| Basic Information | |
|---|---|
| Family ID | F083419 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPKKRGKKYIEAAKKVEAAVASNGNGGLDPEIACQMVRETS |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.12 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 91.15 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.717 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (21.239 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03946 | Ribosomal_L11_N | 76.11 |
| PF02357 | NusG | 9.73 |
| PF00467 | KOW | 3.54 |
| PF00180 | Iso_dh | 2.65 |
| PF00584 | SecE | 1.77 |
| PF00471 | Ribosomal_L33 | 1.77 |
| PF00440 | TetR_N | 1.77 |
| PF00298 | Ribosomal_L11 | 1.77 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0080 | Ribosomal protein L11 | Translation, ribosomal structure and biogenesis [J] | 77.88 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 9.73 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 1.77 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 1.77 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 1.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.72 % |
| Unclassified | root | N/A | 36.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001414|JGI20174J14864_1000266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2026 | Open in IMG/M |
| 3300001593|JGI12635J15846_10191678 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300001661|JGI12053J15887_10053575 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300001661|JGI12053J15887_10067710 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300002558|JGI25385J37094_10041810 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300005440|Ga0070705_100364743 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005445|Ga0070708_102214302 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005467|Ga0070706_101672165 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005468|Ga0070707_100579303 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005468|Ga0070707_101062109 | Not Available | 775 | Open in IMG/M |
| 3300005471|Ga0070698_101272235 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005537|Ga0070730_10328305 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005552|Ga0066701_10033898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2684 | Open in IMG/M |
| 3300005569|Ga0066705_10968319 | Not Available | 504 | Open in IMG/M |
| 3300005574|Ga0066694_10385496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 661 | Open in IMG/M |
| 3300005586|Ga0066691_10481637 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005586|Ga0066691_10826781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300005614|Ga0068856_100214982 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300006034|Ga0066656_10177020 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300006059|Ga0075017_100177756 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300006804|Ga0079221_11400595 | Not Available | 556 | Open in IMG/M |
| 3300006806|Ga0079220_10781332 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300006854|Ga0075425_101728313 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006864|Ga0066797_1279639 | Not Available | 582 | Open in IMG/M |
| 3300006914|Ga0075436_101566698 | Not Available | 501 | Open in IMG/M |
| 3300007076|Ga0075435_101900045 | Not Available | 523 | Open in IMG/M |
| 3300007258|Ga0099793_10354567 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300007265|Ga0099794_10563075 | Not Available | 602 | Open in IMG/M |
| 3300009029|Ga0066793_10005049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 6655 | Open in IMG/M |
| 3300009029|Ga0066793_10175771 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300009038|Ga0099829_10472933 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300009088|Ga0099830_10490021 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300009088|Ga0099830_10743837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 808 | Open in IMG/M |
| 3300009089|Ga0099828_11190629 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009137|Ga0066709_102203017 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300009137|Ga0066709_104442100 | Not Available | 512 | Open in IMG/M |
| 3300009662|Ga0105856_1163896 | Not Available | 683 | Open in IMG/M |
| 3300010087|Ga0127492_1097998 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300010090|Ga0127471_1062967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 952 | Open in IMG/M |
| 3300010111|Ga0127491_1003017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 689 | Open in IMG/M |
| 3300010113|Ga0127444_1092519 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300010119|Ga0127452_1060280 | Not Available | 709 | Open in IMG/M |
| 3300010127|Ga0127489_1169169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1514 | Open in IMG/M |
| 3300010133|Ga0127459_1013256 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300010134|Ga0127484_1128651 | Not Available | 958 | Open in IMG/M |
| 3300010139|Ga0127464_1101265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 948 | Open in IMG/M |
| 3300010335|Ga0134063_10622663 | Not Available | 551 | Open in IMG/M |
| 3300010361|Ga0126378_11039311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 922 | Open in IMG/M |
| 3300010375|Ga0105239_12204298 | Not Available | 641 | Open in IMG/M |
| 3300011120|Ga0150983_12006047 | Not Available | 545 | Open in IMG/M |
| 3300012180|Ga0153974_1115848 | Not Available | 615 | Open in IMG/M |
| 3300012200|Ga0137382_10010476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4915 | Open in IMG/M |
| 3300012203|Ga0137399_11093244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 671 | Open in IMG/M |
| 3300012210|Ga0137378_10484807 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300012210|Ga0137378_10921335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 787 | Open in IMG/M |
| 3300012224|Ga0134028_1107087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 686 | Open in IMG/M |
| 3300012224|Ga0134028_1228386 | Not Available | 613 | Open in IMG/M |
| 3300012362|Ga0137361_10066478 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
| 3300012363|Ga0137390_11701128 | Not Available | 565 | Open in IMG/M |
| 3300012375|Ga0134034_1020669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 749 | Open in IMG/M |
| 3300012376|Ga0134032_1193188 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300012381|Ga0134026_1005159 | Not Available | 700 | Open in IMG/M |
| 3300012381|Ga0134026_1029165 | Not Available | 560 | Open in IMG/M |
| 3300012388|Ga0134031_1089182 | Not Available | 560 | Open in IMG/M |
| 3300012388|Ga0134031_1238606 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300012391|Ga0134035_1186659 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300012399|Ga0134061_1246039 | Not Available | 637 | Open in IMG/M |
| 3300012401|Ga0134055_1124385 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012403|Ga0134049_1054487 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300012683|Ga0137398_10685702 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012917|Ga0137395_11232038 | Not Available | 521 | Open in IMG/M |
| 3300012918|Ga0137396_10061303 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300012918|Ga0137396_10945027 | Not Available | 629 | Open in IMG/M |
| 3300012922|Ga0137394_10969952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 707 | Open in IMG/M |
| 3300012944|Ga0137410_12123830 | Not Available | 501 | Open in IMG/M |
| 3300012977|Ga0134087_10419230 | Not Available | 656 | Open in IMG/M |
| 3300013294|Ga0120150_1050728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 802 | Open in IMG/M |
| 3300014054|Ga0120135_1047089 | Not Available | 651 | Open in IMG/M |
| 3300015051|Ga0137414_1001380 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300015052|Ga0137411_1078164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 812 | Open in IMG/M |
| 3300015086|Ga0167655_1011636 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300015241|Ga0137418_11306042 | Not Available | 505 | Open in IMG/M |
| 3300016422|Ga0182039_11123173 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300017654|Ga0134069_1146125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 788 | Open in IMG/M |
| 3300017993|Ga0187823_10071682 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300020002|Ga0193730_1051448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae | 1188 | Open in IMG/M |
| 3300020012|Ga0193732_1072437 | Not Available | 567 | Open in IMG/M |
| 3300021080|Ga0210382_10555495 | Not Available | 509 | Open in IMG/M |
| 3300021086|Ga0179596_10542601 | Not Available | 590 | Open in IMG/M |
| 3300021432|Ga0210384_11416737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 600 | Open in IMG/M |
| 3300021479|Ga0210410_11368750 | Not Available | 600 | Open in IMG/M |
| 3300021559|Ga0210409_10926188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 745 | Open in IMG/M |
| 3300022531|Ga0242660_1164291 | Not Available | 590 | Open in IMG/M |
| 3300025910|Ga0207684_11192771 | Not Available | 630 | Open in IMG/M |
| 3300026316|Ga0209155_1032201 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300026333|Ga0209158_1242477 | Not Available | 618 | Open in IMG/M |
| 3300026542|Ga0209805_1089330 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300026550|Ga0209474_10618434 | Not Available | 555 | Open in IMG/M |
| 3300026999|Ga0207949_1026149 | Not Available | 538 | Open in IMG/M |
| 3300027480|Ga0208993_1106850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300027633|Ga0208988_1113457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 667 | Open in IMG/M |
| 3300027663|Ga0208990_1139492 | Not Available | 647 | Open in IMG/M |
| 3300027671|Ga0209588_1007381 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300027857|Ga0209166_10139121 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300027857|Ga0209166_10206479 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300027986|Ga0209168_10031592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2919 | Open in IMG/M |
| 3300028047|Ga0209526_10986546 | Not Available | 505 | Open in IMG/M |
| 3300031778|Ga0318498_10438237 | Not Available | 579 | Open in IMG/M |
| 3300031962|Ga0307479_10286132 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300031962|Ga0307479_10388041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1381 | Open in IMG/M |
| 3300032180|Ga0307471_102292171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 681 | Open in IMG/M |
| 3300032180|Ga0307471_103701023 | Not Available | 541 | Open in IMG/M |
| 3300032180|Ga0307471_104191612 | Not Available | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 21.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.77% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001414 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20174J14864_10002666 | 3300001414 | Arctic Peat Soil | MPKKRGKKYIEAAKKVEAALASNGNGGLDPAAAVQL |
| JGI12635J15846_101916784 | 3300001593 | Forest Soil | MPKKRGKKYIEAAKKVEAAVSGNGNGGLDPATAVALAKD |
| JGI12053J15887_100535756 | 3300001661 | Forest Soil | VPKKRGKKYIDAAKKVEAAVASNGNGGLGPDAAVSLAKETSISKFDATIEAH |
| JGI12053J15887_100677106 | 3300001661 | Forest Soil | MPKKRGKKYIEAAKRIEAAVAGNGNGGLDPAAAVAL |
| JGI25385J37094_100418105 | 3300002558 | Grasslands Soil | VSKRHGKKYVEAAKKVEAAVAANGNGGLTPEQAVALAKDTSISKF |
| Ga0070705_1003647433 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKKRGKKYIEAAKKVEAALAGNGESGLEPNAAVALAKETSISK |
| Ga0070708_1022143022 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKKRGKKYIEAAKKVEAALAGNGESGLEPNAAVALAKETSISKFDATVE |
| Ga0070706_1016721652 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKKRGKKYVEAAKKVEAAIAGNGNGGLDPATAVRIARETSISKFDATV |
| Ga0070707_1005793031 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKKRGKKYIEAAKKVEAALAGNGESGLEPNAAVALAKETSISKFDAT |
| Ga0070707_1010621091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKRHGKKYVEAAKKVEAAVAANGNGGLTTEQAVALAKDT |
| Ga0070698_1012722351 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGKHGKKYIEAAKKVEAAVAANGNGGLTTEQAVALAKDTSIS |
| Ga0070730_103283053 | 3300005537 | Surface Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDTETACKLVKESSISKFD |
| Ga0066701_100338987 | 3300005552 | Soil | VPKKRGKKYIEAAKKVEAALSSNGDGGLDPERACQMVRETSISKF |
| Ga0066705_109683191 | 3300005569 | Soil | VPKKRGKKYIEAAKKVEAALSSNGDGGLDPERACQ |
| Ga0066694_103854961 | 3300005574 | Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLDPEIACQIVRDTSISKF |
| Ga0066691_104816371 | 3300005586 | Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVRETSTSK |
| Ga0066691_108267812 | 3300005586 | Soil | MPKKRGKKYIEAAKKVEAALSSNGNGGLDPETACKMVRETSISKFDAT |
| Ga0068856_1002149821 | 3300005614 | Corn Rhizosphere | MPKKRGKKYLEAFKKVEAAVSSNGNGGLEPEAACQIVRDTSTSKF |
| Ga0066656_101770204 | 3300006034 | Soil | MPKKRGKKYIEAAKKVEAAVAGNGNGGLEPEVACQMVRETSISKFD |
| Ga0075017_1001777564 | 3300006059 | Watersheds | MPKKRGKKYIEAAKKVEEALTTNGNGGLDTESACRIVRE |
| Ga0079221_114005951 | 3300006804 | Agricultural Soil | MPKKRGKKYIEAAKKVEAAVQTNGNGGLDPEVAVQLVRETS |
| Ga0079220_107813323 | 3300006806 | Agricultural Soil | MPKRRGKKYIEAEKKVQAALASNGDGGLDTQKAVEIVRDTSISKF |
| Ga0075425_1017283133 | 3300006854 | Populus Rhizosphere | MPKKRGKKYIEAAKKVEAAVSQNGDGGLEPEVACQIVRDTSISK |
| Ga0066797_12796392 | 3300006864 | Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDPATAVALAK |
| Ga0075436_1015666982 | 3300006914 | Populus Rhizosphere | MPKKRGKKYLEAAKKVESAVASNGNGGLEPEVACQIVRDTSTSKFD |
| Ga0075435_1019000452 | 3300007076 | Populus Rhizosphere | MPKKRGKKYIEAAKKVEAAVASNGNGGLEPEAACQIVRDTSTS |
| Ga0099793_103545673 | 3300007258 | Vadose Zone Soil | MSKRHGKKYIEAAKKVEAAVAANGNGGLDPEQAVALAKETSISKF |
| Ga0099794_105630752 | 3300007265 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAALASNGNGGLEPEIACQMVRETSISKFDATV |
| Ga0066793_1000504910 | 3300009029 | Prmafrost Soil | MPKKRGKKYIEAAKKIEAALASNGNGGLTPEAAVQMAKETSISKFD |
| Ga0066793_101757713 | 3300009029 | Prmafrost Soil | VPKKRGKKYIEAAKKVEAAVASNGNGGLDPATAVALAKETS |
| Ga0099829_104729333 | 3300009038 | Vadose Zone Soil | MPKKRGKKYVEAAKKVEAAIASNGETGLDPQAACSMVKETSISKFD |
| Ga0099830_104900211 | 3300009088 | Vadose Zone Soil | MPKKRGKKYVEAAKKVEAAIASNGETGLDPQAACS |
| Ga0099830_107438371 | 3300009088 | Vadose Zone Soil | MPKKRGKKYIEAAKKLEEAVSGNGTGGLDPAPAGALAKDTSI |
| Ga0099828_111906291 | 3300009089 | Vadose Zone Soil | VSKRHGKKYVEAAKKVEAAVAANGNGGLDPEQAVALAK |
| Ga0066709_1022030173 | 3300009137 | Grasslands Soil | MPKKRGKKYIEAVKKVEAALVGNGNVGLDAEAAVAMVKDTSVSKFDA |
| Ga0066709_1044421001 | 3300009137 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLEPEIACQI |
| Ga0105856_11638962 | 3300009662 | Permafrost Soil | MPKKRGKKYIEAAKKVEAALASNGNGGLDPAAAVQLAK |
| Ga0127492_10979983 | 3300010087 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVSQNGDGVLEPEVACQIVRDTSISKFDA |
| Ga0127471_10629673 | 3300010090 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVKE |
| Ga0127491_10030173 | 3300010111 | Grasslands Soil | MPKKRGKKYIEAAKKVEQAVASNGNGGLEPEVACQIVRDTSTSKFD |
| Ga0127444_10925193 | 3300010113 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVAGNGNGGLEPEVACQMVRETSISKFDATV |
| Ga0127452_10602801 | 3300010119 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVKATSTSKF |
| Ga0127489_11691691 | 3300010127 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVKATS |
| Ga0127459_10132565 | 3300010133 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLEPEIACQIVRDTSISKFDA |
| Ga0127484_11286513 | 3300010134 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIV |
| Ga0127464_11012651 | 3300010139 | Grasslands Soil | MPKKRGKKYIEAAKKVEQAVASNGNGGLEPEVACQIVRDTSISKFDATV |
| Ga0134063_106226631 | 3300010335 | Grasslands Soil | MPKKRGKKYIEAAKKVEAALSSNGDAGLTPDAACKIVKETSTSK |
| Ga0126378_110393111 | 3300010361 | Tropical Forest Soil | MPKKRGKKYIEAAKKVEAAIQSNGNGGLEPEVACQIVRDTSTSKFDAT |
| Ga0105239_122042982 | 3300010375 | Corn Rhizosphere | MPKKRGKKYIEAAKKVEAAIAGNGNGGLDPETAVRVA |
| Ga0150983_120060471 | 3300011120 | Forest Soil | MPKRHGKRYIEAAKKVEAAVAANGNGGLDTEQAVALAKETS |
| Ga0153974_11158481 | 3300012180 | Attine Ant Fungus Gardens | MPKKRGKKYIEAAKKVEAALQANGNGGLEPEAAVQMVR |
| Ga0137382_1001047610 | 3300012200 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLDPEIACQIVRD |
| Ga0137399_110932441 | 3300012203 | Vadose Zone Soil | MPKRHGKKYIEAAKKVEAAVAANGNGGLDTEQAVALAKDT |
| Ga0137378_104848071 | 3300012210 | Vadose Zone Soil | VPKKRGKKYIEAAKKVEAAMASNGEGGLEPNAAVA |
| Ga0137378_109213351 | 3300012210 | Vadose Zone Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLGPEEACRIVKET |
| Ga0134028_11070871 | 3300012224 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLDPEIACQI |
| Ga0134028_12283861 | 3300012224 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDPEIACQMVRETSISKFDA |
| Ga0137361_100664787 | 3300012362 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAAMASNGEGGLEPNAAVALAKETSISKFDATVE |
| Ga0137390_117011282 | 3300012363 | Vadose Zone Soil | MPKKRGKKYIEAAKKIEAAVASNGNGGLDPDTAVILAKEASISKFDATIE |
| Ga0134034_10206693 | 3300012375 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVRETS |
| Ga0134032_11931885 | 3300012376 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLEPEIACQIVRD |
| Ga0134026_10051592 | 3300012381 | Grasslands Soil | MPKKRGKKYTEAAKKVEAALAANGDGGLAPEEACKIVRET |
| Ga0134026_10291651 | 3300012381 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVSSNGNGGLEPEIAVQLVRE |
| Ga0134031_10891822 | 3300012388 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLEPEVACQMVRETSISKFD |
| Ga0134031_12386065 | 3300012388 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVAGNGNGGLEPEVACQMVRETSISKFDA |
| Ga0134035_11866595 | 3300012391 | Grasslands Soil | MPKKRGKKYIEAAKKVEAALSSNGDAGLTPDAACKIVKETSTSKFDATIEA |
| Ga0134061_12460391 | 3300012399 | Grasslands Soil | VPKKRGKKYIEAAKKVEAAVASNGNGGLEPEVACQIVRDTSTSKFD |
| Ga0134055_11243854 | 3300012401 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVSQNGDGGLEPEVACHIVRD |
| Ga0134049_10544875 | 3300012403 | Grasslands Soil | MPNKRGKKYIEAAKKVEAAVGGNGNGGLEPEIACQIV |
| Ga0137398_106857023 | 3300012683 | Vadose Zone Soil | MPKKRGKKYLEAAKKVEAALATNGNGGLDPAAAVQ |
| Ga0137395_112320381 | 3300012917 | Vadose Zone Soil | VPKKRGKKYIEAAKKVEAAMASNGEGGLEPNAAVAL |
| Ga0137396_100613031 | 3300012918 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAALAANGDGGLGSEEACKIVRETSISK |
| Ga0137396_109450272 | 3300012918 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAALAGNGNGGLSPEAAVEMV |
| Ga0137394_109699521 | 3300012922 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAALAGNGNGGLSTEAAVQMVKDTSISKFDATV |
| Ga0137410_121238301 | 3300012944 | Vadose Zone Soil | VPKKRGKKYIEAAKKVEAAMASNGEGGLEPNAAVALAKETSISKFDATVE |
| Ga0134087_104192303 | 3300012977 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDPEIACEMV |
| Ga0120150_10507281 | 3300013294 | Permafrost | MPKKRGKKYIEAAKKIEAALASNGNGGLTPEAAVQMAKETSISKFDAT |
| Ga0120135_10470892 | 3300014054 | Permafrost | VPKKRGKKYIEAAKKVEAALAGNGNGGLTPEAAVQMAKETSISKFDATV |
| Ga0137414_10013801 | 3300015051 | Vadose Zone Soil | VPKKRGKKYIEAAKKVEAAMASNGEGGLEPNAAVALAKETSISK |
| Ga0137411_10781643 | 3300015052 | Vadose Zone Soil | VPKKRGKKYIEAAKKVEAAIASNGNGGLDPTAAVALAKETSISKFDAT |
| Ga0167655_10116365 | 3300015086 | Glacier Forefield Soil | MPKKRSKKYIEAAKKIEAALANHGNGGLDPDAAVALAKETSISKFDATV |
| Ga0137418_113060421 | 3300015241 | Vadose Zone Soil | MPKKRGKKYIEAAKKVEAAIAGNGNGGLDPETAVRI |
| Ga0182039_111231733 | 3300016422 | Soil | MPKRRGKKYIEAAKKVEAALSSNGDGGLDTQKAVDLVRETSISKFDA |
| Ga0134069_11461253 | 3300017654 | Grasslands Soil | MPKKRGKKYIEAAKKVEAAVAGNGNGGLEPEVACQMV |
| Ga0187823_100716822 | 3300017993 | Freshwater Sediment | MPKRRGKKYEEAAKKVEAALASNGDGGLDPETAVKIVRET |
| Ga0193730_10514483 | 3300020002 | Soil | MPKKRGKKYIEAAKKVEAAIAGNGNGGLDPETAVRVARETSISKFDATLEAH |
| Ga0193732_10724371 | 3300020012 | Soil | VPKKRGKKYIEAAKKVEAALAGNGNGGLSPDAAVQMVKE |
| Ga0210382_105554951 | 3300021080 | Groundwater Sediment | MPKKRGKKYIEAAKKVEAALASNGNGGLDPEAAVAMVKDTSISKFDAT |
| Ga0179596_105426012 | 3300021086 | Vadose Zone Soil | MPKRHGKKYIEAAKKVEAAVTANGNGGLTTEQAVAL |
| Ga0210384_114167372 | 3300021432 | Soil | MPKKRGKKYIEAAKKVEAALAGNGNGGLDPETAVAMVKDTSISK |
| Ga0210410_113687501 | 3300021479 | Soil | MPKKRGKKYIEAAKKVEAAMSSNGNGGLDPATAVALAKD |
| Ga0210409_109261883 | 3300021559 | Soil | MPKKRGKKYIEAAKRVEAAVTGNGNGGLDPATAVALAKD |
| Ga0242660_11642912 | 3300022531 | Soil | MPKKRGKKYIEAAKKVEAAVQTNGNGGLDPEVAVQLV |
| Ga0207684_111927711 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKKRGKKYIEAAKKVEAALQSNGNGGLDPEVAVQLVR |
| Ga0209155_10322016 | 3300026316 | Soil | MPKKRGKKYIEAAKKVEAAVGGNGNGGLDPEIACQIVRDTSLSKF |
| Ga0209158_12424772 | 3300026333 | Soil | MPKKRGKKYIEAAKKVEAALSSNGNGGLDPETACKMVRETSISKFDATV |
| Ga0209805_10893301 | 3300026542 | Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDPEIACQMVRETS |
| Ga0209474_106184342 | 3300026550 | Soil | MPKKRGKKYIEAAKKVEAALSSNGDAGLAPDAACKIVKETST |
| Ga0207949_10261492 | 3300026999 | Forest Soil | MPKKRGKKYIEAAKRVEAAVTGNGNGGLDPATAVA |
| Ga0208993_11068502 | 3300027480 | Forest Soil | VPKKRGKKYIDAAKKVEAAVASNGNGGLGPDAAVSLAKETSISKFDATIEAHVR |
| Ga0208988_11134571 | 3300027633 | Forest Soil | MPKKRGKKYIEAAKKVEAALASNGNGGLDPAAAVQ |
| Ga0208990_11394922 | 3300027663 | Forest Soil | MPKKRGKKYIEAAKKVEAAIASNGNGGLDTENACQIVRETSISK |
| Ga0209588_10073811 | 3300027671 | Vadose Zone Soil | MPKKRGKKYIEAAKKIEAAVASNGNGGLDPDTAVILAKEASISKFDATIEAH |
| Ga0209166_101391211 | 3300027857 | Surface Soil | MPKKRGKKYEEAAKKVEAAIASNGNGGLTPEEACK |
| Ga0209166_102064793 | 3300027857 | Surface Soil | MPKKRGKKYIEAAKKVEAAVASNGNGGLDTETACKLVKESSISKFDAT |
| Ga0209168_100315927 | 3300027986 | Surface Soil | MPKKRGKKYIEAVKKVEQAVASNGNGGLSPDAACAVVRDTS |
| Ga0209526_109865462 | 3300028047 | Forest Soil | MSKRHGKKYIEAAKKVEAAIAANGNGGLNPEEAVALAK |
| Ga0318498_104382371 | 3300031778 | Soil | MPKRRGKKYIEAAKKVEAALSSNGDGGLDTQKAVDLVRETSISK |
| Ga0307479_102861325 | 3300031962 | Hardwood Forest Soil | MPKRRGKKYIEAEKKVQAALASNGDAGLDPQKAVEIVRDTSISKFDATV |
| Ga0307479_103880411 | 3300031962 | Hardwood Forest Soil | MPKKRGKKYIEAAKKVEAAVGSNGNGGLDPAAAVALARETSISKFDATVEA |
| Ga0307471_1022921713 | 3300032180 | Hardwood Forest Soil | MSKRHGKKYIEAAKKVEAAIAANGNGGLDPEQAVALAKDTSI |
| Ga0307471_1037010231 | 3300032180 | Hardwood Forest Soil | MPKRRGKKYIEAEKKVQAALASNGDAGLDTEKAVAIVRDTSISK |
| Ga0307471_1041916121 | 3300032180 | Hardwood Forest Soil | MPKKRGKKYIEAAKKVEQAVASNGNGGLEPEVACEIVRETSI |
| ⦗Top⦘ |