| Basic Information | |
|---|---|
| Family ID | F084667 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NPALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLVMVGA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 94.64 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.643 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.82% β-sheet: 0.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 1.79 |
| PF00218 | IGPS | 0.89 |
| PF01863 | YgjP-like | 0.89 |
| PF00701 | DHDPS | 0.89 |
| PF12728 | HTH_17 | 0.89 |
| PF00216 | Bac_DNA_binding | 0.89 |
| PF13407 | Peripla_BP_4 | 0.89 |
| PF01022 | HTH_5 | 0.89 |
| PF13424 | TPR_12 | 0.89 |
| PF02910 | Succ_DH_flav_C | 0.89 |
| PF00342 | PGI | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.79 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.89 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.89 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.64 % |
| Unclassified | root | N/A | 5.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459006|GBPF9FW01D0ITX | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 567 | Open in IMG/M |
| 2170459009|GA8DASG02JP6RZ | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 543 | Open in IMG/M |
| 2170459023|GZGNO2B01EI79X | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 507 | Open in IMG/M |
| 2189573003|GZIR7W401BS6JO | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 537 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10098631 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 617 | Open in IMG/M |
| 3300001082|JGI12664J13189_1009428 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 598 | Open in IMG/M |
| 3300001116|JGI12627J13344_104672 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 536 | Open in IMG/M |
| 3300001143|JGI12687J13287_102221 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 599 | Open in IMG/M |
| 3300001162|JGI12714J13572_1009428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 522 | Open in IMG/M |
| 3300001867|JGI12627J18819_10388878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 566 | Open in IMG/M |
| 3300002917|JGI25616J43925_10007431 | All Organisms → cellular organisms → Bacteria | 4753 | Open in IMG/M |
| 3300005162|Ga0066814_10109555 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 525 | Open in IMG/M |
| 3300005164|Ga0066815_10053343 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 673 | Open in IMG/M |
| 3300005764|Ga0066903_108774105 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 513 | Open in IMG/M |
| 3300005993|Ga0080027_10095323 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1111 | Open in IMG/M |
| 3300006172|Ga0075018_10644202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR034 | 568 | Open in IMG/M |
| 3300006176|Ga0070765_100576058 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1061 | Open in IMG/M |
| 3300006954|Ga0079219_10938781 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 706 | Open in IMG/M |
| 3300006954|Ga0079219_10963033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR034 | 701 | Open in IMG/M |
| 3300009792|Ga0126374_11249908 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 597 | Open in IMG/M |
| 3300010154|Ga0127503_10326130 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 538 | Open in IMG/M |
| 3300010159|Ga0099796_10294782 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 686 | Open in IMG/M |
| 3300010162|Ga0131853_10944106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 672 | Open in IMG/M |
| 3300010321|Ga0134067_10140206 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 856 | Open in IMG/M |
| 3300010341|Ga0074045_10058238 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae | 2767 | Open in IMG/M |
| 3300010358|Ga0126370_11026652 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 755 | Open in IMG/M |
| 3300010373|Ga0134128_12527590 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 566 | Open in IMG/M |
| 3300010376|Ga0126381_100196970 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300010376|Ga0126381_103203634 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 647 | Open in IMG/M |
| 3300010376|Ga0126381_104952180 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 511 | Open in IMG/M |
| 3300010398|Ga0126383_13623618 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 504 | Open in IMG/M |
| 3300011120|Ga0150983_12532257 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 548 | Open in IMG/M |
| 3300011392|Ga0153987_1016378 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 763 | Open in IMG/M |
| 3300012059|Ga0153991_1069556 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 546 | Open in IMG/M |
| 3300012169|Ga0153990_1061837 | Not Available | 848 | Open in IMG/M |
| 3300012582|Ga0137358_10378242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300012923|Ga0137359_10848048 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 790 | Open in IMG/M |
| 3300012923|Ga0137359_11357316 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 599 | Open in IMG/M |
| 3300012948|Ga0126375_11683832 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 549 | Open in IMG/M |
| 3300013025|Ga0157367_1121287 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1083 | Open in IMG/M |
| 3300016294|Ga0182041_11376498 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 647 | Open in IMG/M |
| 3300016319|Ga0182033_11297905 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 654 | Open in IMG/M |
| 3300016319|Ga0182033_11681177 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 575 | Open in IMG/M |
| 3300016371|Ga0182034_11303144 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 633 | Open in IMG/M |
| 3300016422|Ga0182039_11221473 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 679 | Open in IMG/M |
| 3300020581|Ga0210399_11428675 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 539 | Open in IMG/M |
| 3300021178|Ga0210408_11259260 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 562 | Open in IMG/M |
| 3300021180|Ga0210396_11220857 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 629 | Open in IMG/M |
| 3300021180|Ga0210396_11324008 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 598 | Open in IMG/M |
| 3300021180|Ga0210396_11551091 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 543 | Open in IMG/M |
| 3300021181|Ga0210388_10094170 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300021181|Ga0210388_11036647 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 702 | Open in IMG/M |
| 3300021377|Ga0213874_10325479 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 584 | Open in IMG/M |
| 3300021401|Ga0210393_10988375 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 681 | Open in IMG/M |
| 3300021401|Ga0210393_11131473 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 631 | Open in IMG/M |
| 3300021403|Ga0210397_11197295 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 590 | Open in IMG/M |
| 3300021403|Ga0210397_11209147 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 587 | Open in IMG/M |
| 3300021406|Ga0210386_11679716 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 525 | Open in IMG/M |
| 3300021477|Ga0210398_11159388 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 612 | Open in IMG/M |
| 3300022726|Ga0242654_10363344 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 547 | Open in IMG/M |
| 3300025939|Ga0207665_11500594 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
| 3300026342|Ga0209057_1157067 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 700 | Open in IMG/M |
| 3300026498|Ga0257156_1094159 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 623 | Open in IMG/M |
| 3300027070|Ga0208365_1045416 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 588 | Open in IMG/M |
| 3300027109|Ga0208603_1055633 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 598 | Open in IMG/M |
| 3300027660|Ga0209736_1108596 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 751 | Open in IMG/M |
| 3300027669|Ga0208981_1100648 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 737 | Open in IMG/M |
| 3300027669|Ga0208981_1140358 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 615 | Open in IMG/M |
| 3300027727|Ga0209328_10023160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
| 3300027727|Ga0209328_10252356 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 526 | Open in IMG/M |
| 3300027738|Ga0208989_10203930 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 654 | Open in IMG/M |
| 3300027879|Ga0209169_10565838 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 595 | Open in IMG/M |
| 3300027894|Ga0209068_10679209 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 603 | Open in IMG/M |
| 3300028047|Ga0209526_10012972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5755 | Open in IMG/M |
| 3300028536|Ga0137415_10714733 | Not Available | 814 | Open in IMG/M |
| 3300028906|Ga0308309_11386369 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 603 | Open in IMG/M |
| 3300030506|Ga0302194_10265154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 688 | Open in IMG/M |
| 3300030872|Ga0265723_1006973 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 721 | Open in IMG/M |
| 3300031128|Ga0170823_10110735 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 741 | Open in IMG/M |
| 3300031446|Ga0170820_11244157 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 615 | Open in IMG/M |
| 3300031543|Ga0318516_10456434 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 734 | Open in IMG/M |
| 3300031545|Ga0318541_10401528 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 766 | Open in IMG/M |
| 3300031546|Ga0318538_10781695 | Not Available | 518 | Open in IMG/M |
| 3300031718|Ga0307474_11264344 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 583 | Open in IMG/M |
| 3300031754|Ga0307475_10025522 | All Organisms → cellular organisms → Bacteria | 4217 | Open in IMG/M |
| 3300031765|Ga0318554_10613591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 612 | Open in IMG/M |
| 3300031769|Ga0318526_10430555 | Not Available | 539 | Open in IMG/M |
| 3300031770|Ga0318521_10243526 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300031771|Ga0318546_10993445 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 590 | Open in IMG/M |
| 3300031771|Ga0318546_10995489 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 590 | Open in IMG/M |
| 3300031777|Ga0318543_10211850 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 861 | Open in IMG/M |
| 3300031777|Ga0318543_10478207 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 558 | Open in IMG/M |
| 3300031799|Ga0318565_10587635 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 535 | Open in IMG/M |
| 3300031833|Ga0310917_10868908 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 607 | Open in IMG/M |
| 3300031879|Ga0306919_11458486 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
| 3300031910|Ga0306923_12326756 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
| 3300031945|Ga0310913_10912763 | Not Available | 617 | Open in IMG/M |
| 3300031946|Ga0310910_10617256 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 859 | Open in IMG/M |
| 3300031954|Ga0306926_10874074 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1078 | Open in IMG/M |
| 3300032001|Ga0306922_11412128 | Not Available | 699 | Open in IMG/M |
| 3300032001|Ga0306922_12321695 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 514 | Open in IMG/M |
| 3300032009|Ga0318563_10383755 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 760 | Open in IMG/M |
| 3300032009|Ga0318563_10769840 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
| 3300032051|Ga0318532_10339864 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
| 3300032059|Ga0318533_10900906 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 649 | Open in IMG/M |
| 3300032065|Ga0318513_10507817 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 590 | Open in IMG/M |
| 3300032076|Ga0306924_12291832 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 548 | Open in IMG/M |
| 3300032089|Ga0318525_10666293 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 530 | Open in IMG/M |
| 3300032174|Ga0307470_11275900 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 600 | Open in IMG/M |
| 3300032180|Ga0307471_102814447 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 617 | Open in IMG/M |
| 3300032205|Ga0307472_102530815 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 522 | Open in IMG/M |
| 3300032261|Ga0306920_100201976 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2966 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 2.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.79% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011392 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC071 MetaG | Host-Associated | Open in IMG/M |
| 3300012059 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC075 MetaG | Host-Associated | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013025 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM2 | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L01_05078970 | 2170459006 | Grass Soil | AQYKPVQKWQEVLRGSNPALKKKAVVAIGRQLMVDLWRLETGRVRAQELNLVMVEASGV |
| F47_09189340 | 2170459009 | Grass Soil | MARGVKGAPHPALKKKAVVAIGRPLMVDLWRLQTGRVTAQDLNLIMVEN |
| FA3_01818570 | 2170459023 | Grass Soil | GSNQALRKKTVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| FE2_03822380 | 2189573003 | Grass Soil | RSKKWQEVLRGSNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| AF_2010_repII_A001DRAFT_100986312 | 3300000793 | Forest Soil | RAALEGKNAASKKKAVVAIARQLIVDLWRLKTGRVSAQELKLVMVGG* |
| JGI12664J13189_10094281 | 3300001082 | Forest Soil | LFQPEYKAVQKWRQVLEGSNRGLKKKAVVAIGRRLMVDIWRLQTGRISVQELGLIMIEG* |
| JGI12627J13344_1046721 | 3300001116 | Forest Soil | VLRSTNRTLKKKAVVAIGRQLMVDLWRLQTGRITAKELNLVMIG* |
| JGI12687J13287_1022211 | 3300001143 | Forest Soil | QKWREVLEGSNRGLKKKAVVAIGRQLIVDIWRLQTGRISAQELGLIMIEA* |
| JGI12714J13572_10094281 | 3300001162 | Forest Soil | LKGPNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN* |
| JGI12627J18819_103888781 | 3300001867 | Forest Soil | VAIGRQLIVDLWRLETGRVTAQELNLVMIGAEGV* |
| JGI25616J43925_100074311 | 3300002917 | Grasslands Soil | VLEGPNRGLKKKAVVAIGRQLIVDIWRLQTGRISAQELNLIMVEG* |
| Ga0066814_101095552 | 3300005162 | Soil | QYQPVQKWQEVLKGPNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN* |
| Ga0066815_100533431 | 3300005164 | Soil | GPNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN* |
| Ga0066903_1087741051 | 3300005764 | Tropical Forest Soil | QEVLRGTNRTLKKKAAVAIGRQLMVDLWRLETGRVSARGLNLVMVGA* |
| Ga0080027_100953231 | 3300005993 | Prmafrost Soil | NPALKKKAVVAIGRPLMVDLWRLQTGRVTAQDLHLIMVEN* |
| Ga0075018_106442021 | 3300006172 | Watersheds | VLRGSNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEASGV* |
| Ga0070765_1005760581 | 3300006176 | Soil | VQKWKEVLAGSNPALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLVIIGA* |
| Ga0079219_109387811 | 3300006954 | Agricultural Soil | VQKWQEVLGGTNRTLKKKAVVAIGRQLIVDLWRLETGRATAKELNLAMIGG* |
| Ga0079219_109630331 | 3300006954 | Agricultural Soil | PNRALKKKAVVAIGRQLMVDLWQLHTGRASAQELNLIMMEG* |
| Ga0126374_112499081 | 3300009792 | Tropical Forest Soil | KKKAVVAIGRQLMVDLWRMQTGRVTAKELNLVMVGA* |
| Ga0127503_103261301 | 3300010154 | Soil | KAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN* |
| Ga0099796_102947821 | 3300010159 | Vadose Zone Soil | QKWQKVLQGTNPALKKKAVVAIGRQVIVDLWRLQTGRVTAQELNLVMIDAEGV* |
| Ga0131853_109441061 | 3300010162 | Termite Gut | LRGTNRALKKKAVVAIGRQLMVDLWRLQTGRSRAQELNLVLIGG* |
| Ga0134067_101402061 | 3300010321 | Grasslands Soil | LKGPNKALKKKAVIAIGRQLIVDLWRLQTGKASAEELKLVMIGG* |
| Ga0074045_100582382 | 3300010341 | Bog Forest Soil | VQKWQEVLRGTNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQELNLVMIGA* |
| Ga0126370_110266521 | 3300010358 | Tropical Forest Soil | KWQEVLRGTNKTLKKKAVVAIGRQLIVDLWRLQTGRSTAQELNLIMIGG* |
| Ga0134128_125275901 | 3300010373 | Terrestrial Soil | IARRRGRKKAVVAIGRQLMVDLWRLQTGRVSAQELNLLMIGG* |
| Ga0126381_1001969701 | 3300010376 | Tropical Forest Soil | PIQKWKAVLEAAHCSLKKKAVVAIGRQLIVDLWRLQTGRASAQELKLIMVGGD* |
| Ga0126381_1032036341 | 3300010376 | Tropical Forest Soil | YGPIQKWKAVLEAAHCSLKKKAVVAIGRQLIVDLWRLQTGRASAQELKLIMVGGD* |
| Ga0126381_1049521801 | 3300010376 | Tropical Forest Soil | KKAVVAIGRQLMVDLWRMETGRVTAQELNLVMVGA* |
| Ga0126383_136236181 | 3300010398 | Tropical Forest Soil | NRTLKKKAVVAIGRQLMVDLWRMETGRVTAQELNLVMVGA* |
| Ga0150983_125322571 | 3300011120 | Forest Soil | KWKEVLAGSNPALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLVIIGA* |
| Ga0153987_10163781 | 3300011392 | Attine Ant Fungus Gardens | KAVQKWQEVLRGTNRGLKKKAVVAIGRQLMVDLWRLQTGRVSAQELNLVMIGG* |
| Ga0153991_10695561 | 3300012059 | Attine Ant Fungus Gardens | VQKWQEVLRGTNRGLKKKAVVAIGRQLMVDLWRLQTGRVSAQELKLVMIGG* |
| Ga0153990_10618371 | 3300012169 | Attine Ant Fungus Gardens | QKWQEVLRGSNRGLKKKAVVAIGRQLMVDLWRLQTGRVSAQELNLVMIGG* |
| Ga0137358_103782422 | 3300012582 | Vadose Zone Soil | LKKKAVVAIGRQLMVDLWRLQTGRVSAQELKLIMIGG* |
| Ga0137359_108480482 | 3300012923 | Vadose Zone Soil | NPALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLVMVGA* |
| Ga0137359_113573161 | 3300012923 | Vadose Zone Soil | KKKAVVAIGRQLMVDLWRLQTGRATAQELNLVMIGA* |
| Ga0126375_116838321 | 3300012948 | Tropical Forest Soil | LKKKAVVAIGRQLIVDLWRLQTGRSTAQELNLIMIGG* |
| Ga0157367_11212871 | 3300013025 | Fungus Garden | PPVQKWQEVLEGTNRTLKKKAVVAIGRQLIVDLWRLQTGRASAQQLNLVMIGG* |
| Ga0182041_113764981 | 3300016294 | Soil | NPGLKKKAVVAIGRRLMVDIWRLQTGRITAQELGLIMIEA |
| Ga0182033_112979051 | 3300016319 | Soil | EVLEGSNRGLKKKAVVAIGRRLIVDIWRLQTGRISAQELGLIMIEA |
| Ga0182033_116811771 | 3300016319 | Soil | KKAVVAIGRQLIIDIWRLQTGRISAQELGLIMIEA |
| Ga0182034_113031441 | 3300016371 | Soil | QKWRQVLEGSNRGLKKKAVVAIGRQLIVDIWRLQTGRICAQELGLIMIEA |
| Ga0182039_112214731 | 3300016422 | Soil | PVQKWQEVLGGTNRTLKKKAVVAIGRQVIVDLWRLQTGRASAQQLKLVMIGG |
| Ga0210399_114286751 | 3300020581 | Soil | KAVVAIGRQLIVDLWRLETGRVTAQELNLVMIETSGV |
| Ga0210408_112592601 | 3300021178 | Soil | PALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLVMVGA |
| Ga0210396_112208571 | 3300021180 | Soil | MILFQPEYKAVQKWRQVLEGSNRGLKKKAVVAIGRRLMVDIWRLQTGRISVQELGLIMIE |
| Ga0210396_113240082 | 3300021180 | Soil | RGSNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0210396_115510911 | 3300021180 | Soil | KKAVVAIGRQLMVDLWRLQTGRVTAQGLNLVMIDA |
| Ga0210388_100941702 | 3300021181 | Soil | KKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0210388_110366471 | 3300021181 | Soil | KKAVVAIGRQLIVDLWRLETGRVTAQELNLVMVDA |
| Ga0213874_103254791 | 3300021377 | Plant Roots | RGLKKKAVVAIGRRLLVDIWRLQTGRISAQELGLIMMEA |
| Ga0210393_109883751 | 3300021401 | Soil | KAVQKWQEVLRGSNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIETSGV |
| Ga0210393_111314731 | 3300021401 | Soil | SNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0210397_111972951 | 3300021403 | Soil | ALKKKAVVAIGRQLIVDLWRLQTGRVTAQELNLLMIGA |
| Ga0210397_112091471 | 3300021403 | Soil | KKKAVVAIGRQLMVDLWRLETGRVTAQELNLVMIDAEGV |
| Ga0210386_116797161 | 3300021406 | Soil | LKKKAVVAIGRQLMVDLWRLQTGRASAQQLNLVMIGG |
| Ga0210398_111593881 | 3300021477 | Soil | VLRGSNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0242654_103633441 | 3300022726 | Soil | PNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN |
| Ga0207665_115005941 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVAIGRQLMVDLWRLETGRVTAQELNLVMIDAEGV |
| Ga0209057_11570671 | 3300026342 | Soil | LKGPNKALKKKAVIAIGRQLIVDLWRLQTGKASAEELKLVMIEG |
| Ga0257156_10941591 | 3300026498 | Soil | TNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQDLNLIMVEN |
| Ga0208365_10454161 | 3300027070 | Forest Soil | KPVQKWQEVLRGSNPALKKKAVVAIGRQLMVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0208603_10556331 | 3300027109 | Forest Soil | LQGTNPALKKKAVVAIGRQLIVDLWRLQTGRVTVQELNLVMVGA |
| Ga0209736_11085962 | 3300027660 | Forest Soil | KKKAVMAIGRQLMVDLWRLQTGRVTAQELNLIMVTD |
| Ga0208981_11006481 | 3300027669 | Forest Soil | NPALKKKAVVAIGRQLMVDLWRLQTGRVTAQELNLVMIGDEGV |
| Ga0208981_11403581 | 3300027669 | Forest Soil | RGTNRALKKKAVVAIGRQLMVDLWRLQTGRVNAQELNLVMIGG |
| Ga0209328_100231601 | 3300027727 | Forest Soil | PQYKPVQKWLEVLRGPNPALKKKAVIAIGRQLIVDLWRLQTGRVTAQELNLIMVTD |
| Ga0209328_102523561 | 3300027727 | Forest Soil | PQYKPVQKWLEVLRGPNPALKKKAVIAIGRQLMVDLWRLQTGRVTAQELNLIMVTD |
| Ga0208989_102039301 | 3300027738 | Forest Soil | KWQEVLRGTNPALKKKAVVAIGRQLMVDLWRLQTGRVTAQELNLVMIGD |
| Ga0209169_105658382 | 3300027879 | Soil | EVLRGSNPASKKKAVVAIGRQLMVDLWRLQTGRVTAQELNLVMVEGPEGV |
| Ga0209068_106792092 | 3300027894 | Watersheds | PALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGV |
| Ga0209526_100129729 | 3300028047 | Forest Soil | EVLRGTNRALKKKAVVAIGRQLMVDLWRLQTGRVSAQELNLVMIEG |
| Ga0137415_107147331 | 3300028536 | Vadose Zone Soil | KKKAVVAIGRQLMVDLWRLQTGRVTAQELNLVMIGD |
| Ga0308309_113863691 | 3300028906 | Soil | KAVVAIGRQLMVDLWRLQTGRVTAQELNLVMVEGPEGV |
| Ga0302194_102651541 | 3300030506 | Bog | GAMRKKAVVAIGRRLAIDLWRIETKRATAEELGLLMLR |
| Ga0265723_10069731 | 3300030872 | Soil | PALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIETSGV |
| Ga0170823_101107351 | 3300031128 | Forest Soil | KKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIDAQGV |
| Ga0170820_112441571 | 3300031446 | Forest Soil | WQEVLRGSNPALKKKAVVAIGRQLMVDLWRLETGRVTAQELNLVMVEA |
| Ga0318516_104564341 | 3300031543 | Soil | KKKAVVAIGRQLMVDLWRMETGRVTAEELNLVMIGA |
| Ga0318541_104015282 | 3300031545 | Soil | KWRAALEGKNAASKKKAVVAIARQLIVDLWRLKTGRVSAQELKLVMVGG |
| Ga0318538_107816951 | 3300031546 | Soil | LEGQNRAHKKKAVVAIGRQLAVDLWRLKTRRVTAQQLKLIMVGGSL |
| Ga0307474_112643441 | 3300031718 | Hardwood Forest Soil | QEVLKGKNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMVDA |
| Ga0307475_100255224 | 3300031754 | Hardwood Forest Soil | WRAVLEGSNRGLKKKAVVAIGRQLMVDLWRLQTGRISAQELNLIMVEG |
| Ga0318554_106135911 | 3300031765 | Soil | WQEVLRGTNGTLKKKAVVAIGRQLMVDLWRMETGRVTAEELNLVMIGA |
| Ga0318526_104305551 | 3300031769 | Soil | LKKKAVVAIGRQLIIDIWRLQTGRISAQELGLIMIEA |
| Ga0318521_102435262 | 3300031770 | Soil | YEPFKKWATHLESKNRALKKKAVVAIGRQLVVDLWRLETGRTSAQQLNLVMVEGQAF |
| Ga0318546_109934451 | 3300031771 | Soil | LKKKAVVAIGRQLIVDLWRLQTGRASAKELNLVMIGG |
| Ga0318546_109954891 | 3300031771 | Soil | THLESKNRALKKKAVVAIGRQLVVDLWRLETGRTSAQQLNLVMVEGQAF |
| Ga0318543_102118501 | 3300031777 | Soil | QEVLGGTNRTLKKKAVVAIGRQLIVDLWRLQTGRASAKELNLVMIGG |
| Ga0318543_104782071 | 3300031777 | Soil | VLEGSNRGLKKKAVVAIGRQLIVDIWRLQTRRICAQELGLIMIEA |
| Ga0318565_105876351 | 3300031799 | Soil | GTNRTLKKKAVVAIGRQLIVDLWRLQTGRASAKELNLVMIGG |
| Ga0310917_108689082 | 3300031833 | Soil | KWQEVLKGSNRGLKKKAVVAIGRQLIVDIWRLQTGQITAQELGLIMIEA |
| Ga0306919_114584861 | 3300031879 | Soil | KVLRGTNRALKKKAVVAIGRQLIVDLWRLQTGRISAQELNLVMIGG |
| Ga0306923_123267561 | 3300031910 | Soil | RALKKKAIVAIGRQLMVDLWRLQTGHISAQELNLVMIGD |
| Ga0310913_109127631 | 3300031945 | Soil | KKKAVVAIGRQLAVDLWRLKTRRVTAQQLKLIMVGGSL |
| Ga0310910_106172563 | 3300031946 | Soil | ALKKKAIVAIGRQLTVDLWRLQTGHISAQELNLVMIDG |
| Ga0306926_108740741 | 3300031954 | Soil | VLRGTNRTLKKKAVVAIGRQLIVDLWRLQTGRASAQQLNPVMIGG |
| Ga0306922_114121281 | 3300032001 | Soil | RAALEGKNAASKKKAVVAIARQLIVDLWRLKTGRVSAKELKLVMVGG |
| Ga0306922_123216951 | 3300032001 | Soil | EVLEGSNPGLKKKAVVAIGRRLMVDIWRLQTGRITAQELGLIMIEA |
| Ga0318563_103837551 | 3300032009 | Soil | VLQGTNRALKKKAVVAIGRQLMVDLWRLQTGRASAQELKLIMIGG |
| Ga0318563_107698401 | 3300032009 | Soil | VQKWREVLEGSNRGLKKKAVVAIGRRLIVDIWRLQTGRISAQELGLIMIEA |
| Ga0318532_103398641 | 3300032051 | Soil | SNRGLKKKAVVAIGRRLIVDIWRLQTGRISAQELGLIMIEA |
| Ga0318533_109009061 | 3300032059 | Soil | GTNKTLKKKAVVAIGRQLIVDLWRLQTGRLSAQELNLVLIGG |
| Ga0318513_105078171 | 3300032065 | Soil | AVQKWRQVLEGSNRGLKKKAVVAIGRQLIVDIWRLQTRRICAQELGLIMIEA |
| Ga0306924_122918321 | 3300032076 | Soil | TNGGLKKKAVVAIGRQLLVDLWRLQTGRISAEALQSV |
| Ga0318525_106662931 | 3300032089 | Soil | PEYKAVQKWREVLEGSNRGLKKKAVVAIGRRLIVDIWRLQTGRISAQELGLIMIEA |
| Ga0307470_112759001 | 3300032174 | Hardwood Forest Soil | KPVQKWQEVLRGSNRGLKKKAVVAIGRQLMVDLWRLQTGRVSAQELNLLMIGG |
| Ga0307471_1028144471 | 3300032180 | Hardwood Forest Soil | NRGLKKKAVVAIGRQLMVDLWRLQTGRVSAQELNLLMIGG |
| Ga0307472_1025308151 | 3300032205 | Hardwood Forest Soil | KWQEVLKGKNPALKKKAVVAIGRQLIVDLWRLETGRVTAQELNLVMIEAEGA |
| Ga0306920_1002019763 | 3300032261 | Soil | TNRALKKKAIVAIGRQLMVDLWRVQTGRISAQELNLVMIGG |
| ⦗Top⦘ |