| Basic Information | |
|---|---|
| Family ID | F083637 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKILVVICSVTLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.91 % |
| % of genes near scaffold ends (potentially truncated) | 54.46 % |
| % of genes from short scaffolds (< 2000 bps) | 64.29 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.071 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (59.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (78.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.64% β-sheet: 0.00% Coil/Unstructured: 61.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 10.71 |
| PF17158 | MASE4 | 3.57 |
| PF13505 | OMP_b-brl | 3.57 |
| PF00497 | SBP_bac_3 | 2.68 |
| PF16868 | NMT1_3 | 2.68 |
| PF02518 | HATPase_c | 1.79 |
| PF00515 | TPR_1 | 1.79 |
| PF01699 | Na_Ca_ex | 1.79 |
| PF05128 | DUF697 | 1.79 |
| PF13467 | RHH_4 | 1.79 |
| PF06411 | HdeA | 1.79 |
| PF01144 | CoA_trans | 1.79 |
| PF04317 | DUF463 | 0.89 |
| PF04205 | FMN_bind | 0.89 |
| PF00291 | PALP | 0.89 |
| PF11272 | DUF3072 | 0.89 |
| PF13414 | TPR_11 | 0.89 |
| PF14559 | TPR_19 | 0.89 |
| PF04191 | PEMT | 0.89 |
| PF04226 | Transgly_assoc | 0.89 |
| PF13180 | PDZ_2 | 0.89 |
| PF01522 | Polysacc_deac_1 | 0.89 |
| PF13580 | SIS_2 | 0.89 |
| PF00072 | Response_reg | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 10.71 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 10.71 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.79 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.79 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 1.79 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 1.79 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 1.79 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 1.79 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.89 |
| COG3106 | Ras-like GTP-binding stress-induced protein YcjX, DUF463 family | Signal transduction mechanisms [T] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.07 % |
| Unclassified | root | N/A | 33.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000664|JGI12418J11929_10075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1348 | Open in IMG/M |
| 3300000667|JGI12495J11915_100790 | Not Available | 507 | Open in IMG/M |
| 3300000676|JGI12333J11928_100720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 811 | Open in IMG/M |
| 3300000676|JGI12333J11928_102005 | Not Available | 522 | Open in IMG/M |
| 3300000679|JGI12586J11914_100577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 752 | Open in IMG/M |
| 3300000693|JGI12545J11889_100779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300000699|JGI12536J11923_102508 | Not Available | 648 | Open in IMG/M |
| 3300000716|JGI12331J11884_100016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3733 | Open in IMG/M |
| 3300000716|JGI12331J11884_102767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300000721|JGI12410J11868_102264 | Not Available | 701 | Open in IMG/M |
| 3300000723|JGI12372J11909_100062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2989 | Open in IMG/M |
| 3300000723|JGI12372J11909_105279 | Not Available | 619 | Open in IMG/M |
| 3300000727|JGI12417J11878_1010358 | Not Available | 575 | Open in IMG/M |
| 3300000729|JGI12371J11900_1000487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2577 | Open in IMG/M |
| 3300000731|JGI12381J11899_1011860 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300000733|JGI12408J11912_1000063 | All Organisms → cellular organisms → Bacteria | 9646 | Open in IMG/M |
| 3300000733|JGI12408J11912_1002769 | Not Available | 1724 | Open in IMG/M |
| 3300000733|JGI12408J11912_1013685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 603 | Open in IMG/M |
| 3300000734|JGI12535J11911_1004721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1348 | Open in IMG/M |
| 3300000909|JGI12488J12863_100017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5112 | Open in IMG/M |
| 3300001075|JGI12453J13212_100083 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
| 3300001075|JGI12453J13212_101857 | Not Available | 806 | Open in IMG/M |
| 3300002568|C688J35102_120865649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1895 | Open in IMG/M |
| 3300003324|soilH2_10218136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2358 | Open in IMG/M |
| 3300003324|soilH2_10277487 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300003988|Ga0055475_10001387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5026 | Open in IMG/M |
| 3300004064|Ga0055479_10079604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300005995|Ga0066790_10417261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-15 | 574 | Open in IMG/M |
| 3300009029|Ga0066793_10501882 | Not Available | 694 | Open in IMG/M |
| 3300009029|Ga0066793_10719166 | Not Available | 567 | Open in IMG/M |
| 3300010046|Ga0126384_10000225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29133 | Open in IMG/M |
| 3300012212|Ga0150985_107355276 | Not Available | 500 | Open in IMG/M |
| 3300012469|Ga0150984_114014087 | Not Available | 867 | Open in IMG/M |
| 3300012931|Ga0153915_12354286 | Not Available | 623 | Open in IMG/M |
| 3300014201|Ga0181537_11074380 | Not Available | 544 | Open in IMG/M |
| 3300016270|Ga0182036_10009578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5090 | Open in IMG/M |
| 3300016341|Ga0182035_10463799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1076 | Open in IMG/M |
| 3300016387|Ga0182040_10171632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1568 | Open in IMG/M |
| 3300016422|Ga0182039_10028369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3560 | Open in IMG/M |
| 3300016445|Ga0182038_10579275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 966 | Open in IMG/M |
| 3300017974|Ga0187777_11098213 | Not Available | 579 | Open in IMG/M |
| 3300018014|Ga0187860_1051506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2076 | Open in IMG/M |
| 3300018058|Ga0187766_10744092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 680 | Open in IMG/M |
| 3300019240|Ga0181510_1152281 | Not Available | 613 | Open in IMG/M |
| 3300019260|Ga0181506_1347786 | Not Available | 578 | Open in IMG/M |
| 3300025797|Ga0210062_1001579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6773 | Open in IMG/M |
| 3300026783|Ga0207778_101418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1732 | Open in IMG/M |
| 3300026800|Ga0207742_102046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1988 | Open in IMG/M |
| 3300026804|Ga0207737_101238 | Not Available | 1691 | Open in IMG/M |
| 3300026804|Ga0207737_103677 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300026809|Ga0207820_100005 | All Organisms → cellular organisms → Bacteria | 17969 | Open in IMG/M |
| 3300026817|Ga0207775_100001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 39145 | Open in IMG/M |
| 3300026817|Ga0207775_100269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6268 | Open in IMG/M |
| 3300026817|Ga0207775_100494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4089 | Open in IMG/M |
| 3300026817|Ga0207775_113070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 635 | Open in IMG/M |
| 3300026819|Ga0207765_100127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 11119 | Open in IMG/M |
| 3300026819|Ga0207765_102611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1789 | Open in IMG/M |
| 3300026819|Ga0207765_109819 | Not Available | 789 | Open in IMG/M |
| 3300026823|Ga0207759_110747 | Not Available | 733 | Open in IMG/M |
| 3300026823|Ga0207759_113752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 637 | Open in IMG/M |
| 3300026833|Ga0207728_123544 | Not Available | 544 | Open in IMG/M |
| 3300026839|Ga0207764_126133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 508 | Open in IMG/M |
| 3300026845|Ga0207760_117416 | Not Available | 581 | Open in IMG/M |
| 3300026847|Ga0207802_1000037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 16452 | Open in IMG/M |
| 3300026849|Ga0207804_101058 | Not Available | 3123 | Open in IMG/M |
| 3300026860|Ga0207823_100044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16561 | Open in IMG/M |
| 3300026862|Ga0207724_1001966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2085 | Open in IMG/M |
| 3300026868|Ga0207818_1001308 | Not Available | 2548 | Open in IMG/M |
| 3300026868|Ga0207818_1010888 | Not Available | 830 | Open in IMG/M |
| 3300026872|Ga0207785_1022577 | Not Available | 550 | Open in IMG/M |
| 3300026898|Ga0207788_1002387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2039 | Open in IMG/M |
| 3300026928|Ga0207779_1004533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2042 | Open in IMG/M |
| 3300026928|Ga0207779_1039911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 538 | Open in IMG/M |
| 3300026979|Ga0207817_1002091 | Not Available | 2464 | Open in IMG/M |
| 3300026979|Ga0207817_1027501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 607 | Open in IMG/M |
| 3300026981|Ga0207822_1004561 | Not Available | 1628 | Open in IMG/M |
| 3300026988|Ga0207834_1030836 | Not Available | 626 | Open in IMG/M |
| 3300027000|Ga0207803_1000068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17911 | Open in IMG/M |
| 3300027011|Ga0207740_1021250 | Not Available | 852 | Open in IMG/M |
| 3300027024|Ga0207819_1000002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 51922 | Open in IMG/M |
| 3300027024|Ga0207819_1005145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2069 | Open in IMG/M |
| 3300027035|Ga0207776_1007527 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300027063|Ga0207762_1000888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6766 | Open in IMG/M |
| 3300027330|Ga0207777_1000301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13251 | Open in IMG/M |
| 3300027516|Ga0207761_1007197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2659 | Open in IMG/M |
| 3300027680|Ga0207826_1008486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2782 | Open in IMG/M |
| 3300027680|Ga0207826_1044278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
| 3300027680|Ga0207826_1190652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 554 | Open in IMG/M |
| 3300027703|Ga0207862_1000017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 37245 | Open in IMG/M |
| 3300027703|Ga0207862_1171989 | Not Available | 646 | Open in IMG/M |
| 3300027915|Ga0209069_10631961 | Not Available | 621 | Open in IMG/M |
| 3300031368|Ga0307429_1003837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5977 | Open in IMG/M |
| 3300031546|Ga0318538_10762245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 525 | Open in IMG/M |
| 3300031744|Ga0306918_11372916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 542 | Open in IMG/M |
| 3300031771|Ga0318546_10205921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300031833|Ga0310917_10284898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300031879|Ga0306919_11473031 | Not Available | 513 | Open in IMG/M |
| 3300031910|Ga0306923_10165326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2527 | Open in IMG/M |
| 3300031910|Ga0306923_11179291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
| 3300031912|Ga0306921_11152251 | Not Available | 866 | Open in IMG/M |
| 3300031942|Ga0310916_10057970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2988 | Open in IMG/M |
| 3300031942|Ga0310916_10228876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
| 3300031942|Ga0310916_10488664 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031947|Ga0310909_10236799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1523 | Open in IMG/M |
| 3300031947|Ga0310909_10831129 | Not Available | 762 | Open in IMG/M |
| 3300031959|Ga0318530_10482327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 515 | Open in IMG/M |
| 3300031981|Ga0318531_10518067 | Not Available | 540 | Open in IMG/M |
| 3300032059|Ga0318533_10589646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 816 | Open in IMG/M |
| 3300032160|Ga0311301_10389951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2142 | Open in IMG/M |
| 3300032261|Ga0306920_103679603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 563 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 59.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.68% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000664 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 | Environmental | Open in IMG/M |
| 3300000667 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 | Environmental | Open in IMG/M |
| 3300000676 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 | Environmental | Open in IMG/M |
| 3300000679 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 | Environmental | Open in IMG/M |
| 3300000693 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 | Environmental | Open in IMG/M |
| 3300000699 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 | Environmental | Open in IMG/M |
| 3300000716 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 | Environmental | Open in IMG/M |
| 3300000721 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 | Environmental | Open in IMG/M |
| 3300000723 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 | Environmental | Open in IMG/M |
| 3300000727 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300001075 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004064 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
| 3300026804 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
| 3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026898 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12418J11929_100751 | 3300000664 | Tropical Forest Soil | ICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12495J11915_1007902 | 3300000667 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG* |
| JGI12333J11928_1007201 | 3300000676 | Tropical Forest Soil | LMKKILVVICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12333J11928_1020052 | 3300000676 | Tropical Forest Soil | LXXXRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12586J11914_1005771 | 3300000679 | Tropical Forest Soil | VVICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12545J11889_1007791 | 3300000693 | Tropical Forest Soil | VVXCSXVLALSLAGCGWGPWAGKGPIIGKGKAPAPVVTKG* |
| JGI12536J11923_1025082 | 3300000699 | Tropical Forest Soil | MKKVFTVICSVLVALSLAGCGWFVPGKGKAPIIGKGKAPAPVVTKG* |
| JGI12331J11884_1000164 | 3300000716 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGKAPAPVVTKG* |
| JGI12331J11884_1027671 | 3300000716 | Tropical Forest Soil | MKKVFTVICSVLVALSLAGCGWFVPGKGKAPIIGKGKAP |
| JGI12410J11868_1022641 | 3300000721 | Tropical Forest Soil | VXCSVLLALSLAGCGWWAPGKGKAPIIGKGKAPAPVVTKG* |
| JGI12372J11909_1000623 | 3300000723 | Tropical Forest Soil | MKKILVVICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG*TS* |
| JGI12372J11909_1052792 | 3300000723 | Tropical Forest Soil | MKKVFTVICSVLVALSLAGCGWFVPGKGKAPIIGKGKAPA |
| JGI12417J11878_10103582 | 3300000727 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGK |
| JGI12371J11900_10004872 | 3300000729 | Tropical Forest Soil | MKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG* |
| JGI12381J11899_10118602 | 3300000731 | Tropical Forest Soil | MKKFLVVICSAVLALGLAGCAGKGKTPIGKGKAPAPVVTKG*TN |
| JGI12408J11912_10000637 | 3300000733 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGKAPAPVVTKG* |
| JGI12408J11912_10027695 | 3300000733 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPV |
| JGI12408J11912_10136851 | 3300000733 | Tropical Forest Soil | VICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG* |
| JGI12535J11911_10047212 | 3300000734 | Tropical Forest Soil | MKRTLVVICAVMLALGIAGCGWVGKTPIIGKGKAPAPVVTKG* |
| JGI12488J12863_1000177 | 3300000909 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGPIIGKGKAPAPVVTKG* |
| JGI12453J13212_1000831 | 3300001075 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGKAPAPVV |
| JGI12453J13212_1018572 | 3300001075 | Tropical Forest Soil | RALRLTIPWGGIMKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG* |
| C688J35102_1208656494 | 3300002568 | Soil | MKKVLVILCSVVLAVGLAGCVGKGKAPIGKGKAPAPVVTKG* |
| soilH2_102181361 | 3300003324 | Sugarcane Root And Bulk Soil | MKKVLVILCSVVLAVGLAGCAGKGKAPIGKGKAPAPVVTKG* |
| soilH2_102774871 | 3300003324 | Sugarcane Root And Bulk Soil | NPLGWHMKKVLVILCSVVLAVGLAGCVGKGKAPIGKGKAPAPVVTKG* |
| Ga0055475_100013876 | 3300003988 | Natural And Restored Wetlands | MKMFFVIICSAVLALGLAGCAGKGKVPIGKGKAPAPVVTKG* |
| Ga0055479_100796042 | 3300004064 | Natural And Restored Wetlands | MFFVIICSAVLALGLAGCAGKGKVPIGKGKAPAPVVTKG* |
| Ga0066790_104172611 | 3300005995 | Soil | MNKFLVVICSVVLALGLAGCAGKGKTPIGKGKAPAPVVTKG* |
| Ga0066793_105018822 | 3300009029 | Prmafrost Soil | MKKFLIVICSVVLAIGLAGCAGKGKTPIGKGKAPAPVVTRG* |
| Ga0066793_107191661 | 3300009029 | Prmafrost Soil | MNKFLVVICSVVLALGLAGCAGKGKTPIGKGKAPAPVVTRG* |
| Ga0126384_1000022520 | 3300010046 | Tropical Forest Soil | MKKFLVVLCSAILAFGLAGCWGKGKAPYGKGKAPAPVVTKG* |
| Ga0150985_1073552761 | 3300012212 | Avena Fatua Rhizosphere | IPWGGIMKKVLVILCSVVLAVGLAGCAGKGKAPIGKGKAPAPVVTKG* |
| Ga0150984_1140140872 | 3300012469 | Avena Fatua Rhizosphere | WHMKKVLVILCSVVLAVGLAGCVGKGKAPIGKGKAPAPVVTKG* |
| Ga0153915_123542861 | 3300012931 | Freshwater Wetlands | MKKFLVVICSAVLALGLAGCAGKGKTPIGKGKAPAPVVTKG* |
| Ga0181537_110743801 | 3300014201 | Bog | MHVDLANRRGLGIMKKLLIITCSVMLALSVGGCVGKGKAPIGKGKAPAPIVTKG* |
| Ga0182036_100095787 | 3300016270 | Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPWGGKGKAPIIGKGKAPAPVVTKG |
| Ga0182035_104637992 | 3300016341 | Soil | MKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPA |
| Ga0182040_101716322 | 3300016387 | Soil | VDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAP |
| Ga0182039_100283695 | 3300016422 | Soil | MKKILVVICSVMLALSLAGCGWGPFAGKGKAPIIGKGKAPAPVVT |
| Ga0182038_105792752 | 3300016445 | Soil | VDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVT |
| Ga0187777_110982131 | 3300017974 | Tropical Peatland | MKKMLVVVCSLVLALGLAGCAGKGKAPIIGKGKAPAPVVTKG |
| Ga0187860_10515061 | 3300018014 | Peatland | MPGFTKLTGMGAMNKFLAIVCSVLLALSVAGCAGKGKAPIGKGKAPVPVVTKG |
| Ga0187766_107440922 | 3300018058 | Tropical Peatland | MKRTLVVICTVMLALSLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0181510_11522811 | 3300019240 | Peatland | VDLANRRGLGIMKKLLIITCSVMLALSVGGCVGKGKAPIGKGKAPAPIVTKG |
| Ga0181506_13477862 | 3300019260 | Peatland | GLGIMKKLLIITCSVMLALSVGGCVGKGKAPIGKGKAPAPIVTKG |
| Ga0210062_10015795 | 3300025797 | Natural And Restored Wetlands | MKMFFVIICSAVLALGLAGCAGKGKVPIGKGKAPAPVVTKG |
| Ga0207693_103517083 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GLIVQLQGGPMKKFLIAVCSIVLAIGVSGCVGKAPVGKGKAPAPVVTRG |
| Ga0207778_1014182 | 3300026783 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207742_1020461 | 3300026800 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPWGKGKAPIIGKGKAPAPVVTKG |
| Ga0207737_1012382 | 3300026804 | Tropical Forest Soil | VDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207737_1036771 | 3300026804 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALGLAGCGWAGKAPIIGKGKAPA |
| Ga0207820_10000521 | 3300026809 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207775_10000127 | 3300026817 | Tropical Forest Soil | MKKILVVICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207775_1002693 | 3300026817 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPWAGKGPIIGKGKAPAPVVTKG |
| Ga0207775_1004941 | 3300026817 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAP |
| Ga0207775_1130701 | 3300026817 | Tropical Forest Soil | VVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207765_1001277 | 3300026819 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207765_1026113 | 3300026819 | Tropical Forest Soil | MKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG |
| Ga0207765_1098192 | 3300026819 | Tropical Forest Soil | VLTVVCSVLLALSLAGCAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207759_1107471 | 3300026823 | Tropical Forest Soil | SNIGALRLTIPWGGIMKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG |
| Ga0207759_1137522 | 3300026823 | Tropical Forest Soil | RGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207728_1235441 | 3300026833 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCDWAGWAGKGKAPIIGKGKAPAPVVT |
| Ga0207764_1261332 | 3300026839 | Tropical Forest Soil | QIQDIAIVDFIWTGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207760_1174161 | 3300026845 | Tropical Forest Soil | MKKILVVICSAVLALGLAGCAGKGKTPIGKGKAPAPVVTKG |
| Ga0207802_10000371 | 3300026847 | Tropical Forest Soil | WTGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207804_1010582 | 3300026849 | Tropical Forest Soil | VDFIWTGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207823_10004420 | 3300026860 | Tropical Forest Soil | MKKILVVICSVTLALGLAGCGWAGKTPIIGKGKAP |
| Ga0207724_10019662 | 3300026862 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207818_10013083 | 3300026868 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVV |
| Ga0207818_10108882 | 3300026868 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCDWAGWAGKGKAPIIGKG |
| Ga0207785_10225772 | 3300026872 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVT |
| Ga0207788_10023873 | 3300026898 | Tropical Forest Soil | VLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207779_10045333 | 3300026928 | Tropical Forest Soil | GVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207779_10399111 | 3300026928 | Tropical Forest Soil | RTLVVICTVMLALGLAGCVGKAPIIGKGKAPAPVVTKG |
| Ga0207817_10020914 | 3300026979 | Tropical Forest Soil | VDFIWTGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAP |
| Ga0207817_10275011 | 3300026979 | Tropical Forest Soil | AVMLALGLAACDWAGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207822_10045611 | 3300026981 | Tropical Forest Soil | SVLLALSLAGCGWFTPGKGKAPIIGKGKAPAPVVTKG |
| Ga0207834_10308361 | 3300026988 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCDWAGWAGKGKAPIIGK |
| Ga0207803_100006818 | 3300027000 | Tropical Forest Soil | VDSLFKQGHLMKKMLVVICSLVLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207740_10212501 | 3300027011 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCDWAGWAGKGKAPIIGKGKA |
| Ga0207819_100000249 | 3300027024 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWGKGKAPIIGKGKAPAPVVTKG |
| Ga0207819_10051451 | 3300027024 | Tropical Forest Soil | IAIVDFIWTGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPVVTKG |
| Ga0207776_10075271 | 3300027035 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTK |
| Ga0207762_10008883 | 3300027063 | Tropical Forest Soil | MKKMLVVICSLVLALSLAGCGWGPWAGKGPIIGKGKAPAPVVTKG |
| Ga0207777_10003011 | 3300027330 | Tropical Forest Soil | ALRLTIPWGGIMKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG |
| Ga0207761_10071971 | 3300027516 | Tropical Forest Soil | LERGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207826_10084864 | 3300027680 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCDWAGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0207826_10442781 | 3300027680 | Tropical Forest Soil | MKRTLVVICAVMLALGIAGCGWVGKTPIIGKGKAPAPVVTKG |
| Ga0207826_11351802 | 3300027680 | Tropical Forest Soil | NPIYLKQLRPLMKKFLVVICSAVLALGLAGCAGKGKTPIGKGKAPAPVVTKG |
| Ga0207826_11906521 | 3300027680 | Tropical Forest Soil | GVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0207862_100001739 | 3300027703 | Tropical Forest Soil | RLTIPWGGIMKKVLVILCSVIVSASLAGCVAGKAPWIGKGKAPAPVVTKG |
| Ga0207862_11719891 | 3300027703 | Tropical Forest Soil | MKRTLVVICAVMLALGLAGCGWVGKTPIIGKGKAPAPVVTKG |
| Ga0209069_106319611 | 3300027915 | Watersheds | MEKFLIVVCSVVLALGLAGCAGKGKTPIGKGKAPAPVVTKG |
| Ga0307429_10038375 | 3300031368 | Salt Marsh | MKTFLVIICSSVLALGVAGCVGKAPIGKGKAPAPVVTKG |
| Ga0318538_107622451 | 3300031546 | Soil | SVLLALSLAGCGWWAPGKGKAPIIGKGKAPAPVVTKG |
| Ga0306918_113729161 | 3300031744 | Soil | KKILVVICSVTLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0318546_102059212 | 3300031771 | Soil | LMKKMLVVICSLVLALSLAGCGWGPFGKGKAPIIGKGKAPAPVVTKG |
| Ga0310917_102848981 | 3300031833 | Soil | MKKILVLICSVTLALSLAGCGWGPFAGKGKAPIIGKGKAPAPVVTKG |
| Ga0306919_114730311 | 3300031879 | Soil | MKKILVVICSVTLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0306923_101653264 | 3300031910 | Soil | QGHLMKKMLVVICSLVLALSLAGCGWGPFGKGKAPIIGKGKAPAPVVTKG |
| Ga0306923_111792912 | 3300031910 | Soil | VDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTK |
| Ga0306921_111522511 | 3300031912 | Soil | VDSLFKQGHLMKKMLVVICSLVLALSLAGCGWGPFGKGKAPIIGKGKAPAPVVTKG |
| Ga0310916_100579704 | 3300031942 | Soil | LMKRTLVVICAVMLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0310916_102288761 | 3300031942 | Soil | MKKVFTVVCSVLLALSLAGCGWFTPGKGKAPIIGKGKAPAPVVTKG |
| Ga0310916_104886643 | 3300031942 | Soil | MRKVFTVVCSVLVALSLAGCGWFTPGKGKAPIIGKGKAPAPVVTK |
| Ga0310909_102367992 | 3300031947 | Soil | MKRTLVVICAAMLALGLAGCGWVGKTPIIGKGKAPAPVVTKG |
| Ga0310909_108311293 | 3300031947 | Soil | MKKMLVVICSLVLALSLAGCGWGPFAGKGKAPIIGKGKAPAPVVTKG |
| Ga0318530_104823271 | 3300031959 | Soil | IVDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKTPIIGKGKAPAPVVTKG |
| Ga0318531_105180671 | 3300031981 | Soil | MKKILVLICSVTLALGLAGCGWAGKGKAPIIGKGKAPAPVVTKG |
| Ga0318533_105896461 | 3300032059 | Soil | VDLLFGRGVLMKRTLVVICAVMLALGLAGCGWAGKAPIIGKGKAPAPV |
| Ga0311301_103899511 | 3300032160 | Peatlands Soil | LVIVVSLVLALGVAGCAGKGKAPIGKGKAPAPVVTKG |
| Ga0306920_1036796031 | 3300032261 | Soil | RRGALMKKILVLICSVTLALSLAGCGWGPFAGKGKAPIIGKGKAPAPVVTKG |
| ⦗Top⦘ |