Metagenome Family F084503

Basic Information
Family ID	F084503
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	42 residues
Representative Sequence	HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD
Number of Associated Samples	99
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.57 %
% of genes near scaffold ends (potentially truncated)	94.64 %
% of genes from short scaffolds (< 2000 bps)	95.54 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Bacteria (96.429 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.500 % of family members)
Environment Ontology (ENVO)	Unclassified (23.214 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (44.643 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF01575	MaoC_dehydratas	28.57
PF00106	adh_short	8.04
PF02515	CoA_transf_3	8.04
PF03401	TctC	4.46
PF13561	adh_short_C2	3.57
PF00857	Isochorismatase	1.79
PF12728	HTH_17	1.79
PF11730	DUF3297	1.79
PF01546	Peptidase_M20	1.79
PF13531	SBP_bac_11	0.89
PF00924	MS_channel	0.89
PF04055	Radical_SAM	0.89
PF07693	KAP_NTPase	0.89
PF01042	Ribonuc_L-PSP	0.89
PF13517	FG-GAP_3	0.89
PF00181	Ribosomal_L2	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	8.04
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	4.46
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	1.79
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.79
COG0090	Ribosomal protein L2	Translation, ribosomal structure and biogenesis [J]	0.89
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.89
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	0.89
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	0.89
COG4928	Predicted P-loop ATPase, KAP-like	General function prediction only [R]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	91.96 %
Unclassified	root	N/A	3.57 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	57.14 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4.46 %
Unclassified	root	N/A	3.57 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	32.14 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.57 %
Unclassified	root	N/A	3.57 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	24.11 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.39 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	8.04 %
Unclassified	root	N/A	3.57 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.79 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.89 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	24.11 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.39 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	8.04 %
Unclassified	root	N/A	3.57 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.79 %
Promicromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae	0.89 %
unclassified Comamonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	24.11 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.39 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	8.04 %
Unclassified	root	N/A	3.57 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.79 %
Antribacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Antribacter	0.89 %
Comamonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	24.11 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.39 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	8.04 %
Unclassified	root	N/A	3.57 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.79 %
unclassified Antribacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Antribacter → unclassified Antribacter	0.89 %
Comamonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	24.11 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.39 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	8.04 %
Unclassified	root	N/A	3.57 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.79 %
Antribacter sp. KLBMP9083	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Antribacter → unclassified Antribacter → Antribacter sp. KLBMP9083	0.89 %
Comamonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000597\|AF_2010_repII_A1DRAFT_10074581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	856	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10095673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	734	Open in IMG/M
3300000816\|AF_2010_repII_A10DRAFT_1020240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	703	Open in IMG/M
3300002245\|JGIcombinedJ26739_101075717	All Organisms → cellular organisms → Bacteria → Proteobacteria	691	Open in IMG/M
3300004267\|Ga0066396_10000394	All Organisms → cellular organisms → Bacteria → Proteobacteria	3149	Open in IMG/M
3300004268\|Ga0066398_10000958	All Organisms → cellular organisms → Bacteria → Proteobacteria	2456	Open in IMG/M
3300004633\|Ga0066395_10190978	All Organisms → cellular organisms → Bacteria → Proteobacteria	1066	Open in IMG/M
3300004633\|Ga0066395_10422158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	755	Open in IMG/M
3300005165\|Ga0066869_10047507	All Organisms → cellular organisms → Bacteria → Proteobacteria	746	Open in IMG/M
3300005563\|Ga0068855_100789544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1010	Open in IMG/M
3300005577\|Ga0068857_100747084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	932	Open in IMG/M
3300005617\|Ga0068859_102270032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	599	Open in IMG/M
3300005764\|Ga0066903_106084219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	632	Open in IMG/M
3300005764\|Ga0066903_108340972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	529	Open in IMG/M
3300005764\|Ga0066903_109034834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	504	Open in IMG/M
3300006176\|Ga0070765_100275814	All Organisms → cellular organisms → Bacteria → Proteobacteria	1548	Open in IMG/M
3300006178\|Ga0075367_10727114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	631	Open in IMG/M
3300006872\|Ga0101947_1038794	Not Available	870	Open in IMG/M
3300006881\|Ga0068865_100119436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1957	Open in IMG/M
3300006903\|Ga0075426_10822519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	699	Open in IMG/M
3300008886\|Ga0115930_1020497	All Organisms → cellular organisms → Bacteria → Proteobacteria	1921	Open in IMG/M
3300009147\|Ga0114129_12010041	All Organisms → cellular organisms → Bacteria → Proteobacteria	699	Open in IMG/M
3300009148\|Ga0105243_12160993	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300009792\|Ga0126374_11239481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	599	Open in IMG/M
3300010358\|Ga0126370_10203204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1499	Open in IMG/M
3300010358\|Ga0126370_10859843	All Organisms → cellular organisms → Bacteria → Proteobacteria	815	Open in IMG/M
3300010359\|Ga0126376_12169683	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300010361\|Ga0126378_13181726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	522	Open in IMG/M
3300010362\|Ga0126377_11407127	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300010362\|Ga0126377_11775704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	692	Open in IMG/M
3300010366\|Ga0126379_10486418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1303	Open in IMG/M
3300010371\|Ga0134125_10781177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1051	Open in IMG/M
3300010373\|Ga0134128_12619086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300010375\|Ga0105239_10779185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1095	Open in IMG/M
3300010376\|Ga0126381_101260124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1068	Open in IMG/M
3300010398\|Ga0126383_12672037	All Organisms → cellular organisms → Bacteria → Proteobacteria	582	Open in IMG/M
3300010400\|Ga0134122_12318511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	583	Open in IMG/M
3300010401\|Ga0134121_10386540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1261	Open in IMG/M
3300010868\|Ga0124844_1101738	All Organisms → cellular organisms → Bacteria → Proteobacteria	1091	Open in IMG/M
3300010868\|Ga0124844_1272390	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300010999\|Ga0138505_100066554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	531	Open in IMG/M
3300012189\|Ga0137388_11162640	All Organisms → cellular organisms → Bacteria → Proteobacteria	709	Open in IMG/M
3300012201\|Ga0137365_10091014	All Organisms → cellular organisms → Bacteria → Proteobacteria	2297	Open in IMG/M
3300012205\|Ga0137362_10279169	All Organisms → cellular organisms → Bacteria → Proteobacteria	1445	Open in IMG/M
3300012211\|Ga0137377_11950524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	504	Open in IMG/M
3300012357\|Ga0137384_10756612	All Organisms → cellular organisms → Bacteria → Proteobacteria	787	Open in IMG/M
3300012469\|Ga0150984_122530955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	788	Open in IMG/M
3300012916\|Ga0157310_10462809	All Organisms → cellular organisms → Bacteria → Proteobacteria	543	Open in IMG/M
3300012960\|Ga0164301_11012186	Not Available	654	Open in IMG/M
3300012961\|Ga0164302_10459551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	887	Open in IMG/M
3300012989\|Ga0164305_11201431	Not Available	657	Open in IMG/M
3300014326\|Ga0157380_10921713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	901	Open in IMG/M
3300014745\|Ga0157377_10139923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1486	Open in IMG/M
3300015357\|Ga0134072_10402911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	540	Open in IMG/M
3300015373\|Ga0132257_103165243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	599	Open in IMG/M
3300015374\|Ga0132255_103506407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300015374\|Ga0132255_105777513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	523	Open in IMG/M
3300016270\|Ga0182036_10166125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1587	Open in IMG/M
3300016270\|Ga0182036_10533537	All Organisms → cellular organisms → Bacteria → Proteobacteria	933	Open in IMG/M
3300016404\|Ga0182037_10326672	All Organisms → cellular organisms → Bacteria → Proteobacteria	1242	Open in IMG/M
3300017792\|Ga0163161_11521480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	588	Open in IMG/M
3300018066\|Ga0184617_1026374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1340	Open in IMG/M
3300018465\|Ga0190269_11189488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598	Open in IMG/M
3300018468\|Ga0066662_10353777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1265	Open in IMG/M
3300019362\|Ga0173479_10843353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	512	Open in IMG/M
3300019867\|Ga0193704_1080677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300021081\|Ga0210379_10428688	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300021560\|Ga0126371_13788948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	510	Open in IMG/M
3300022756\|Ga0222622_10432843	All Organisms → cellular organisms → Bacteria → Proteobacteria	931	Open in IMG/M
3300025901\|Ga0207688_10222138	All Organisms → cellular organisms → Bacteria → Proteobacteria	1138	Open in IMG/M
3300025915\|Ga0207693_10754587	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Antribacter → unclassified Antribacter → Antribacter sp. KLBMP9083	751	Open in IMG/M
3300025923\|Ga0207681_11606245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	544	Open in IMG/M
3300025926\|Ga0207659_11296865	Not Available	625	Open in IMG/M
3300025930\|Ga0207701_10562332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	973	Open in IMG/M
3300025945\|Ga0207679_10664015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	944	Open in IMG/M
3300025972\|Ga0207668_11052361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	728	Open in IMG/M
3300026023\|Ga0207677_10912208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	792	Open in IMG/M
3300026118\|Ga0207675_101859711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	621	Open in IMG/M
3300026295\|Ga0209234_1181267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	734	Open in IMG/M
3300026328\|Ga0209802_1318018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	515	Open in IMG/M
3300027371\|Ga0209418_1075216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	605	Open in IMG/M
3300027866\|Ga0209813_10394682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300027874\|Ga0209465_10246042	All Organisms → cellular organisms → Bacteria → Proteobacteria	894	Open in IMG/M
3300027915\|Ga0209069_10759147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	575	Open in IMG/M
3300028592\|Ga0247822_11183816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	637	Open in IMG/M
3300028755\|Ga0307316_10371696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	527	Open in IMG/M
3300028793\|Ga0307299_10083515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1188	Open in IMG/M
3300028793\|Ga0307299_10255870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	658	Open in IMG/M
3300028885\|Ga0307304_10574935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	520	Open in IMG/M
3300031561\|Ga0318528_10060167	All Organisms → cellular organisms → Bacteria → Proteobacteria	1937	Open in IMG/M
3300031716\|Ga0310813_11088321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	732	Open in IMG/M
3300031716\|Ga0310813_11140139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	716	Open in IMG/M
3300031723\|Ga0318493_10241215	All Organisms → cellular organisms → Bacteria → Proteobacteria	963	Open in IMG/M
3300031751\|Ga0318494_10239224	All Organisms → cellular organisms → Bacteria → Proteobacteria	1040	Open in IMG/M
3300031764\|Ga0318535_10041700	All Organisms → cellular organisms → Bacteria → Proteobacteria	1888	Open in IMG/M
3300031781\|Ga0318547_10177732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1263	Open in IMG/M
3300031782\|Ga0318552_10059732	All Organisms → cellular organisms → Bacteria → Proteobacteria	1824	Open in IMG/M
3300031792\|Ga0318529_10117436	All Organisms → cellular organisms → Bacteria → Proteobacteria	1209	Open in IMG/M
3300031793\|Ga0318548_10258284	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300031832\|Ga0318499_10292905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	629	Open in IMG/M
3300031834\|Ga0315290_11309784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	597	Open in IMG/M
3300031847\|Ga0310907_10599844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium	600	Open in IMG/M
3300031890\|Ga0306925_10275032	All Organisms → cellular organisms → Bacteria → Proteobacteria	1813	Open in IMG/M
3300031942\|Ga0310916_10022855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4456	Open in IMG/M
3300031942\|Ga0310916_11335366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	589	Open in IMG/M
3300031949\|Ga0214473_11844009	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300032052\|Ga0318506_10052548	All Organisms → cellular organisms → Bacteria → Proteobacteria	1648	Open in IMG/M
3300032054\|Ga0318570_10146816	All Organisms → cellular organisms → Bacteria → Proteobacteria	1053	Open in IMG/M
3300032054\|Ga0318570_10543004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	530	Open in IMG/M
3300032075\|Ga0310890_10093022	All Organisms → cellular organisms → Bacteria → Proteobacteria	1867	Open in IMG/M
3300033550\|Ga0247829_10071961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2516	Open in IMG/M
3300034354\|Ga0364943_0262659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	647	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.79%
Host-Associated	Host-Associated	22.32%
Engineered	Engineered	0.89%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	72.32%
Plants	Host-Associated → Plants	21.43%
Aquatic	Environmental → Aquatic	4.46%
Microbial	Host-Associated → Microbial	0.89%
Built Environment	Engineered → Built Environment	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.54%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.82%
Sediment	Environmental → Aquatic → Sediment	2.68%
Freshwater	Environmental → Aquatic → Freshwater	1.79%
Roots	Host-Associated → Plants → Roots	1.79%
Floodplain	Environmental → Terrestrial → Floodplain	0.89%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.89%
Bacteria	Host-Associated → Microbial → Bacteria	0.89%
Unclassified	Engineered → Built Environment → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.04%
Loam	Environmental → Terrestrial → Soil → Loam	12.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.36%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.68%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Lake	Environmental → Aquatic → Freshwater → Lake	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.89%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.89%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified	0.89%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	18.75%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.46%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.68%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.89%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.89%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.89%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified	0.89%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.93%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.68%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.79%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.79%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.79%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.89%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.89%
Micrasterias Crux-Melitensis (Mzch 98) Associated	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.89%
Drinking Water Pipes	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000816	Forest soil microbial communities from Amazon forest - 2010 replicate II A10	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005165	Soil and rhizosphere microbial communities from Laval, Canada - mgHMC	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006872	Biofilm microbial communities from drinking water pipes in Singapore	Engineered	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300008886	Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98)	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300010999	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019867	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300027371	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental	Open in IMG/M
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F084503

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AF_2010_repII_A1DRAFT_100745813	3300000597	Forest Soil	RFKAAGCRRMTFRISTMGDXMAQFRRLVEDVLPYVD*
AF_2010_repII_A1DRAFT_100956731	3300000597	Forest Soil	MARRRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD*
AF_2010_repII_A10DRAFT_10202402	3300000816	Forest Soil	ECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD*
JGIcombinedJ26739_1010757171	3300002245	Forest Soil	HIKLFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD*
Ga0066396_100003942	3300004267	Tropical Forest Soil	MNFGITLSKQIKRYKARRVVGITFWISTMGDQMAQFRRVIEDVLPYLD*
Ga0066398_100009583	3300004268	Tropical Forest Soil	MNFGITLSKQIKRYKARRVVGRITFWISTMGDQMAQFRRVIEDVLPYLD*
Ga0066395_101909782	3300004633	Tropical Forest Soil	MNFGITLSKQIKRYKARRVVGRITFWISTIGDQMAQFRRVIEDVLPYLD*
Ga0066395_104221582	3300004633	Tropical Forest Soil	YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0066869_100475071	3300005165	Soil	CVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0068855_1007895441	3300005563	Corn Rhizosphere	GSPRDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN*
Ga0068857_1007470841	3300005577	Corn Rhizosphere	HLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN*
Ga0068859_1022700322	3300005617	Switchgrass Rhizosphere	HLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVD*
Ga0066903_1060842191	3300005764	Tropical Forest Soil	LQRYAACGCRRITFRISTMGDPMAQFRRLAEEVLPFV*
Ga0066903_1083409721	3300005764	Tropical Forest Soil	CVEHIKRFKAAGCRRITFRISTMGDVMEQFRRLVEEVLPYID*
Ga0066903_1090348342	3300005764	Tropical Forest Soil	ECVEHIKRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD*
Ga0070765_1002758141	3300006176	Soil	ECVEHIKLFKASGCRRITFRISTMGDPMVQFRRLVEDVLPYVD*
Ga0075367_107271142	3300006178	Populus Endosphere	DCIEHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVD*
Ga0101947_10387942	3300006872	Drinking Water Pipes	EDLKKWKAAGCKRLTFRISTMGDPLKQLKRVAEEVLPFV*
Ga0068865_1001194361	3300006881	Miscanthus Rhizosphere	QFKASGCRRITFRISTMGDPMQQFRRVAEEVLPFVD*
Ga0075426_108225192	3300006903	Populus Rhizosphere	PRDCVEQIKRYKASGCRRITFRISTMGDQMAQFRRVIEDVLPYVD*
Ga0115930_10204971	3300008886	Micrasterias Crux-Melitensis (Mzch 98) Associated	HLRQFKNSGCNRVTFRISTMGDPMAVFRRAVEEVLPFV*
Ga0114129_120100412	3300009147	Populus Rhizosphere	FKASGCRRITFRISTMGDPMEQFRRLVEDVLAYVD*
Ga0105243_121609931	3300009148	Miscanthus Rhizosphere	TPRDCIEQLKRYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV*
Ga0126374_112394811	3300009792	Tropical Forest Soil	DCIAHLQQYKASGCRRITFRISTMGDPMAQLRRVTEEVLPFVN*
Ga0126370_102032041	3300010358	Tropical Forest Soil	AHLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0126370_108598432	3300010358	Tropical Forest Soil	YGAPRDCIAQLRAFKSCGCRRITFRIATMGDPMTQLRRLAEEVLPFV*
Ga0126376_121696831	3300010359	Tropical Forest Soil	RDCIEHIRQFRACGCRRITFRISTMRDPLAQFRRLVEDVLPHVG*
Ga0126378_131817261	3300010361	Tropical Forest Soil	KASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD*
Ga0126377_114071273	3300010362	Tropical Forest Soil	PRECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0126377_117757041	3300010362	Tropical Forest Soil	PRDCIAHLQRYAACGCRRITFRISTMGDAMAQLRRLVDEVLPYV*
Ga0126379_104864182	3300010366	Tropical Forest Soil	SPRDCIAHLKQYKASGCRRITFRISTMGDPMAQLRRVTEEVLPFVS*
Ga0134125_107811771	3300010371	Terrestrial Soil	CIEHLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN*
Ga0134128_126190861	3300010373	Terrestrial Soil	LFKASGCRRIIFRISTMGDPMEQFRRIAEEVLPFVV*
Ga0105239_107791852	3300010375	Corn Rhizosphere	LKQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD*
Ga0126381_1012601241	3300010376	Tropical Forest Soil	IKRFKAAGCRRITFRISTMGDVMEQFRRLVEDVLPYVD*
Ga0126383_126720371	3300010398	Tropical Forest Soil	HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0134122_123185112	3300010400	Terrestrial Soil	QFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVE*
Ga0134121_103865401	3300010401	Terrestrial Soil	PRDCIEHLRQYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV*
Ga0124844_11017383	3300010868	Tropical Forest Soil	IRRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD*
Ga0124844_12723901	3300010868	Tropical Forest Soil	RFKVKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD*
Ga0138505_1000665541	3300010999	Soil	PRECIAHLKQFKASGCRRITFRISTMGDPIEQFRRVAEEVLPFVN*
Ga0137388_111626401	3300012189	Vadose Zone Soil	VQIEQLKASGCRRITFRISTMGDPMAQLRRVVDEVLPFVD*
Ga0137365_100910141	3300012201	Vadose Zone Soil	GSPRDCIAHLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0137362_102791691	3300012205	Vadose Zone Soil	WLPYGSPRECVEHIKLFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD*
Ga0137377_119505241	3300012211	Vadose Zone Soil	RFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD*
Ga0137384_107566122	3300012357	Vadose Zone Soil	FKASGCRRITFRISTMGDPMQQFRRVVEDVLPYVD*
Ga0150984_1225309551	3300012469	Avena Fatua Rhizosphere	DCIEHLRQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD*
Ga0157310_104628091	3300012916	Soil	YGSPRDCIEHLKRYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV*
Ga0164301_110121861	3300012960	Soil	ACIEHLKLFQAAGGRRLTFRIPTLGDPMEPFRRIAEEVLPFVV*
Ga0164302_104595511	3300012961	Soil	LKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD*
Ga0164305_112014311	3300012989	Soil	YGSPRDCIEHLKRYKDAGCHRVTFRISTMGDPMAQLKRVTEEVLPFV*
Ga0157380_109217132	3300014326	Switchgrass Rhizosphere	QLKQFKASGSRRITFRISTMGDPMEQFRRLAEEVLPFVD*
Ga0157377_101399231	3300014745	Miscanthus Rhizosphere	RDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN*
Ga0134072_104029111	3300015357	Grasslands Soil	GSPRECVEQIKGYKASGCRRITFRISTMGDQMAQFRRVIEDVLPYVD*
Ga0132257_1031652431	3300015373	Arabidopsis Rhizosphere	RDCIAHLQSFAASGCRRITFRISTMGDPMAQLRRLVEEVLPYV*
Ga0132255_1035064071	3300015374	Arabidopsis Rhizosphere	YGSPRDCIEHLKLFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVE*
Ga0132255_1057775132	3300015374	Arabidopsis Rhizosphere	FAASGCRRITFRISTMGDPMAQLRRLVEEVLPYV*
Ga0182036_101661253	3300016270	Soil	KRFKASGCRRITFRISTMGDPMAQFRRLVEDVLQYVD
Ga0182036_105335371	3300016270	Soil	HIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0182037_103266723	3300016404	Soil	YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQLQRLVEDVLPYVD
Ga0163161_115214801	3300017792	Switchgrass Rhizosphere	HIKRFKASGCRRITFRISTMGDAMEQFRRLVEDVLPYVD
Ga0184617_10263742	3300018066	Groundwater Sediment	YGSPRDCIEHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN
Ga0190269_111894881	3300018465	Soil	DCIEHLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN
Ga0066662_103537773	3300018468	Grasslands Soil	ECVEHIKGFKASGCRRITFRISTMGDPMEQFRRLVEDVLPYVD
Ga0173479_108433532	3300019362	Soil	KQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD
Ga0193704_10806771	3300019867	Soil	AHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN
Ga0210379_104286882	3300021081	Groundwater Sediment	IAQLAQFKASGCRRITFRISTMGDPMAQLRRVVEEVLPGVR
Ga0126371_137889482	3300021560	Tropical Forest Soil	FKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD
Ga0222622_104328431	3300022756	Groundwater Sediment	PRDCIAQLKQFKASGCRRITFRISTMRDPMTQFRRVVDEVLPFV
Ga0207688_102221381	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	KQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD
Ga0207693_107545872	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	VCFAARRDADRDCVAQLQQFKASGCRRITFRISTMRDPIAQLRRVVEEVLPFV
Ga0207681_116062452	3300025923	Switchgrass Rhizosphere	SPRDCIEHLKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD
Ga0207659_112968651	3300025926	Miscanthus Rhizosphere	DCIVHLRRFKESGCNRVTFRISTMGDPMAQLRRVAEEVLPFV
Ga0207701_105623322	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	DCIEQLKRYKEVGCNRVTFRISTMGDPMAQLRRVTEEVLPFV
Ga0207679_106640152	3300025945	Corn Rhizosphere	CIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN
Ga0207668_110523611	3300025972	Switchgrass Rhizosphere	RDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN
Ga0207677_109122082	3300026023	Miscanthus Rhizosphere	KQFKASGCRRITFRISTMGDPMQQFRRVAEEVLPFVD
Ga0207675_1018597111	3300026118	Switchgrass Rhizosphere	SPRDCIEHLKRFKAHGCRRVTFRISTMADPLQQLRRVVEEVLPFV
Ga0209234_11812673	3300026295	Grasslands Soil	HLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD
Ga0209802_13180181	3300026328	Soil	RECVEHIKRFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD
Ga0209418_10752162	3300027371	Forest Soil	LKASGCRRITFRISTMGDAMEQFRRLVEDVLPYVD
Ga0209813_103946822	3300027866	Populus Endosphere	FKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVD
Ga0209465_102460423	3300027874	Tropical Forest Soil	KRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD
Ga0209069_107591471	3300027915	Watersheds	IAHLRQFKACGCRRITFRISTMGDPMAQLRRVTEEVLPFV
Ga0247822_111838162	3300028592	Soil	FKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN
Ga0307316_103716961	3300028755	Soil	IAQLKEFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN
Ga0307299_100835151	3300028793	Soil	AHLKEFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN
Ga0307299_102558701	3300028793	Soil	SWLTYGPPRDCIAQLKQFKASGCRRITFRISTMRDPMTQFRRVVDEVLPFV
Ga0307304_105749351	3300028885	Soil	TYGSPRECIAHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN
Ga0318528_100601674	3300031561	Soil	HIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD
Ga0310813_110883212	3300031716	Soil	EHLRRYKAAGCNRVTFRISTMGDPMAQLKRVTDEVLPFV
Ga0310813_111401391	3300031716	Soil	YGSPRDCIEHLKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD
Ga0318493_102412151	3300031723	Soil	IKRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD
Ga0318494_102392243	3300031751	Soil	TYGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318535_100417004	3300031764	Soil	GSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318547_101777321	3300031781	Soil	CVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318552_100597321	3300031782	Soil	ECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318529_101174363	3300031792	Soil	IKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318548_102582841	3300031793	Soil	YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318499_102929052	3300031832	Soil	RFKAAGCRRITFRISTMGDPIVQFQRLVEDVLPYVD
Ga0315290_113097842	3300031834	Sediment	YGSPRNCIEHLKQFKASGCRRVTFRISTMGDPMAQLRRVVEEVLPFV
Ga0310907_105998442	3300031847	Soil	CIEHLKRFKAHGCRRITFRISTMADPLRQLRRVVEEVLPFV
Ga0306925_102750321	3300031890	Soil	EHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD
Ga0310916_100228551	3300031942	Soil	ECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLQYVD
Ga0310916_113353662	3300031942	Soil	HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD
Ga0214473_118440091	3300031949	Soil	GSPRDCIEHIERFKASGCRRITFRISTMRDPMAQFRRLVEDVLPYVE
Ga0318506_100525484	3300032052	Soil	AWLIHGSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318570_101468161	3300032054	Soil	WLTHGSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD
Ga0318570_105430042	3300032054	Soil	RRFKAAGCRRITFRISTMGDPIVQFQRLVEDVLPYVD
Ga0310890_100930221	3300032075	Soil	LKTYKASGCRRVTFRISTMGDPMAQLRRVTEEVLPFV
Ga0247829_100719611	3300033550	Soil	HLKRYKAHGCRRVTFRISTMGDPMTQLRRVTEEVLPFV
Ga0364943_0262659_506_646	3300034354	Sediment	GSPRDCIEHLKRFKAHGCRRITFRISTMADPLRQLRRVVEEVLPFV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign