIMD |
Ga0114350_10746784 | 3300008116 | Freshwater, Plankton | MSDLYSILATWYPDGNYTEAELWDAIAEIEGVSVSEIMDGDLTEYL* |
Ga0114337_10236611 | 3300008262 | Freshwater, Plankton | MENLYSILSERHPDGDFSEMDLWDAIADSEGLELNEIMDGDLTEYL* |
Ga0104242_10248243 | 3300008962 | Freshwater | MDNLYSILSTWYPEGDYTEAELWDAIAESEGLDVSEIMDGDLTEYL* |
Ga0102831_10587614 | 3300008996 | Estuarine | MLGYHRRTTMNNLYSILAEMHPNGDFNEADLWDAIAESEGVDVYEIMDGDLTEYL* |
Ga0102830_10650321 | 3300009059 | Estuarine | MSNLYSILSQWYPDGNYSEQELWDAIAEVEGVDVYSIMDGDLTEYL* |
Ga0102830_12302292 | 3300009059 | Estuarine | MSNLYSILQEMHPKGDFNEFELWEAIAESEGVDVYEIMDGDLTEYL* |
Ga0105099_102089432 | 3300009082 | Freshwater Sediment | MDNLYSILSTWYPEGDYTEAELWDAIAESEGVDVYEIMDGDLTDYL* |
Ga0114975_100611263 | 3300009164 | Freshwater Lake | MDDLYSILSEWYPDGNYSEQELWDAIAESQGVDVYSIMDGDLTEYL* |
Ga0114979_104854962 | 3300009180 | Freshwater Lake | MSNLYSILAEWYPDGNYSESELWDAVAESEGVDVHSIMDGDLTDYL* |
Ga0114983_10674772 | 3300009194 | Deep Subsurface | MNNLYSILSDWYPDGNYTEAELWDAIAELEGVSVSEIMDGDLTEYL* |
Ga0136551_10654921 | 3300010388 | Pond Fresh Water | QNGGMMSDLYSTLAEWYPDGNYTEADLWEAIAEVHGVDVNEIMDGDLVEYL* |
Ga0138308_1970292 | 3300010965 | Lake Chemocline | MNSLYSILAEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL* |
Ga0151620_10140792 | 3300011268 | Freshwater | MNNLYSILAELHPAGDFTEADLWEAIAESQGVDVNEIMDQDLTEYL* |
Ga0157203_10524192 | 3300012663 | Freshwater | MSNLYSILAEWYPDGNYSEAELWDAVAESEGLDVYSIMDGDLTDYL* |
Ga0157210_10096001 | 3300012665 | Freshwater | MSNLYSILQEMHPEGDFNESDLWEAIAEAEGVDVNEIMDGDLTEYL* |
Ga0164293_108631301 | 3300013004 | Freshwater | MENLYSILSERHPDGDFSEMDLWEAIADSEGLELNEIMDGDLTDYL* |
Ga0164292_107744431 | 3300013005 | Freshwater | LYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL* |
Ga0164292_108955602 | 3300013005 | Freshwater | MDNLYSILSERHPEGDFNEMDLWEAIADSEGLELYEIMDGDLTDYL* |
Ga0181359_10068957 | 3300019784 | Freshwater Lake | MSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTDYL |
Ga0211732_120184110 | 3300020141 | Freshwater | MSNLYSILAEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL |
Ga0211732_12765892 | 3300020141 | Freshwater | MSNLYSILAEWYPDGNYSEQELWDAVAESQGVDVYSIMDGDLTDYL |
Ga0211732_13711193 | 3300020141 | Freshwater | MSNLYSILSERHPEGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0211736_100869483 | 3300020151 | Freshwater | LSERHPEGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0211736_107853655 | 3300020151 | Freshwater | MSNLYSILSTWYPDGDYTEAELWDAIAEVEGVSVSEIMDGDLTEYL |
Ga0211734_103371035 | 3300020159 | Freshwater | MSNLYSILSEWYPDGNYSEAELWDAIAESQGVDVYSIMDGDLTEYL |
Ga0211735_111803471 | 3300020162 | Freshwater | KMSNLYSILAEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL |
Ga0208359_100060815 | 3300020541 | Freshwater | MDNLYSILSEWYPDGNYSEQELWDAIAESQGVDVYSIMDGDLTEYL |
Ga0207942_10332291 | 3300020549 | Freshwater | RRNTMSNLYSILAEMYPGGDFNETDLWEAIAEAEGVDVNEIMDGDLTEYL |
Ga0208597_10604573 | 3300020562 | Freshwater | MSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTEYL |
Ga0207909_10073423 | 3300020572 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0214168_10269133 | 3300021140 | Freshwater | MSNLYSILSTWYPEGDFNEAELWDAIAENEGVDVNEIMDGDLTDYL |
Ga0194048_100770931 | 3300021519 | Anoxic Zone Freshwater | MSNLYSILAEWYPDGNYSEQELWDAIAESQGVDVYSIMDGDLTEYL |
Ga0194048_101334613 | 3300021519 | Anoxic Zone Freshwater | YSILADWYPDGNYSEQELWDAIAESQGVDVYSIMDGDLTEYL |
Ga0222714_100094737 | 3300021961 | Estuarine Water | MSNLYTILAEMHPSGDFTESDLWEAIAESEGVDVYEIIDGDLTEYL |
Ga0222714_102278403 | 3300021961 | Estuarine Water | MNNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0222712_103964513 | 3300021963 | Estuarine Water | MNSLYSILAEWYPDGNYSEEELWDAIAESQGVDVYSIMDGDLTDYL |
Ga0214921_1000747313 | 3300023174 | Freshwater | MMSNLYSILSEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTEYL |
Ga0214921_1001140022 | 3300023174 | Freshwater | MDNLYSILSTWYPEGDYTEAELWDAIAESEGLDVSEIMDGDLTEYL |
Ga0214919_101757121 | 3300023184 | Freshwater | MSNLYSILAEWYPDGNYSEAELWEAVAESEGVDVYSIMDGDLTEYL |
Ga0244777_108808382 | 3300024343 | Estuarine | MNNLYSILAEMHPNGDFNEADLWDAIAESEGVDVYEIMDGDLTEYL |
Ga0244775_100147066 | 3300024346 | Estuarine | MNNLYSILSERHPDGDFNEMDLWEAIAGSEGLELNEIMDGDLTEYL |
Ga0244775_106111033 | 3300024346 | Estuarine | MNNLYSILSERHPDGNFGEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0244775_113893342 | 3300024346 | Estuarine | MSNLYSILAEWHPDGDFNESDLWDAIAESEGVDVSSIMDGDLTDYL |
Ga0208800_10392693 | 3300027193 | Estuarine | YTLGYLKESIKMSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTEYL |
Ga0208439_10563722 | 3300027278 | Estuarine | MNNLYSILSERHPDGDFGEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0209300_10199396 | 3300027365 | Deep Subsurface | MNNLYSILSDWYPDGNYTEAELWDAIAELEGVSVSEIMDGDLTEYL |
Ga0209087_11856741 | 3300027734 | Freshwater Lake | KMSNLYSILAEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTDYL |
Ga0209134_100199625 | 3300027764 | Freshwater Lake | MSNLYSILSEWYPDGNYSEAELWDAVAESEGVDVYSIMDGDLTEYL |
Ga0209770_101437923 | 3300027769 | Freshwater Lake | MSNLYSILSEWYPDGNYSEAELWDAVAESQGVDVYSIMDGDLTDYL |
Ga0209770_103871192 | 3300027769 | Freshwater Lake | MDNLYSILSERHPEGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0209287_102264481 | 3300027792 | Freshwater Sediment | MDNLYSILSTWYPEGDYTEAELWDAIAESEGVDVYEIMDGDLTDYL |
Ga0209229_100018439 | 3300027805 | Freshwater And Sediment | MSNFYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0209230_100065598 | 3300027836 | Freshwater And Sediment | MSNVYEILAEWHPSGDFTESDLWDAIAESEGVDVYSIMDGDLTDYL |
Ga0209550_104151752 | 3300027892 | Freshwater Lake | MSNLYSILAESHPDGDFTESDLWDAIAESEGVDVYSIMDGDLTDYL |
Ga0315907_102150545 | 3300031758 | Freshwater | MDNLYSILSEWYPEGEFSESELWDAIAESEGVEVSEIMDGDLIEYL |
Ga0315907_103937723 | 3300031758 | Freshwater | MSDLYSILATWYPDGNYTEAELWDAIAEIEGVSVSEIMDGDLTEYL |
Ga0315907_105021863 | 3300031758 | Freshwater | MNNLYSILSERYPEGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0315900_110166862 | 3300031787 | Freshwater | MENLYSILSERHPDGDFGEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0315909_105904952 | 3300031857 | Freshwater | MDNLYSILSERHPDGDFSEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0315901_104008314 | 3300031963 | Freshwater | MNNLYSILSERHPEGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0315902_112733392 | 3300032093 | Freshwater | YQRSNTKMNSLYSILAEWYPDGNYSEEELWDAIAESQGVDVYSIMDGDLTDYL |
Ga0334992_0317336_124_288 | 3300033992 | Freshwater | MATRGGLLMDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0335002_0225013_948_1088 | 3300034020 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLDLNEIMDGDLTEYL |
Ga0335002_0503890_95_277 | 3300034020 | Freshwater | MLTTWTHGYHRRTMMSNLYSILSERHPDGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0335012_0183432_1_132 | 3300034093 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTE |
Ga0335012_0409286_533_661 | 3300034093 | Freshwater | YSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLTEYL |
Ga0335029_0091986_1856_2023 | 3300034102 | Freshwater | MLGYHRRTTMNNLYSILSERHPDGNFGEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0335036_0869821_62_202 | 3300034106 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELYEIMDGDLTEYL |
Ga0335058_0694841_442_561 | 3300034121 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDG |
Ga0335052_0178611_1106_1234 | 3300034279 | Freshwater | MDNLYSILSERHPDGDFNEMDLWEAIADSEGLELNEIMDGDLT |
⦗Top⦘ |