Basic Information | |
---|---|
Family ID | F083818 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 43 residues |
Representative Sequence | AIAEQQRSLRGRWGEGTNADTETLRETLRMYKTFLDQLIGPRAS |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.89 % |
% of genes near scaffold ends (potentially truncated) | 99.11 % |
% of genes from short scaffolds (< 2000 bps) | 89.29 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (66.071 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.679 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.429 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01336 | tRNA_anti-codon | 44.64 |
PF14579 | HHH_6 | 20.54 |
PF01844 | HNH | 1.79 |
PF07282 | OrfB_Zn_ribbon | 0.89 |
PF11716 | MDMPI_N | 0.89 |
PF01252 | Peptidase_A8 | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 66.07 % |
All Organisms | root | All Organisms | 33.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004082|Ga0062384_101357081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 522 | Open in IMG/M |
3300004635|Ga0062388_102676464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 525 | Open in IMG/M |
3300005168|Ga0066809_10193417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300005467|Ga0070706_100043476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 4152 | Open in IMG/M |
3300005538|Ga0070731_11187213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300005557|Ga0066704_11019091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 511 | Open in IMG/M |
3300005591|Ga0070761_10550879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 715 | Open in IMG/M |
3300005952|Ga0080026_10164213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 647 | Open in IMG/M |
3300006878|Ga0074061_1094583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 755 | Open in IMG/M |
3300009029|Ga0066793_10694829 | Not Available | 578 | Open in IMG/M |
3300009143|Ga0099792_10354244 | Not Available | 886 | Open in IMG/M |
3300009520|Ga0116214_1023492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2202 | Open in IMG/M |
3300009524|Ga0116225_1546548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
3300009525|Ga0116220_10402357 | Not Available | 612 | Open in IMG/M |
3300009698|Ga0116216_10790630 | Not Available | 569 | Open in IMG/M |
3300009839|Ga0116223_10069198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → environmental samples → uncultured Quadrisphaera sp. | 2267 | Open in IMG/M |
3300010043|Ga0126380_11641655 | Not Available | 575 | Open in IMG/M |
3300010373|Ga0134128_11355853 | Not Available | 784 | Open in IMG/M |
3300010376|Ga0126381_104810601 | Not Available | 519 | Open in IMG/M |
3300010401|Ga0134121_10182249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1807 | Open in IMG/M |
3300010867|Ga0126347_1184999 | Not Available | 714 | Open in IMG/M |
3300010878|Ga0136899_10266638 | Not Available | 652 | Open in IMG/M |
3300011119|Ga0105246_12159133 | Not Available | 541 | Open in IMG/M |
3300012200|Ga0137382_11301202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300012204|Ga0137374_10979635 | Not Available | 613 | Open in IMG/M |
3300012205|Ga0137362_10318830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → environmental samples → uncultured Quadrisphaera sp. | 1346 | Open in IMG/M |
3300012210|Ga0137378_10747304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300012381|Ga0134026_1178467 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012392|Ga0134043_1252271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 789 | Open in IMG/M |
3300012515|Ga0157338_1009769 | Not Available | 956 | Open in IMG/M |
3300013105|Ga0157369_12684093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300013307|Ga0157372_13339270 | Not Available | 511 | Open in IMG/M |
3300014054|Ga0120135_1102946 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300014157|Ga0134078_10138090 | Not Available | 948 | Open in IMG/M |
3300015372|Ga0132256_100603609 | Not Available | 1212 | Open in IMG/M |
3300017821|Ga0187812_1233516 | Not Available | 586 | Open in IMG/M |
3300017822|Ga0187802_10005106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3941 | Open in IMG/M |
3300017924|Ga0187820_1045235 | Not Available | 1179 | Open in IMG/M |
3300017959|Ga0187779_10394725 | Not Available | 901 | Open in IMG/M |
3300017970|Ga0187783_11342442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300017975|Ga0187782_10786163 | Not Available | 736 | Open in IMG/M |
3300018029|Ga0187787_10369143 | Not Available | 558 | Open in IMG/M |
3300018035|Ga0187875_10142153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300018035|Ga0187875_10335812 | Not Available | 814 | Open in IMG/M |
3300018043|Ga0187887_10040621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2888 | Open in IMG/M |
3300018057|Ga0187858_10412501 | Not Available | 837 | Open in IMG/M |
3300018090|Ga0187770_11137781 | Not Available | 630 | Open in IMG/M |
3300019875|Ga0193701_1043072 | Not Available | 921 | Open in IMG/M |
3300020070|Ga0206356_11008464 | Not Available | 584 | Open in IMG/M |
3300021171|Ga0210405_11231780 | Not Available | 553 | Open in IMG/M |
3300021181|Ga0210388_10350425 | Not Available | 1298 | Open in IMG/M |
3300021374|Ga0213881_10292613 | Not Available | 726 | Open in IMG/M |
3300021402|Ga0210385_10030237 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
3300021404|Ga0210389_10885337 | Not Available | 695 | Open in IMG/M |
3300021407|Ga0210383_10571050 | Not Available | 975 | Open in IMG/M |
3300021433|Ga0210391_10564666 | Not Available | 893 | Open in IMG/M |
3300021475|Ga0210392_10939875 | Not Available | 647 | Open in IMG/M |
3300021478|Ga0210402_10856770 | Not Available | 835 | Open in IMG/M |
3300022467|Ga0224712_10620733 | Not Available | 529 | Open in IMG/M |
3300022530|Ga0242658_1148028 | Not Available | 603 | Open in IMG/M |
3300022724|Ga0242665_10348600 | Not Available | 530 | Open in IMG/M |
3300024227|Ga0228598_1068816 | Not Available | 707 | Open in IMG/M |
3300024271|Ga0224564_1121182 | Not Available | 536 | Open in IMG/M |
3300025905|Ga0207685_10502508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300025910|Ga0207684_10380612 | Not Available | 1214 | Open in IMG/M |
3300025921|Ga0207652_10517561 | Not Available | 1073 | Open in IMG/M |
3300025929|Ga0207664_10102608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. MW-13 | 2365 | Open in IMG/M |
3300025931|Ga0207644_10208946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1542 | Open in IMG/M |
3300026340|Ga0257162_1055154 | Not Available | 508 | Open in IMG/M |
3300026984|Ga0208732_1000479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter vulgaris | 2350 | Open in IMG/M |
3300027002|Ga0209110_1051632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300027173|Ga0208097_1013446 | Not Available | 901 | Open in IMG/M |
3300027371|Ga0209418_1047259 | Not Available | 763 | Open in IMG/M |
3300027545|Ga0209008_1057853 | Not Available | 880 | Open in IMG/M |
3300027725|Ga0209178_1274659 | Not Available | 615 | Open in IMG/M |
3300027915|Ga0209069_10847333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300028775|Ga0302231_10417577 | Not Available | 566 | Open in IMG/M |
3300028795|Ga0302227_10278550 | Not Available | 638 | Open in IMG/M |
3300029701|Ga0222748_1111789 | Not Available | 543 | Open in IMG/M |
3300029951|Ga0311371_10223529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2757 | Open in IMG/M |
3300030054|Ga0302182_10124054 | Not Available | 1126 | Open in IMG/M |
3300030503|Ga0311370_10232194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → environmental samples → uncultured Quadrisphaera sp. | 2449 | Open in IMG/M |
3300030520|Ga0311372_12238508 | Not Available | 627 | Open in IMG/M |
3300030677|Ga0302317_10298961 | Not Available | 721 | Open in IMG/M |
3300030738|Ga0265462_10568974 | Not Available | 849 | Open in IMG/M |
3300031226|Ga0307497_10709453 | Not Available | 520 | Open in IMG/M |
3300031231|Ga0170824_111909810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300031231|Ga0170824_111914199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300031544|Ga0318534_10777705 | Not Available | 538 | Open in IMG/M |
3300031572|Ga0318515_10471516 | Not Available | 671 | Open in IMG/M |
3300031573|Ga0310915_10285374 | Not Available | 1165 | Open in IMG/M |
3300031681|Ga0318572_10472960 | Not Available | 746 | Open in IMG/M |
3300031713|Ga0318496_10009588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4515 | Open in IMG/M |
3300031713|Ga0318496_10259040 | Not Available | 959 | Open in IMG/M |
3300031751|Ga0318494_10675578 | Not Available | 604 | Open in IMG/M |
3300031763|Ga0318537_10118356 | Not Available | 984 | Open in IMG/M |
3300031768|Ga0318509_10302531 | Not Available | 895 | Open in IMG/M |
3300031769|Ga0318526_10056347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1510 | Open in IMG/M |
3300031782|Ga0318552_10398483 | Not Available | 702 | Open in IMG/M |
3300031793|Ga0318548_10644552 | Not Available | 514 | Open in IMG/M |
3300031799|Ga0318565_10272971 | Not Available | 822 | Open in IMG/M |
3300031845|Ga0318511_10160680 | Not Available | 986 | Open in IMG/M |
3300031962|Ga0307479_10506417 | Not Available | 1191 | Open in IMG/M |
3300032054|Ga0318570_10576751 | Not Available | 513 | Open in IMG/M |
3300032059|Ga0318533_11204074 | Not Available | 554 | Open in IMG/M |
3300032515|Ga0348332_14583369 | Not Available | 656 | Open in IMG/M |
3300032828|Ga0335080_11264141 | Not Available | 739 | Open in IMG/M |
3300032897|Ga0335071_11810030 | Not Available | 554 | Open in IMG/M |
3300032898|Ga0335072_10969655 | Not Available | 785 | Open in IMG/M |
3300032954|Ga0335083_11066743 | Not Available | 632 | Open in IMG/M |
3300033134|Ga0335073_10180702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2640 | Open in IMG/M |
3300033290|Ga0318519_10431750 | Not Available | 787 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.68% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.46% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.79% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006878 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010878 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062384_1013570811 | 3300004082 | Bog Forest Soil | AIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTS* |
Ga0062388_1026764642 | 3300004635 | Bog Forest Soil | RAIQERASALRGRWGEGSNADTETLRETLRMYKSFMDQLVGPAS* |
Ga0066809_101934171 | 3300005168 | Soil | AIAEQQRSLRGRWGEDSNADTEALRETLRMYKTFLDQLIGSRAS* |
Ga0070706_1000434763 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPTS* |
Ga0070731_111872131 | 3300005538 | Surface Soil | SLRDRWGEGNNADTENLRATLRMYKTFLDQLIGSRATS* |
Ga0066704_110190911 | 3300005557 | Soil | TLRDQWGEGSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0070761_105508792 | 3300005591 | Soil | SALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTP* |
Ga0080026_101642132 | 3300005952 | Permafrost Soil | RAIAARQQAIQERQRSLQDRWGEGTQADTETLRETLRMYRAFLDQLIGPKA* |
Ga0074061_10945832 | 3300006878 | Soil | QQAIAEQQRSLRGRWGEGSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0066793_106948291 | 3300009029 | Prmafrost Soil | AIQERQRSLRGRWGEGTQADTETLRETLRMYRAFLNQLIGPKA* |
Ga0099792_103542442 | 3300009143 | Vadose Zone Soil | IAEQQRSLRGRWGAGTNADTETLRATLRMYKTFLDQLIGPRAS* |
Ga0116214_10234921 | 3300009520 | Peatlands Soil | AERQRGLRGRWDTTSAADTETLRETLRMYRTFLDQLIGPEPS* |
Ga0116225_15465481 | 3300009524 | Peatlands Soil | QQRAIQQQQRSLRGRWGEGTNADTEALRETLRMYRTFLDQLIGPRATADAGRTD* |
Ga0116220_104023571 | 3300009525 | Peatlands Soil | RSLRDRWGEGTNADTEGLRETLRMYRTFIDQLIGSRAG* |
Ga0116216_107906302 | 3300009698 | Peatlands Soil | EERQRAIAEQQRSLRDRWDEGTNADTEGLRETLRMYRTFIDQLIGSRAG* |
Ga0116223_100691981 | 3300009839 | Peatlands Soil | QRGLRGRWDSTAAADTETLRETLRMYRTFLDQLIGPEPS* |
Ga0126380_116416551 | 3300010043 | Tropical Forest Soil | EQQRALRGRWGEGTNADTETLRETLRMYKTFLDQLIGPRAS* |
Ga0134128_113558531 | 3300010373 | Terrestrial Soil | RAIEERQQAIAEQQRSLRGRWGGDSNADTENLRETLRMYKTFLDQLIGPRA* |
Ga0126381_1048106011 | 3300010376 | Tropical Forest Soil | ALRGRWGEGTNADTETLRETLRMYKTFLDQLIGPRAS* |
Ga0134121_101822491 | 3300010401 | Terrestrial Soil | GEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0126347_11849991 | 3300010867 | Boreal Forest Soil | ASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPTS* |
Ga0136899_102666381 | 3300010878 | Soil | RAIQERASALRGRWGEGSNADTETLRETLRMYKAFMDQLVGPSS* |
Ga0105246_121591332 | 3300011119 | Miscanthus Rhizosphere | LRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0137382_113012021 | 3300012200 | Vadose Zone Soil | RQRAIAEQQRTLRDQWGEGSNADTEALRATLRMYKTFLDQLIGPRAS* |
Ga0137374_109796352 | 3300012204 | Vadose Zone Soil | QQRSLRGRWGEGTNADTEALRETLRMYKTFLNQLIGSRTSSAG* |
Ga0137362_103188302 | 3300012205 | Vadose Zone Soil | QRTLRDQWGEGSNADTEALRATLRMYKTFLDQLIGPRAS* |
Ga0137378_107473041 | 3300012210 | Vadose Zone Soil | RQRAIAEQQRSLRDQWGEGSNADTEALRATLRMYKTFLDQLIGPRAS* |
Ga0134026_11784673 | 3300012381 | Grasslands Soil | AEQQRSLRGRWGEDTNADTENLRETLRMYKTFLDQLIGPRAS* |
Ga0134043_12522712 | 3300012392 | Grasslands Soil | EERQRAIAEQQRTLRDQWGEGSNADTENLRATLRMYKTFLDQLIGSRTSSAS* |
Ga0157338_10097691 | 3300012515 | Arabidopsis Rhizosphere | LRDRWGEGSNADTENLRATLRMYKTFLDQLIGPRAG* |
Ga0157369_126840931 | 3300013105 | Corn Rhizosphere | EERQQAIAEQQRSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0157372_133392702 | 3300013307 | Corn Rhizosphere | ERQQAIAEQQRSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0120135_11029461 | 3300014054 | Permafrost | QKAIAEQQRSLRDRWGEGNNADTENLRATLRMYKTFLDQLIGAKATS* |
Ga0134078_101380902 | 3300014157 | Grasslands Soil | EQQRSLRGRWGEDSNADTEALRETLRMYKTFLDQLIGSRTSNVS* |
Ga0132256_1006036091 | 3300015372 | Arabidopsis Rhizosphere | RSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS* |
Ga0187812_12335162 | 3300017821 | Freshwater Sediment | AIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPTA |
Ga0187802_100051061 | 3300017822 | Freshwater Sediment | QRGLRGRWDTTSAADTETLRETLRMYRTFLDQLIGPEPS |
Ga0187820_10452351 | 3300017924 | Freshwater Sediment | QGLIAERQRSLRGRWGEGTNADTETLRETLQMYRAFLDQLTGAR |
Ga0187779_103947251 | 3300017959 | Tropical Peatland | AIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPAA |
Ga0187783_113424421 | 3300017970 | Tropical Peatland | ERQRAIAEQQRSLRGRWGEGTDTDTEALRETLRMYRTFLDQLIGPRA |
Ga0187782_107861632 | 3300017975 | Tropical Peatland | DLRGRWDTGAPADTETLRETLRMYRSFLDQLIGPEPS |
Ga0187787_103691432 | 3300018029 | Tropical Peatland | RTLRGRWGDGANADTEALRETLRMYKTFLDQLIGPRAG |
Ga0187875_101421531 | 3300018035 | Peatland | NRQRSLRDRWGEGSEADTETLRETLRMYRAFLDQLIGPKA |
Ga0187875_103358121 | 3300018035 | Peatland | RQRSLRDRWGEGSEADTETLRETLRMYRAFLDQLVGPKV |
Ga0187887_100406211 | 3300018043 | Peatland | QRSLRGRWGEGTEADKETLRETLRMYRAFLDQLIGPKA |
Ga0187858_104125011 | 3300018057 | Peatland | ERQQAIAERQRSLRGRWGEGAEADTETLRETLRMYRAFLDQLIGPKA |
Ga0187770_111377812 | 3300018090 | Tropical Peatland | GLRGRWDTTSAADTETLRETLRMYRTFLDQLIGPEPS |
Ga0193701_10430722 | 3300019875 | Soil | AIAEQQRSLRGRWGEGSNADTENLRETLRMYKTFLDQLIGSRTSSAS |
Ga0206356_110084641 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ERQQAIAEQQRSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS |
Ga0210405_112317802 | 3300021171 | Soil | ERQRGLRGRWDTTSAADTETLRETLRMYRTFLDQLIGPEPS |
Ga0210388_103504251 | 3300021181 | Soil | AIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTP |
Ga0213881_102926132 | 3300021374 | Exposed Rock | LRGRWGEGTNADTEALRETLRLYKTFLDQLIGSRVS |
Ga0210385_100302372 | 3300021402 | Soil | RASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTP |
Ga0210389_108853371 | 3300021404 | Soil | NSLRGRWGEGSNADTENLRETLRMYKTFLDQLIGSRTS |
Ga0210383_105710502 | 3300021407 | Soil | DRQHAIAEQQRSLRGRWGEGTNADTEALRETLRMYKTFLDQLIGPRAS |
Ga0210391_105646662 | 3300021433 | Soil | RSLRGRWDGGTQADTEVLRETLRMYRAFLYQLIGSSGTSGS |
Ga0210392_109398752 | 3300021475 | Soil | SLRGRWGEGSNADTENLRETLRMYKTFLDQLIGSRTS |
Ga0210402_108567702 | 3300021478 | Soil | IAEQQRSLRGRWGEGSNADTESMRETLRMYKTFLDQLIGPRAG |
Ga0224712_106207331 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | EQQRSLRDRWGEGSNADTENLRATLRMYKTFLDQLIGPRA |
Ga0242658_11480281 | 3300022530 | Soil | QERQQAIAEQQRSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSAAS |
Ga0242665_103486002 | 3300022724 | Soil | QRTLRDRWGEGSNADTEALRATLRMYKTFLDQLIGPRAS |
Ga0228598_10688161 | 3300024227 | Rhizosphere | RQRAIQERASALRGRWGEGSNADTETLRETLRMYRAFMVQLIGRTS |
Ga0224564_11211821 | 3300024271 | Soil | QERQRSLHDRWGGGSEADTETLRETLRMYRAFLDQLIGSKA |
Ga0207685_105025082 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RAIEERQRAIAEQQRSLRDRWGEGSNADTENLRATLRMYKTFLDQLIGPRA |
Ga0207684_103806121 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPTS |
Ga0207652_105175612 | 3300025921 | Corn Rhizosphere | IAEQQRSLRGRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS |
Ga0207664_101026081 | 3300025929 | Agricultural Soil | QQRTLRDQWGEGSNADTENLRATLRMYKTFLDQLIGSRTSSAS |
Ga0207644_102089462 | 3300025931 | Switchgrass Rhizosphere | GRWGEDSNADTENLRETLRMYKTFLDQLIGSRTSSAS |
Ga0257162_10551541 | 3300026340 | Soil | AEQQRSLRGRWGEDSNADTEVLRETLRMYKTFLDQLIGSRAS |
Ga0208732_10004791 | 3300026984 | Forest Soil | QHAIAEQQRSLRGRWGEGTNADTEALRETLRMYKTFLDQLIGPRAS |
Ga0209110_10516322 | 3300027002 | Forest Soil | QERASALRGRWGEGSNADTETLRETLRMYKAFMDQLVGPSS |
Ga0208097_10134461 | 3300027173 | Forest Soil | IAERQQSLRGRWGDGTNADTETLRATLLMYRAFLDQLTGPRIS |
Ga0209418_10472591 | 3300027371 | Forest Soil | IEERQHAIAEQQRSLRGRWGEGSNADTETLRETLRMYKTFLDQLIGPRAS |
Ga0209008_10578532 | 3300027545 | Forest Soil | AIEERKQAIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTS |
Ga0209178_12746592 | 3300027725 | Agricultural Soil | LRDRWGEGSNADTENLRATLRMYKTFLDQLIGPRA |
Ga0209069_108473332 | 3300027915 | Watersheds | MRPGSTPDPWGEGTNADTEALRETLRMYRTFLDQLIGPRAG |
Ga0302231_104175771 | 3300028775 | Palsa | ERAGALRGRWGEGSNADTETLRETLRMYRAFMDQLIGPAA |
Ga0302227_102785502 | 3300028795 | Palsa | ERQQAIQDRQRSLRGRWGEGAEADTETLRETLRMYRAFLDQLIGPKV |
Ga0222748_11117892 | 3300029701 | Soil | RAIEERQHAIAEQQRSLRGRWGEGTNADTEALRETLRMYKTFLDQLIGARAS |
Ga0311371_102235291 | 3300029951 | Palsa | QRSLRGRWGEGAEADTETLRETLRMYRAFLDQLIGPKV |
Ga0302182_101240542 | 3300030054 | Palsa | SLRGRWGEGAEADTETLRETLRMYRAFLDQLIGPKV |
Ga0311370_102321942 | 3300030503 | Palsa | IQEQQTSLRGRWGEGSEADTETLRATLRMYKAFLDQLVGPKA |
Ga0311372_122385081 | 3300030520 | Palsa | RSLRGRWGEGSEADTETLRETLRMYRAFLDQLIGSKA |
Ga0302317_102989612 | 3300030677 | Palsa | AIQERQRSLRGRWGEGAEADTETLRETLRMYRAFLDQLIGPKA |
Ga0265462_105689741 | 3300030738 | Soil | ERQRGLRGRWDSTSAADTETLRETLRMYRTFLDQLIGPEPS |
Ga0307497_107094531 | 3300031226 | Soil | SLRGRWGEGSNADTEALRETLRMYKTFLDQLIGPRAS |
Ga0170824_1119098102 | 3300031231 | Forest Soil | AIAEQQRTLRDQWGEGSNADTENLRETLRMYKTFLDQLIGPRASSR |
Ga0170824_1119141992 | 3300031231 | Forest Soil | AIAEQQRTLRDQWGEGSNADTENLRETLRMYKTFLDQLIGQRVS |
Ga0318534_107777051 | 3300031544 | Soil | AEQQRALRGRWGEGANADTETLRQTLRMYKTFLDQLIGPRASRR |
Ga0318515_104715161 | 3300031572 | Soil | HAIAEQQRSLRGRWGEGTHADTETLRETLRMYKTFLDQLIGSRVS |
Ga0310915_102853741 | 3300031573 | Soil | QRSLRARWSEGARADTETLRATLLTYRAFLDQLTGAR |
Ga0318572_104729602 | 3300031681 | Soil | QRAIAEQQRSLRGRWGEGTNADTEALRETLRMYKTFLDQLIGPRAS |
Ga0318496_100095883 | 3300031713 | Soil | RWGEGANADTETLRQTLRMYKTFLDQLIGPRASRR |
Ga0318496_102590402 | 3300031713 | Soil | AIAEQQRSLRGRWGEGTNADTETLRETLRMYKTFLDQLIGPRAS |
Ga0318494_106755781 | 3300031751 | Soil | IQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLVGPTA |
Ga0318537_101183561 | 3300031763 | Soil | QRAIAEQQRSLRGRWGEGTNADTETLRETLRMYKTFLDQLIGSRAS |
Ga0318509_103025311 | 3300031768 | Soil | AIAEQQRTLRDRWGQGTNADTETLRETLRMYKTFLDQLIGSRAG |
Ga0318526_100563471 | 3300031769 | Soil | RGRWGEGANADTETLRQTLRMYKTFLDQLIGPRASRR |
Ga0318552_103984832 | 3300031782 | Soil | EQQRALRGRWGEGANADTETLRQTLRMYKTFLDQLIGPRASRR |
Ga0318548_106445521 | 3300031793 | Soil | GAIQERQRAIAEQQRSLRGRWGEGTNADTETLRETLRMYKTFLDQLIGSRAS |
Ga0318565_102729711 | 3300031799 | Soil | IAEQQRTLRDRWGQGTNADTETLRETLRMYKTFLDQLIGSRAG |
Ga0318511_101606802 | 3300031845 | Soil | ERQRSLRGRWAEGSNADTEALRETLLMYKSFLDQLIGPGRAS |
Ga0307479_105064171 | 3300031962 | Hardwood Forest Soil | RAIEERQQAIQERASALRGRWGEGSNADTETLRETLRMYRAFMDQLIGSTS |
Ga0318570_105767512 | 3300032054 | Soil | LRGRWGEGTNADTETLRETLRMYKTFLDQLIGSRAS |
Ga0318533_112040742 | 3300032059 | Soil | LSLRGRWGEGTNADTETLRETLRMYKTFLDQLIGPRAS |
Ga0348332_145833692 | 3300032515 | Plant Litter | QRSLRDRWGEGSQADTETLRETLRMYRAFLDQLIGPKA |
Ga0335080_112641412 | 3300032828 | Soil | AIQERQRAIQERASALRGRWGEGSNADTEMLRETLRMYRAFIDQLVRPAS |
Ga0335071_118100301 | 3300032897 | Soil | QQQRSLRGRWSEGTNADTENLRETLRMYKTFLDQLIGPRAS |
Ga0335072_109696552 | 3300032898 | Soil | HAIAEQQRSLRGRWGEDSNADTEALRETLRMYKTFLDQLIGSRTS |
Ga0335083_110667431 | 3300032954 | Soil | RQHAIAEQQRSLRGRWGEGSNADTETLRETLRMYKTFLDQLIGPRAS |
Ga0335073_101807021 | 3300033134 | Soil | QEQQRSLRGRWGEDSNADTEALRETLRMYKTFLDQLIGSRTADVS |
Ga0318519_104317501 | 3300033290 | Soil | AIAEHQHTLPGRWGEVTNADTETLRETLRMYKTFLDQLIGPRAS |
⦗Top⦘ |