NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084903

Metagenome Family F084903

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084903
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 61 residues
Representative Sequence MNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Number of Associated Samples 24
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.79 %
% of genes near scaffold ends (potentially truncated) 43.75 %
% of genes from short scaffolds (< 2000 bps) 46.43 %
Associated GOLD sequencing projects 24
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (58.036 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(65.179 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(86.607 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.11%    β-sheet: 0.00%    Coil/Unstructured: 48.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00078RVT_1 4.46
PF07727RVT_2 3.57
PF13952DUF4216 1.79
PF03018Dirigent 1.79
PF13960DUF4218 1.79
PF03732Retrotrans_gag 1.79
PF00400WD40 1.79
PF03641Lysine_decarbox 1.79
PF14291DUF4371 0.89
PF00665rve 0.89
PF05699Dimer_Tnp_hAT 0.89
PF13833EF-hand_8 0.89
PF13456RVT_3 0.89
PF13966zf-RVT 0.89
PF00132Hexapep 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 1.79
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.89
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.89
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.89
COG4584TransposaseMobilome: prophages, transposons [X] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.04 %
UnclassifiedrootN/A41.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918001|WWPM1086_GHCZ6091_g1Not Available700Open in IMG/M
3300028786|Ga0307517_10026066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7106Open in IMG/M
3300028786|Ga0307517_10028827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6592Open in IMG/M
3300028786|Ga0307517_10039750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5154Open in IMG/M
3300028786|Ga0307517_10088533Not Available2558Open in IMG/M
3300028786|Ga0307517_10134645Not Available1762Open in IMG/M
3300028786|Ga0307517_10174981Not Available1400Open in IMG/M
3300028786|Ga0307517_10200918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1246Open in IMG/M
3300028786|Ga0307517_10266044Not Available990Open in IMG/M
3300028786|Ga0307517_10337227Not Available825Open in IMG/M
3300028786|Ga0307517_10383235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus750Open in IMG/M
3300028794|Ga0307515_10061522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides5324Open in IMG/M
3300028794|Ga0307515_10086763Not Available3984Open in IMG/M
3300028794|Ga0307515_10134315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2701Open in IMG/M
3300028794|Ga0307515_10212139Not Available1777Open in IMG/M
3300030521|Ga0307511_10115118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1690Open in IMG/M
3300030521|Ga0307511_10135755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix brachista1465Open in IMG/M
3300030521|Ga0307511_10189664Not Available1089Open in IMG/M
3300030522|Ga0307512_10035816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4222Open in IMG/M
3300030522|Ga0307512_10052582Not Available3246Open in IMG/M
3300030522|Ga0307512_10187812Not Available1146Open in IMG/M
3300030522|Ga0307512_10285968Not Available783Open in IMG/M
3300030522|Ga0307512_10297999Not Available754Open in IMG/M
3300030522|Ga0307512_10462173Not Available508Open in IMG/M
3300031456|Ga0307513_10020902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides7744Open in IMG/M
3300031456|Ga0307513_10038019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5349Open in IMG/M
3300031456|Ga0307513_10040587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides5144Open in IMG/M
3300031456|Ga0307513_10077672Not Available3436Open in IMG/M
3300031456|Ga0307513_10107406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2794Open in IMG/M
3300031456|Ga0307513_10186551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1930Open in IMG/M
3300031456|Ga0307513_10289479Not Available1410Open in IMG/M
3300031456|Ga0307513_10968575Not Available559Open in IMG/M
3300031456|Ga0307513_10995903Not Available547Open in IMG/M
3300031507|Ga0307509_10125661Not Available2531Open in IMG/M
3300031507|Ga0307509_10193520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1881Open in IMG/M
3300031507|Ga0307509_10209088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba1778Open in IMG/M
3300031507|Ga0307509_10223993Not Available1690Open in IMG/M
3300031507|Ga0307509_10272408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1459Open in IMG/M
3300031507|Ga0307509_10624353Not Available748Open in IMG/M
3300031507|Ga0307509_10647910Not Available725Open in IMG/M
3300031507|Ga0307509_10951840Not Available524Open in IMG/M
3300031616|Ga0307508_10013885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7351Open in IMG/M
3300031616|Ga0307508_10056350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis3480Open in IMG/M
3300031616|Ga0307508_10139512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2027Open in IMG/M
3300031616|Ga0307508_10216714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1514Open in IMG/M
3300031616|Ga0307508_10278617Not Available1265Open in IMG/M
3300031616|Ga0307508_10312539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1163Open in IMG/M
3300031616|Ga0307508_10465656Not Available857Open in IMG/M
3300031616|Ga0307508_10572292Not Available729Open in IMG/M
3300031616|Ga0307508_10799246Not Available560Open in IMG/M
3300031616|Ga0307508_10911462Not Available506Open in IMG/M
3300031649|Ga0307514_10131374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1723Open in IMG/M
3300031649|Ga0307514_10223626Not Available1150Open in IMG/M
3300031649|Ga0307514_10310320Not Available875Open in IMG/M
3300031730|Ga0307516_10026044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5945Open in IMG/M
3300031730|Ga0307516_10030859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5406Open in IMG/M
3300031730|Ga0307516_10278798Not Available1354Open in IMG/M
3300031730|Ga0307516_10302256Not Available1275Open in IMG/M
3300031730|Ga0307516_10683596Not Available682Open in IMG/M
3300031730|Ga0307516_10836546Not Available583Open in IMG/M
3300031730|Ga0307516_10841516Not Available580Open in IMG/M
3300031838|Ga0307518_10012947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5959Open in IMG/M
3300031838|Ga0307518_10163950Not Available1523Open in IMG/M
3300031838|Ga0307518_10311358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa948Open in IMG/M
3300031838|Ga0307518_10488038Not Available640Open in IMG/M
3300031838|Ga0307518_10582834Not Available541Open in IMG/M
3300031838|Ga0307518_10631167Not Available501Open in IMG/M
3300032354|Ga0325403_1002181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae17143Open in IMG/M
3300032354|Ga0325403_1002434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix brachista16476Open in IMG/M
3300032354|Ga0325403_1003029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15157Open in IMG/M
3300032354|Ga0325403_1003900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13742Open in IMG/M
3300032354|Ga0325403_1005922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11582Open in IMG/M
3300032354|Ga0325403_1016033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa6960Open in IMG/M
3300032354|Ga0325403_1016084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa6949Open in IMG/M
3300032354|Ga0325403_1017486Not Available6619Open in IMG/M
3300032354|Ga0325403_1021847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida5741Open in IMG/M
3300032354|Ga0325403_1031252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea4437Open in IMG/M
3300032354|Ga0325403_1039861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Carduoideae → Cardueae → Carduinae → Cynara → Cynara cardunculus → Cynara cardunculus subsp. cardunculus → Cynara cardunculus var. scolymus3627Open in IMG/M
3300032354|Ga0325403_1045041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3247Open in IMG/M
3300032354|Ga0325403_1072706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1895Open in IMG/M
3300032355|Ga0325401_1000234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus36906Open in IMG/M
3300032355|Ga0325401_1200145Not Available660Open in IMG/M
3300032374|Ga0325400_1050317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3424Open in IMG/M
3300032389|Ga0325405_1001459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae23928Open in IMG/M
3300032389|Ga0325405_1003956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae15213Open in IMG/M
3300032389|Ga0325405_1004215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus14728Open in IMG/M
3300032389|Ga0325405_1007827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10710Open in IMG/M
3300032389|Ga0325405_1010026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9228Open in IMG/M
3300032389|Ga0325405_1013527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7684Open in IMG/M
3300032389|Ga0325405_1019423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6005Open in IMG/M
3300032389|Ga0325405_1041315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3119Open in IMG/M
3300032389|Ga0325405_1044786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2861Open in IMG/M
3300032390|Ga0325404_1000647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus35447Open in IMG/M
3300032390|Ga0325404_1000888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales30638Open in IMG/M
3300032390|Ga0325404_1032699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa3946Open in IMG/M
3300032740|Ga0325411_1002954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida19181Open in IMG/M
3300032740|Ga0325411_1023186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida5492Open in IMG/M
3300032740|Ga0325411_1034481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3792Open in IMG/M
3300032741|Ga0325414_1054756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2476Open in IMG/M
3300033160|Ga0325402_1015127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7134Open in IMG/M
3300033179|Ga0307507_10051484Not Available3962Open in IMG/M
3300033179|Ga0307507_10055625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3748Open in IMG/M
3300033179|Ga0307507_10076916Not Available2972Open in IMG/M
3300033179|Ga0307507_10079443Not Available2899Open in IMG/M
3300033179|Ga0307507_10098692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2457Open in IMG/M
3300033179|Ga0307507_10279809Not Available1044Open in IMG/M
3300033180|Ga0307510_10194000Not Available1575Open in IMG/M
3300034389|Ga0325419_009002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix brachista10618Open in IMG/M
3300034689|Ga0325421_030907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3925Open in IMG/M
3300034689|Ga0325421_082425Not Available1243Open in IMG/M
3300034899|Ga0325407_010156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9229Open in IMG/M
3300034899|Ga0325407_080517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1287Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza65.18%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem30.36%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf3.57%
Wastewater Plasmid PoolsEngineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918001Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler)EngineeredOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
WWPMV_5403902035918001Wastewater Plasmid PoolsMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNTFLGIISHDYLFNHKSLKKAFIIIGDISNYKTNQT
Ga0307517_10026066103300028786EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIGDILIFDSTVYEP
Ga0307517_1002882723300028786EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHNTTLKEASIIIGDISNFDSTVYEP
Ga0307517_1003975053300028786EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKLLVVNIQNNFLGIISHHTSLKEALIIIEDISIFYSTVYEPXEYETLRKK
Ga0307517_1008853333300028786EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFDSVYE
Ga0307517_1013464513300028786EctomycorrhizaNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKTLIIIEDISIFDSVYEA
Ga0307517_1017498113300028786EctomycorrhizaNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIKDISIFDSVYES
Ga0307517_1020091833300028786EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISYHTTLKEALIIIEDISIFLLHGLRAVRV
Ga0307517_1026604413300028786EctomycorrhizaQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFDSTVYEP
Ga0307517_1033722723300028786EctomycorrhizaMNIQNIIENNLLLFTVNVWIKKPQVLNIQNIFLGIISHHTSLKEASIIIEDIPIFLTPRFTSRESMK
Ga0307517_1038323513300028786EctomycorrhizaIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISPHTSLKEASIIIEDISIFDSTVYEL
Ga0307515_1006152213300028794EctomycorrhizaRNPKGMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLEIISHHTSLKEASIIIEDISIF
Ga0307515_1008676343300028794EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNTFLGIISHDYLFNHTSLKKAFIIIGDISNYKTNQT
Ga0307515_1013431513300028794EctomycorrhizaMNIQNIIGNNLLLFVVNVWIKKPQVVNIQNIFLGIISHRTSLKEASIIIEDILIFDSTVYEP
Ga0307515_1021213913300028794EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKALIIIEDISIFDSVYEAXEYEIGF
Ga0307511_1011511813300030521EctomycorrhizaNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYEP
Ga0307511_1013575513300030521EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHNTTLKEASIIIGDISNFDST
Ga0307511_1018966413300030521EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLQEASIIIEDISIIDSTVYEP
Ga0307512_1003581653300030522EctomycorrhizaMNIQNIIRNNLLLFAVNVWIKKPQVVNIQNIFLGIISYHISLKEVSIIIEDILIFDSTVYEP
Ga0307512_1005258223300030522EctomycorrhizaQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIF
Ga0307512_1018781213300030522EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFDSTIYEL
Ga0307512_1028596813300030522EctomycorrhizaRNSKWMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNTFLGIISHDYLFNHISLKEVSIIMGTF
Ga0307512_1029799913300030522EctomycorrhizaMNIQNITGNNLLLFTVNIWIKKPQVVNIQNIFLGIISHHTSLKEALIIIE
Ga0307512_1046217313300030522EctomycorrhizaPKGMNIQNIIGNNLLLFVVNIWIKKSQVVNIQNIFPGIISHHTSLKEASIIIEDILIFYSIVYEP
Ga0307513_1002090283300031456EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDILIFDSTVTSRKSMKH
Ga0307513_1003801913300031456EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIGDILIFDSTVYEPXKYE
Ga0307513_1004058713300031456EctomycorrhizaMTIQNIIENNLLLFTVNIWIKKPSVVNIKNNFLGIISHHATLIIIEDISIFDSMVY
Ga0307513_1007767213300031456EctomycorrhizaMNIQNIIENNLLLFTVNIWIKKPSVVNIKNNFLGIISHHAALIIIEDISIFDSMVYKP
Ga0307513_1010740623300031456EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPSVVNIQNNFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Ga0307513_1018655113300031456EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTV
Ga0307513_1028947913300031456EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNTFLGIISHDYLFNHTSLKKAFIIIGDISNFASTVYES
Ga0307513_1096857513300031456EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFLVHGLRAVRV
Ga0307513_1099590313300031456EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHYTSLKEALIIIEDISIFDSTVYEPW
Ga0307509_1012566113300031507EctomycorrhizaNPKGMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFLIPRFTSRKSMKH
Ga0307509_1019352023300031507EctomycorrhizaMNIQNIIENNLLLFAVNVWIKKPQMVNIQNIFLGIISHHPSLKEALLIIEGISIFLTPRFTSHESMKH
Ga0307509_1020908813300031507EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPKVVNIQNIFLGIISHRTSLKEALIIIEDILIFTPRFMSHESIKH
Ga0307509_1022399313300031507EctomycorrhizaNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKALIIIEDISIFDSVYEA
Ga0307509_1027240813300031507EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKLSVVNIQNNFLGIISDHTSLKEALIIIKDISIFDSTVYEP
Ga0307509_1062435323300031507EctomycorrhizaIQNIIRNNLLLFTVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYEP
Ga0307509_1064791013300031507EctomycorrhizaPFKGMNIQNIIRNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEVLIIIEDISIFYSTVYEP
Ga0307509_1095184013300031507EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKSQVVNIQNIFLGIISHHTSLKEALIIIEDISIFLLHGLRAVRV
Ga0307508_10013885123300031616EctomycorrhizaMNIQNIIRNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKALIIIEDISIFDSVYEAXEYEIGF
Ga0307508_1005635063300031616EctomycorrhizaMNIQNIIGNNLLLFAINVWIKKPQVVNIQNIFLGIISHRTSLKEASIIIEDISIFDSTVYEP
Ga0307508_1013951213300031616EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYEP
Ga0307508_1021671413300031616EctomycorrhizaNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISPHTSLKEASNIIEDISIFDSTVYE
Ga0307508_1027861713300031616EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIKDISIFDSVYE
Ga0307508_1031253933300031616EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKLLVVNIQNNFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Ga0307508_1046565613300031616EctomycorrhizaNIIGNNLLLFSVNVWIKKPQVVNIQNNFLGIISHHTSLKEASIIIEDISIFFDSMVYEP
Ga0307508_1057229223300031616EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNTFLGIISHDYLFNHKSLKKTFIIIGDISNY
Ga0307508_1079924613300031616EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISPHTSLKESSIIIEDISIFDSTVY
Ga0307508_1091146223300031616EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDI
Ga0307514_1013137433300031649EctomycorrhizaMNIQNIIGNNLLLFSVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDILIFLTPWFTSRENMKR
Ga0307514_1022362623300031649EctomycorrhizaMTIQNIIENNLLLFTVNIWIKKPSVVNIKNNFLGIISHHAALIIIEDISIFDSMVYKPXEYA
Ga0307514_1031032023300031649EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKALIIIEDISIFDS
Ga0307516_1002604453300031730EctomycorrhizaMNIQNIIGNNLLLFVVNIWIKKPQVVNIQNIFLGIISHHTSVKEVLIIIKDISIFDSTVYEP
Ga0307516_1003085933300031730EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTIYEP
Ga0307516_1027879813300031730EctomycorrhizaNDLLLFVVNIWIKKPQVVNIQNIFVGIKSHHTSLKETSIIIEDISIFDSTVYEP
Ga0307516_1030225623300031730EctomycorrhizaNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYE
Ga0307516_1068359613300031730EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPSVVNIQNNFLGIISHHTSLKEALII
Ga0307516_1083654613300031730EctomycorrhizaMNIQNIIRNNLLLFTVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDI
Ga0307516_1084151613300031730EctomycorrhizaQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFLLHGLRAVRV
Ga0307518_1001294723300031838EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYEP
Ga0307518_1016395013300031838EctomycorrhizaNIQNIIGNNLLLFAVNVWIKKPQVVNIQNTFLGIISHDYLFNHISLKEASIIMGTF
Ga0307518_1031135813300031838EctomycorrhizaMNIQNIIGNNLLVFVVNVWIKKPQVVNIQNIFLEIISHHTSLKEASIIIEDIS
Ga0307518_1048803813300031838EctomycorrhizaIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISPHTSLKEASIIIEDISIFDSTVYEL
Ga0307518_1058283413300031838EctomycorrhizaGMNIQNIIGNNLLVFAVNVWIKKPKVVNIQNIFLGIISHHTSLKQASIIIEDISNFDSTVYEP
Ga0307518_1063116733300031838EctomycorrhizaMNIQNIIRNNLLLFTVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVY
Ga0325403_1002181103300032354XylemMNIQNIIGNNLLLFNVNIWIKKPSVVNILNNFLGIISHHIALKEALIIIENISIFDSTVYEP
Ga0325403_100243443300032354XylemMNIQNIIGNDLLLFVVDVWIKKPQMVNIQNIFLEIISHHTSLKEASIIIEDISIFNSTVYEP
Ga0325403_1003029133300032354XylemMNIQNIIGNNLLLFTVNVWIKKPKWLISKIFFLGIISHHTSLKEASIIIEDISIFDSTVYEP
Ga0325403_100390023300032354XylemMNIQNIIWNNLLLFTVNVWIKKPQAVNIQNIFLGIISHHTSLEEALIIIEDISIFDSTVYEP
Ga0325403_1005922143300032354XylemMNIQNIIGNNLLLFTVNVWIKKPQVVNVQNIFLRIINHHTSLKEVSIIIEDILIFDSMVYKP
Ga0325403_101603323300032354XylemMNIQNIIGNNLLLFAVNIWIKKPSVVNIQNNFLGIISHHISLEEALIIIENISIFDSMVYEP
Ga0325403_1016084123300032354XylemLDKEIQKGMNIQNIIGNNLLLFAVNIWIKKPSVVNIQNNFLGIISHHTSLEEALIIIENISIFDSMVYEP
Ga0325403_101748623300032354XylemMQNIIGNNLLLFAINVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFYSTVYEP
Ga0325403_102184723300032354XylemMNIQNIIGNNLLLFSVNIWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFFYSMVYEP
Ga0325403_103125273300032354XylemMNIQNIIGNNLLLFTVNVWIKKPEVVNIQNNLLGIISHHTSLKEALIIIEDISTFDSTVYVS
Ga0325403_103986143300032354XylemMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFLLHGLRVVRV
Ga0325403_104504123300032354XylemMNIQNIIENNLLLFDVNIWIKKPQVVNIQNNFLEIISHHTFLKEVSIIIEDIQFFTQWFASRESMKH
Ga0325403_107270643300032354XylemMNIQNIIGNNLLLLAVNVWIKKPKVVNIQNIFLGIISHYTSLKEALIVIEDISIFLLRGLRAVRV
Ga0325401_1000234313300032355XylemLDKEIPKGCIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLEIISHHTSLKEALIIIEDILIFDSTVYEP
Ga0325401_120014513300032355XylemIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Ga0325400_105031743300032374XylemMNIQNIIGNNLLLFAVNVWIKKPKVVNIQNIFLEIISHYTSLKEALIIIKDISFFYYSMVYEP
Ga0325405_1001459213300032389XylemMNIQNIIGNNLLLFNVNIWIKKSSVVNIQNNFLGIISHHITLKEVLIIIEDISIFYSMVYEP
Ga0325405_100395643300032389XylemMNIQNIIENNLLLFAVNVWIKKPQVVNIQNNFLEIISHHTSLKEVSIIIEDIQFFTPRFKSRESMQH
Ga0325405_100421583300032389XylemMNIQNIIGNNLLLFTVNVWIKKPKWLISKIFFLGIISHHTSLKEASIIIEDISIFDSMVYEP
Ga0325405_100782773300032389XylemMNIQNIIGNNLLLFIVNIWIKKPSVVNIQNNFLGIIYHHTALKEALIIIKEISIFDPWFTSRESMKY
Ga0325405_101002663300032389XylemMNIQNIIGNNLLLFAVNIWIKKPKIVNIQNTFLGIRSHDYLFNHTSLKKVSIIIGDISNFASTVYESXKYEILKKK
Ga0325405_101352713300032389XylemMNIQNIIGNNLLLFSVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFFDSMVYEP
Ga0325405_101942353300032389XylemMNIENIIGNNLLLFAVNVWIKKPQVVNIQNNFLGIISHHTFLKEALIIIEDILIFFYSTIYEP
Ga0325405_104131553300032389XylemMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEASIIIEDISIFDS
Ga0325405_104478643300032389XylemMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Ga0325404_1000647233300032390XylemMNIQNIIRNNLLLFAVNVWIKKPQVVNIQNIFLGIISHYTSLKETLIIIKDISIFLLHGLRAIRV
Ga0325404_1000888113300032390XylemMNIQNIIGNNLLLFVVDVWIKKPQAVNIKNIFLVITSHHISLKETLIIIKDILIFDSTVCEP
Ga0325404_103269913300032390XylemMNIQNIIGNNLLLLAVNVWIKKPKVVNIQNIFLGIISHYTSLKEALIVIGDISIFLLCGLRAVRV
Ga0325411_1002954103300032740XylemMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIINHHTSLKEASIIIEDISIFDFTVYKS
Ga0325411_102318633300032740XylemMNIQNIIGNNLSLFTVNIWIKKPSTVNIQNNFLGIICHYTALKEALIIIKDISIFDFTVYEL
Ga0325411_103448113300032740XylemMNIQNIIGNNLLLFAVNVWIKKLKVINIQNIFLGIISHYTSLKEALIIIKDISFFLLLCGLRAMRV
Ga0325414_105475623300032741LeafLLLFAVNVWIKKPQVVNIQNIFLGIISHHTSLKEALIIIEDISIFDSTVYEP
Ga0325402_101512773300033160XylemMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIINHHTSLKEASIIIEDILIFDFTVYKS
Ga0307507_1005148443300033179EctomycorrhizaMNIQNIIENNLLLFTVNVWIKKPQVLNIQNIFLGIISHHTSLKEASIIIEDIPIFLTPRFTSHESMKR
Ga0307507_1005562513300033179EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPKVVNIQNNFLGIISHHTSLKEASIRIEGISIFDSTVYEP
Ga0307507_1007691623300033179EctomycorrhizaMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNNFLGIISHHTFLKEALIIIKDISIFLLHGL
Ga0307507_1007944313300033179EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKIPQVVNIQNIFLGIISHHTSLKKALIIIEDISIFDSVYE
Ga0307507_1009869223300033179EctomycorrhizaMNIQNIIGNNLLIFAVNVWIKKPQVVNIQNIFLEIISPHTSLKEASIIIEDISIFDSTVYEL
Ga0307507_1027980923300033179EctomycorrhizaMNIQNIIGNNLLLFAINVWIKKPQVVNIQNIFLGIISYHTSLKEASIIIEDISIFD
Ga0307510_1019400023300033180EctomycorrhizaMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIISPHTSLKEASIIIEDISI
Ga0325419_009002_2335_25233300034389LeafMNIQNIIGNDLLLFVVDVWIKKPQMVNIQNIFLEIISHHTSLKEASIIIEDISIFDSTVNEP
Ga0325421_030907_3754_39243300034689LeafMNIQNIIGNNLLLFAVNVWIKKPQVVNIQNIFLGIINHHTSLKEASIIIEDISIFDF
Ga0325421_082425_3_1523300034689LeafMNIQNIIGNNLLLFAVNIWIKKPQVVNIQNIFLGIISHHTFLKEALIIIE
Ga0325407_010156_6103_63333300034899XylemMNIQNIIGNNLLLFAVNIWIKKPKIVNIQNTFLGIRSHDYLFNHTSLKKVSIIIGDISNFASTVYESWKYEILKKK
Ga0325407_080517_1116_12863300034899XylemMNIQNIIGNNLLLFTVNVWIKKPKVVNIQNIFLGIISHYTSLKEALIVIEDISIFLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.