| Basic Information | |
|---|---|
| Family ID | F083727 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MHGQQTMKYLNDKAVADAIMAKHQKDQINPEFQKAVEEALAAKVKNITE |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 81.25 % |
| % of genes near scaffold ends (potentially truncated) | 27.68 % |
| % of genes from short scaffolds (< 2000 bps) | 66.96 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.893 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.65% β-sheet: 0.00% Coil/Unstructured: 49.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13946 | DUF4214 | 5.36 |
| PF00959 | Phage_lysozyme | 2.68 |
| PF00476 | DNA_pol_A | 2.68 |
| PF00166 | Cpn10 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.68 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.36 % |
| Unclassified | root | N/A | 19.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002091|JGI24028J26656_1001059 | All Organisms → cellular organisms → Bacteria | 6709 | Open in IMG/M |
| 3300002091|JGI24028J26656_1016128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300002092|JGI24218J26658_1002004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5577 | Open in IMG/M |
| 3300002098|JGI24219J26650_1029768 | Not Available | 674 | Open in IMG/M |
| 3300002408|B570J29032_109315938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300002933|G310J44882_10000836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14510 | Open in IMG/M |
| 3300002933|G310J44882_10029461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
| 3300002933|G310J44882_10037794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300002933|G310J44882_10055883 | Not Available | 869 | Open in IMG/M |
| 3300003277|JGI25908J49247_10037966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300003375|JGI26470J50227_1000191 | All Organisms → cellular organisms → Bacteria | 27941 | Open in IMG/M |
| 3300003375|JGI26470J50227_1001891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7078 | Open in IMG/M |
| 3300003375|JGI26470J50227_1002405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6043 | Open in IMG/M |
| 3300003375|JGI26470J50227_1032846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300003787|Ga0007811_1010568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300003804|Ga0007817_1001340 | Not Available | 2060 | Open in IMG/M |
| 3300003814|Ga0007877_1011539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300003852|Ga0031655_10106484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300003852|Ga0031655_10250716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300003852|Ga0031655_10251200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300003852|Ga0031655_10285991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300004481|Ga0069718_15084366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
| 3300004684|Ga0065168_1001327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4126 | Open in IMG/M |
| 3300004805|Ga0007792_10039975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
| 3300004807|Ga0007809_10005243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4979 | Open in IMG/M |
| 3300004807|Ga0007809_10008952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3698 | Open in IMG/M |
| 3300004807|Ga0007809_10021009 | Not Available | 2289 | Open in IMG/M |
| 3300005662|Ga0078894_10814142 | Not Available | 816 | Open in IMG/M |
| 3300005805|Ga0079957_1343554 | Not Available | 657 | Open in IMG/M |
| 3300006071|Ga0007876_1010520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2664 | Open in IMG/M |
| 3300006072|Ga0007881_1060373 | Not Available | 976 | Open in IMG/M |
| 3300006105|Ga0007819_1004750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3774 | Open in IMG/M |
| 3300006109|Ga0007870_1109059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300006116|Ga0007807_1099961 | Not Available | 533 | Open in IMG/M |
| 3300006125|Ga0007825_1011193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1969 | Open in IMG/M |
| 3300007542|Ga0099846_1306051 | Not Available | 544 | Open in IMG/M |
| 3300008107|Ga0114340_1194935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300008108|Ga0114341_10271041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter paneuropaeus | 901 | Open in IMG/M |
| 3300008110|Ga0114343_1190374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300008113|Ga0114346_1022463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3380 | Open in IMG/M |
| 3300008267|Ga0114364_1011399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7926 | Open in IMG/M |
| 3300009009|Ga0105105_10990729 | Not Available | 521 | Open in IMG/M |
| 3300009082|Ga0105099_10345800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300009154|Ga0114963_10020181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4447 | Open in IMG/M |
| 3300009165|Ga0105102_10594047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300009169|Ga0105097_10564580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300009182|Ga0114959_10026960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3551 | Open in IMG/M |
| 3300009183|Ga0114974_10017560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5091 | Open in IMG/M |
| 3300009183|Ga0114974_10356274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300009184|Ga0114976_10022775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3810 | Open in IMG/M |
| 3300009502|Ga0114951_10096438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1689 | Open in IMG/M |
| 3300010158|Ga0114960_10225308 | Not Available | 967 | Open in IMG/M |
| 3300010885|Ga0133913_11541355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1681 | Open in IMG/M |
| 3300011184|Ga0136709_1024658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300020048|Ga0207193_1190496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1639 | Open in IMG/M |
| 3300020706|Ga0214217_1019466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300020710|Ga0214198_1022722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300020726|Ga0214220_1001440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5863 | Open in IMG/M |
| 3300020731|Ga0214170_1049816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300020735|Ga0214219_1010356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1843 | Open in IMG/M |
| 3300021131|Ga0214206_1000623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9273 | Open in IMG/M |
| 3300021139|Ga0214166_1056877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300021354|Ga0194047_10058230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300021961|Ga0222714_10542412 | Not Available | 590 | Open in IMG/M |
| 3300022179|Ga0181353_1063343 | Not Available | 954 | Open in IMG/M |
| 3300022200|Ga0196901_1183395 | Not Available | 680 | Open in IMG/M |
| 3300022591|Ga0236341_1000302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31515 | Open in IMG/M |
| 3300022591|Ga0236341_1003943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6827 | Open in IMG/M |
| 3300022594|Ga0236340_1008365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3424 | Open in IMG/M |
| 3300022594|Ga0236340_1064531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300023174|Ga0214921_10006173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16553 | Open in IMG/M |
| 3300023174|Ga0214921_10213692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
| 3300023311|Ga0256681_10095935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2320 | Open in IMG/M |
| 3300023311|Ga0256681_10615884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2239 | Open in IMG/M |
| 3300025075|Ga0209615_100763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2625 | Open in IMG/M |
| 3300025379|Ga0208738_1001276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5721 | Open in IMG/M |
| 3300025379|Ga0208738_1019324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300025389|Ga0208257_1001638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5237 | Open in IMG/M |
| 3300025407|Ga0208378_1069958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300025417|Ga0208616_1001313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5465 | Open in IMG/M |
| 3300025430|Ga0208622_1087080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300025450|Ga0208744_1010319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2096 | Open in IMG/M |
| 3300025598|Ga0208379_1151024 | Not Available | 524 | Open in IMG/M |
| 3300025648|Ga0208507_1131360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300027693|Ga0209704_1230312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300027708|Ga0209188_1004028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9823 | Open in IMG/M |
| 3300027708|Ga0209188_1146329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300027759|Ga0209296_1186420 | Not Available | 900 | Open in IMG/M |
| 3300027759|Ga0209296_1261586 | Not Available | 706 | Open in IMG/M |
| 3300027769|Ga0209770_10175490 | Not Available | 855 | Open in IMG/M |
| 3300027785|Ga0209246_10069739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
| 3300027785|Ga0209246_10168786 | Not Available | 859 | Open in IMG/M |
| 3300027792|Ga0209287_10226589 | Not Available | 714 | Open in IMG/M |
| 3300027805|Ga0209229_10486273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300027896|Ga0209777_10060669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3366 | Open in IMG/M |
| 3300027896|Ga0209777_10172150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300027896|Ga0209777_10253804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
| 3300027896|Ga0209777_10327206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
| 3300027896|Ga0209777_10662822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027896|Ga0209777_10665150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300027896|Ga0209777_10796137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 664 | Open in IMG/M |
| 3300027896|Ga0209777_10929981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1092187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. KIM | 1349 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1001024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 61329 | Open in IMG/M |
| 3300031759|Ga0316219_1050254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1716 | Open in IMG/M |
| 3300031813|Ga0316217_10017195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5388 | Open in IMG/M |
| 3300031885|Ga0315285_10000300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 50181 | Open in IMG/M |
| 3300031951|Ga0315904_11481150 | Not Available | 501 | Open in IMG/M |
| 3300032092|Ga0315905_11092615 | Not Available | 662 | Open in IMG/M |
| 3300032665|Ga0316221_1058805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
| 3300032675|Ga0316225_1072676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300034101|Ga0335027_0291609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 25.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 10.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 9.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.46% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.57% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 3.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.79% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.79% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.89% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003814 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006125 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020706 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24028J26656_10010591 | 3300002091 | Lentic | MHGQQTMKYLNDKAVADAIVARNKDTQKIDPAFAKAVEEALAAKAKNI |
| JGI24028J26656_10161283 | 3300002091 | Lentic | MHGQQTMKYLNDKAVADAIVARNKDTQKIDPAFAKAV |
| JGI24218J26658_10020046 | 3300002092 | Lentic | MHGQQTMKYLNDKAVADAIVARNKDTQKIDPAFAKAVE |
| JGI24219J26650_10297682 | 3300002098 | Lentic | MHGQQTMKYLNDKAVAEAILAKNKDHLVDPVFMKAVEEALAARVKNITE* |
| B570J29032_1093159382 | 3300002408 | Freshwater | MHGQPTLNYLNDKAVAEAIMAKHKANAEAVSPAFQKAVEEALTAEAKTTATN* |
| G310J44882_100008363 | 3300002933 | Freshwater | MHGLQTMKYLNEQAAAEAILAKHDKDEVNPAFQKAVEEALAARAKNITE* |
| G310J44882_100294613 | 3300002933 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK* |
| G310J44882_100377943 | 3300002933 | Freshwater | MHGQQTMKYLNDKAVADAMLIKHQKDQIDPVFXKAAEEAIAARVKNITE* |
| G310J44882_100558831 | 3300002933 | Freshwater | IMHGQQTMKYLNDKAVADAMLIKHQKDQIDPVFAKAAEEAIAARVKNITE* |
| JGI25908J49247_100379662 | 3300003277 | Freshwater Lake | MHGQQTMKYLNDKAVADAILANRKIDTNAVSPAFQKVVEEALAARAAVSK* |
| JGI26470J50227_100019115 | 3300003375 | Freshwater | MHGLQTMKYLNEQAAAQAILAKHEKVEIDPAFEKAVQEALAAKAKSIAE* |
| JGI26470J50227_10018919 | 3300003375 | Freshwater | MHGQQTMKYLNDKAVADAILAKRKTDENTISPEFKKAVEEALAAKAKTAK* |
| JGI26470J50227_10024053 | 3300003375 | Freshwater | MHGQQTMKYLNDKAVSDAMLAKHQKDQIDPVFAKAAEEAIAARVKNITE* |
| JGI26470J50227_10328461 | 3300003375 | Freshwater | YLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKVKAAK* |
| Ga0007811_10105682 | 3300003787 | Freshwater | MHGQQTIKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK* |
| Ga0007817_10013403 | 3300003804 | Freshwater | YRYRYQHKGNIMHGQQTMKYLNDKAVSDAMLAKHQKDQIDPVFAKAAEEAIAARVKNITE |
| Ga0007877_10115393 | 3300003814 | Freshwater | KYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK* |
| Ga0031655_101064843 | 3300003852 | Freshwater Lake Sediment | MHGQQTLKHLNEQAVAQAILAKHKTEQVDPVFAKAVEEALIAKAQAK* |
| Ga0031655_102507161 | 3300003852 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAILAKHKDSKDQLDPVLVKAVNEALAAKAKNISE* |
| Ga0031655_102512001 | 3300003852 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAMLAKHSKDQVDPVFEKAVEEALAVRAKNITE* |
| Ga0031655_102859911 | 3300003852 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAILAKHKTEKVDPVFAKAVEEAMAKRAQ |
| Ga0069718_150843661 | 3300004481 | Sediment | MHGQQTMKYLNDKAVADAMLKKRELTEVDPAFEKAVQEALAARAKNI |
| Ga0065168_10013273 | 3300004684 | Freshwater | MHGQQTMKHLNDKAVADAILASRKAVSPVALDPKLVKAMEDVLAQKAIAKSAN* |
| Ga0007792_100399753 | 3300004805 | Freshwater | MHGQQTLKHLNEQAVAQAILAKHSKDQIDPVFQKAVEEALAAKAQAN* |
| Ga0007809_100052434 | 3300004807 | Freshwater | LHGLKTMAYLNKQAAAEAILAKHDKDGVNPAFQKAVEEALAARAKNITE* |
| Ga0007809_100089521 | 3300004807 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENTINPEFKKAVEEALAAKAQTAK* |
| Ga0007809_100210091 | 3300004807 | Freshwater | TITKGIKMHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK* |
| Ga0078894_108141423 | 3300005662 | Freshwater Lake | MHGQQTMKYLNDKAVADAIVANRKVDTNAISPAFQKAVEEALAAKAKAAAAK* |
| Ga0079957_13435541 | 3300005805 | Lake | MHGQQTMKYLNDKAVADAIMANHKVDTNAVSPAFQKAVEEALAAKAKAAAK* |
| Ga0007876_10105203 | 3300006071 | Freshwater | MHGQQTMKYLNDKAVADAILAKRKTDENTISPEFKKAVEEALAAKAQAAAK* |
| Ga0007881_10603731 | 3300006072 | Freshwater | MHGQQTMKYLNDKAVADAILAKNKDHQVDPAFQKAVEEALAARAKNITE* |
| Ga0007819_10047505 | 3300006105 | Freshwater | MAYLNKQAAAEAILAKHDKDGVNPAFQKAVEEALAARAKNITE* |
| Ga0007870_11090592 | 3300006109 | Freshwater | MHGQQTMKYLNDKAVAEAMLAKRPKDQIDPVFAKAVEEALAAKAKQISA* |
| Ga0007807_10999612 | 3300006116 | Freshwater | GIKMHGQQTMKYLNDKAVADAILAKRKTDENTISPEFKKAVEEALAAKAQAAAK* |
| Ga0007825_10111931 | 3300006125 | Freshwater | LNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK* |
| Ga0099846_13060511 | 3300007542 | Aqueous | MHGQQTMKYLNDKAVADAIMAKHQKDQINPEFQKAVEEALAAKVKNITE* |
| Ga0114340_11949352 | 3300008107 | Freshwater, Plankton | MKYLNDKAVADAILANRKIDTNAVSPAFQKVVEEALAARAAVSK* |
| Ga0114341_102710411 | 3300008108 | Freshwater, Plankton | MKYLNDKAAADAIMAKHARDPNSVNPEFAKVVEETLAKRAQEKAAA* |
| Ga0114343_11903742 | 3300008110 | Freshwater, Plankton | MHGQQTMKYLNDKAAADAIMAKHARDPNSVNPEFAKVVEETLAKRAQEKAAA* |
| Ga0114346_10224633 | 3300008113 | Freshwater, Plankton | MHGLQTMKYLNEQAAAKAILAKHDKDTQKVDPVFAKAVEEALASKAKNITQ* |
| Ga0114364_10113994 | 3300008267 | Freshwater, Plankton | MHGQQTMKYLNDKAVADAMLAKRNVDTQKIDPVFAKAVEEALASKAKNITQ* |
| Ga0105105_109907291 | 3300009009 | Freshwater Sediment | NMHGQQTMKYLNDKAVADAIMAKRPANDQIDPVFAKAVEEALAAKAKNISQ* |
| Ga0105099_103458002 | 3300009082 | Freshwater Sediment | MHGQQTMKFLNDKAVADAMLAKQPKDHIDPVFQKAVEEALAARAKNISQ* |
| Ga0114963_100201813 | 3300009154 | Freshwater Lake | MHGQQTLKYLNDQAVAQAILAKHKNTQAIDPVFEKAVEESLAAKAKNITE* |
| Ga0105102_105940471 | 3300009165 | Freshwater Sediment | MHGQQTMKYLNDKAVADAMLAKQPKDVVNPAFEKAVQEALTARAKNLTE* |
| Ga0105097_105645802 | 3300009169 | Freshwater Sediment | MKYLNDKAVADAMLAKQPKDAVNPAFEKVVQEALAARAKNITE* |
| Ga0114959_100269602 | 3300009182 | Freshwater Lake | MKYLNEQATAEAILAKHEKIDIDPVFEKAVEEALANRAKNITE* |
| Ga0114974_100175603 | 3300009183 | Freshwater Lake | MHGQQTMKYLNDKAVADAIMKKQAQAPIDPAFQKAVEEALAARVKNITQ* |
| Ga0114974_103562742 | 3300009183 | Freshwater Lake | MHGQQTMKYLNDKAVADAIMANRKVDTDAVSPAFQKAVEEALAAKAKAAATK* |
| Ga0114976_100227753 | 3300009184 | Freshwater Lake | MHGQQTMKYLNDKAVADAILARNKDTQKIDPAFAKAVEEALAAKAKNITA* |
| Ga0114951_100964382 | 3300009502 | Freshwater | MHGQQTMKYLNDKAVSDAMLAKRDKVEIDPRFEKAVEEAMVARVKNITE* |
| Ga0114960_102253082 | 3300010158 | Freshwater Lake | MHGTNTMKYLNDKAVAEAILAKHEKIDIDPVFEKAVEEALANRAKNITE* |
| Ga0133913_115413553 | 3300010885 | Freshwater Lake | MHGLQTMAYLNDKAAADAITAKHDKDTQKIDPVFAKAVEEALASKAKNISQ* |
| Ga0136709_10246583 | 3300011184 | Freshwater | MHGQQTMKYLNDKAVADAMMKKQAQAPIDPVFQKAVEEAIAARVKNITQ* |
| Ga0207193_11904962 | 3300020048 | Freshwater Lake Sediment | MHGLQTMKYLNEKAVADAMLAKQPKEAVNSAFEKAVKEALAARVKNISE |
| Ga0214217_10194661 | 3300020706 | Freshwater | MHGQQTMKYLNDKAVADAMLIKHQKDQIDPVFAKAAEEAIAARVKNITE |
| Ga0214198_10227223 | 3300020710 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKA |
| Ga0214220_10014403 | 3300020726 | Freshwater | MHGLQTMKYLNEQAAAEAILAKHDKDEVNPAFQKAVEEALAARAKNITE |
| Ga0214170_10498162 | 3300020731 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKVKAAK |
| Ga0214219_10103563 | 3300020735 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK |
| Ga0214206_10006239 | 3300021131 | Freshwater | MHGQQTMKYLNDKAVADAILAKRKTDENTISPEFKKAVEEALAAKAQAAAK |
| Ga0214166_10568771 | 3300021139 | Freshwater | MHGQQTMKYLNDKAVADAILAKRKTDENTISPEFKKAVEEALAAKAKTAK |
| Ga0194047_100582303 | 3300021354 | Anoxic Zone Freshwater | MHGQQTMKYLNDKAVADAMLAKRDKNETNPVFEKAVEEALAARAKNITE |
| Ga0222714_105424122 | 3300021961 | Estuarine Water | MHGQQTMKYLNDKAAADAIMAKHARDPNSVNPEFAKVVEETLAKRAQEKVAA |
| Ga0181353_10633431 | 3300022179 | Freshwater Lake | MHGQQTMKYLNDKAVADAILANRKIDTNAVSPAFQKVVEEALAARAAVSK |
| Ga0196901_11833952 | 3300022200 | Aqueous | MHGQQTMKYLNDKAVADAIMAKHQKDQINPEFQKAVEEALAAKVKNITE |
| Ga0236341_100030234 | 3300022591 | Freshwater | MHGQQTMKYLNDKAVSDAMLAKHQKDQIDPVFAKAAEEAIAARVKNITE |
| Ga0236341_10039436 | 3300022591 | Freshwater | MHGQQTLKHLNEQAVAQAILAKHSKDQIDPVFQKAVEEALAAKAQAK |
| Ga0236340_10083654 | 3300022594 | Freshwater | MHGQQTMKYLNDKAVSDAMLAKHQKDQIDPVFAKAAEEAIAARV |
| Ga0236340_10645313 | 3300022594 | Freshwater | MHGQQTLKHLNEQAVAQAILAKHSKDQIDPVFQKAVEEALAAKAQ |
| Ga0214921_100061738 | 3300023174 | Freshwater | MHGQQTMKYLNDKAAADAIMAKHARDPNSVNPEFAKVVEKTLAKRAQEKAAA |
| Ga0214921_102136922 | 3300023174 | Freshwater | MHGQQTMKYLNDKAVAEAIMANHKVNTDAISPAFQKAVEEALAAKAKAAAAK |
| Ga0256681_100959353 | 3300023311 | Freshwater | MHGQQTLKYLNDQAVAAAMLAKHKDTQAIDPAFAKAVEESLAAKAKNITE |
| Ga0256681_106158843 | 3300023311 | Freshwater | MHGQQTLKHLNEQAVADAILAKKDKVEIDPRFEKAVQEALVSRAKNITE |
| Ga0209615_1007633 | 3300025075 | Freshwater | MHGQQTMKYLNDKAVADAMMKKQAQSPIDPVFQKAVEEALAARVKNITQ |
| Ga0208738_10012765 | 3300025379 | Freshwater | MHGQQTIKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK |
| Ga0208738_10193242 | 3300025379 | Freshwater | MHGQQTMKYLNDKAVADAILAKNKDHQVDPAFQKAVEEALAARAKNITE |
| Ga0208257_10016383 | 3300025389 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENTINPEFKKAVEEALAAKAQTAK |
| Ga0208378_10699583 | 3300025407 | Freshwater | MHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKA |
| Ga0208616_10013134 | 3300025417 | Freshwater | MAYLNKQAAAEAILAKHDKDGVNPAFQKAVEEALAARAKNITE |
| Ga0208622_10870802 | 3300025430 | Freshwater | LHGLKTMAYLNKQAAAEAILAKHDKDGVNPAFQKAVEEALTARAKNITE |
| Ga0208744_10103191 | 3300025450 | Freshwater | QQTIKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTAK |
| Ga0208379_11510242 | 3300025598 | Freshwater | MHGQQTMKHLNDKAVADAILASRKAVSPVALDPKLVKAMEDVLAQKAIAKSAN |
| Ga0208507_11313603 | 3300025648 | Freshwater | MHGQQTIKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKAQTA |
| Ga0209704_12303122 | 3300027693 | Freshwater Sediment | MHGQQTMKYLNDKAVADAMLAKQPKDVVNPAFEKAVQEALTARAKNITE |
| Ga0209188_10040283 | 3300027708 | Freshwater Lake | MHGQQTLKYLNDQAVAQAILAKHKNTQAIDPVFEKAVEESLAAKAKNITE |
| Ga0209188_11463292 | 3300027708 | Freshwater Lake | MHGLQTMKYLNEQATAEAILAKHEKIDIDPVFEKAVEEALANRAKNITE |
| Ga0209296_11864203 | 3300027759 | Freshwater Lake | MHGQQTMKYLNDKAVADAIMKKQAQAPIDPAFQKAVEEALAARVKNITQ |
| Ga0209296_12615862 | 3300027759 | Freshwater Lake | MHGQQTMKYLNDKAVADAIMANRKVDTDAVSPAFQKAVEEALAAKAKAAATK |
| Ga0209770_101754902 | 3300027769 | Freshwater Lake | MHGQQTMKYLNDKAVADAIVANRKVDTNAISPAFQKAVEEALAAKAKAAASK |
| Ga0209246_100697391 | 3300027785 | Freshwater Lake | MHGQQTMKYLNDKAVADAILANRKIDTNAVSPAFQKVVEEALA |
| Ga0209246_101687863 | 3300027785 | Freshwater Lake | DSMHGQQTMKYLNDKAVADAILANRKIDTNAVSPAFQKVVEEALAARAAVSK |
| Ga0209287_102265892 | 3300027792 | Freshwater Sediment | MHGQQTMKYLNDKAVADAMLAKQPKDHIDPVFQKAVEEALAARAKNISQ |
| Ga0209229_104862732 | 3300027805 | Freshwater And Sediment | MHGQQTMKYLNDKAVADAMMKKQAQSPIDPVFQKAVEEALAARVKN |
| Ga0209777_100606693 | 3300027896 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAILAKHKDSKDQLDPVLVKAVNEALAAKAKNISE |
| Ga0209777_101721505 | 3300027896 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAILAKHKTEKVDPVFAKAVEEAMAKRAQEVK |
| Ga0209777_102538042 | 3300027896 | Freshwater Lake Sediment | MHGQQTLKHLNEQAVAQAILAKHSKDQIDPVFQKAVEEALAAKAQAN |
| Ga0209777_103272063 | 3300027896 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAMLAKHSKDQVDPVFEKAVEEALAVRAKNITE |
| Ga0209777_106628223 | 3300027896 | Freshwater Lake Sediment | MHGQQTMKYLNDKAVADAMLIKHQKDQIDPVFQKAAEEAIAARVKNITE |
| Ga0209777_106651502 | 3300027896 | Freshwater Lake Sediment | MHGQQTLKHLNDQAVANAIMAKRSKEQVDPVFAKAVEEALAAKAKQISE |
| Ga0209777_107961374 | 3300027896 | Freshwater Lake Sediment | TFKHLNEQAVAQAILAKHKTEQVDPVFAKAVEEALIAKAQAK |
| Ga0209777_109299811 | 3300027896 | Freshwater Lake Sediment | MHGQQTLKHLNEQAVAQAILAKHKTEQVDPVFAKAVEEALTAK |
| (restricted) Ga0247831_10921872 | 3300028559 | Freshwater | MHGTNTMKYLNDKAVADAMLKKRETAEIDPAFEKAVQEALAARAKNITE |
| (restricted) Ga0247843_100102478 | 3300028569 | Freshwater | MHGQQTMKYLNDKAVADAMLKKRETAEIDPAFEKAVQEALAARAKNITE |
| Ga0316219_10502543 | 3300031759 | Freshwater | MHGQQTMKYLNDKAVADAIIAKNKDHKVDPVFQKAVEEALAARAKNIAE |
| Ga0316217_100171953 | 3300031813 | Freshwater | MHGQQTMKYLNDKAVADAIMAKNKDHGIDPVFQKAVEEALAVKAQAK |
| Ga0315285_1000030036 | 3300031885 | Sediment | MHGQQTMKYLNDKAVADVIMTNHKVDTNAISPAFQKAVEEALAAKAKAAAN |
| Ga0315904_114811501 | 3300031951 | Freshwater | TQGDSMHGQQTMKYLNDKAAADAIMAKHARDPNSVNPEFAKVVEETLAKRAQEKAAA |
| Ga0315905_110926151 | 3300032092 | Freshwater | YLNEQAAAKAILAKHDKDTQKVDPVFAKAVEEALASKAKNITQ |
| Ga0316221_10588051 | 3300032665 | Freshwater | YLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKVKAAK |
| Ga0316225_10726761 | 3300032675 | Freshwater | KMHGQQTMKYLNDKAVADAILAKHKTDENAINPEFKKAVEEALAAKVKAAK |
| Ga0335027_0291609_674_823 | 3300034101 | Freshwater | MHGQQTMKYLNDKAVADAIMAKQSKEQIDPVFAKAVEEALAAKAKNISQ |
| ⦗Top⦘ |