Metagenome / Metatranscriptome Family F083221

Overview

Basic Information

• Family ID: F083221
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 113
• Average Sequence Length: 43 residues
• Representative Sequence: MSFLDRFRKKTEDEASRIARLSKTGRMTDGHIIDAVSDNDGR
• Number of Associated Samples: 91
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 12.50 %
• % of genes near scaffold ends (potentially truncated): 99.12 %
• % of genes from short scaffolds (< 2000 bps): 95.58 %
• Associated GOLD sequencing projects: 82
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (97.345 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.620 % of family members)
• Environment Ontology (ENVO): Unclassified (61.947 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (72.566 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 25.71%
  β-sheet: 5.71%
  Coil/Unstructured: 68.57%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF01066	CDP-OH_P_transf	5.31
PF13614	AAA_31	0.88
PF10415	FumaraseC_C	0.88
PF00392	GntR	0.88
PF01842	ACT	0.88
PF03449	GreA_GreB_N	0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0558	Phosphatidylglycerophosphate synthase	Lipid transport and metabolism [I]	5.31
COG1183	Phosphatidylserine synthase	Lipid transport and metabolism [I]	5.31
COG5050	sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases	Lipid transport and metabolism [I]	5.31
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.35 %
Unclassified	root	N/A	2.65 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.35 %
Unclassified	root	N/A	2.65 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.35 %
Unclassified	root	N/A	2.65 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	93.81 %
Unclassified	root	N/A	2.65 %

Level 5

Name	Rank	Taxonomy	Distribution
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	69.03 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	13.27 %
Unclassified	root	N/A	2.65 %

Level 6

Name	Rank	Taxonomy	Distribution
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	64.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.27 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	4.42 %
Unclassified	root	N/A	2.65 %

Level 7

Name	Rank	Taxonomy	Distribution
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	64.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.27 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	4.42 %
Unclassified	root	N/A	2.65 %

Level 8

Name	Rank	Taxonomy	Distribution
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	64.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.27 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	4.42 %
Unclassified	root	N/A	2.65 %

Level 9

Name	Rank	Taxonomy	Distribution
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	64.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	13.27 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	4.42 %
Unclassified	root	N/A	2.65 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2044078002|MGR_F548DK202J3TSP	All Organisms → cellular organisms → Bacteria → Acidobacteria	527
2067725003|GPWSG_F5G3JLY01DK4K4	All Organisms → cellular organisms → Bacteria → Acidobacteria	521
3300000364|INPhiseqgaiiFebDRAFT_101363656	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1145
3300000956|JGI10216J12902_103438409	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	882
3300000956|JGI10216J12902_109459639	All Organisms → cellular organisms → Bacteria	1641
3300003319|soilL2_10184328	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1102
3300003324|soilH2_10207614	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1231
3300004643|Ga0062591_101293730	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	716
3300005295|Ga0065707_10681114	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	648
3300005295|Ga0065707_10765635	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	612
3300005328|Ga0070676_11073591	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	607
3300005338|Ga0068868_101644307	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	604
3300005339|Ga0070660_100090700	All Organisms → cellular organisms → Bacteria → Acidobacteria	2410
3300005341|Ga0070691_10802038	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	573
3300005344|Ga0070661_100540900	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	936
3300005345|Ga0070692_10471270	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	808
3300005345|Ga0070692_10718193	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	674
3300005347|Ga0070668_101570565	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	602
3300005356|Ga0070674_102050923	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	521
3300005459|Ga0068867_100625442	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	942
3300005459|Ga0068867_101259584	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	681
3300005467|Ga0070706_101499231	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	616
3300005545|Ga0070695_101003072	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	679
3300005547|Ga0070693_101360676	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	551
3300005549|Ga0070704_101643079	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	593
3300005578|Ga0068854_100889065	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	782
3300005616|Ga0068852_100330466	All Organisms → cellular organisms → Bacteria → Acidobacteria	1483
3300005617|Ga0068859_100371963	All Organisms → cellular organisms → Bacteria	1525
3300005718|Ga0068866_10665925	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	710
3300005719|Ga0068861_100904585	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	836
3300005842|Ga0068858_101545618	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	655
3300005844|Ga0068862_102392542	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	540
3300006049|Ga0075417_10754605	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	502
3300006169|Ga0082029_1202632	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	730
3300006169|Ga0082029_1448523	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	945
3300006755|Ga0079222_10825502	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	762
3300006847|Ga0075431_100298915	All Organisms → cellular organisms → Bacteria	1626
3300006852|Ga0075433_11238685	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	647
3300006852|Ga0075433_11665509	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	550
3300006904|Ga0075424_100794048	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1010
3300006954|Ga0079219_10268067	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1030
3300006954|Ga0079219_11534334	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606
3300006969|Ga0075419_10848262	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	656
3300009094|Ga0111539_10354538	All Organisms → cellular organisms → Bacteria → Acidobacteria	1707
3300009098|Ga0105245_11788857	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	667
3300009100|Ga0075418_11974168	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	635
3300009101|Ga0105247_11065689	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	635
3300009147|Ga0114129_10709934	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1291
3300009174|Ga0105241_10781070	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	878
3300009174|Ga0105241_11380136	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	674
3300009174|Ga0105241_12328772	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	533
3300009176|Ga0105242_12873896	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	532
3300009840|Ga0126313_11834138	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	508
3300010375|Ga0105239_13317928	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	524
3300010399|Ga0134127_11413326	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	767
3300010399|Ga0134127_11436107	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	761
3300011119|Ga0105246_10296288	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1304
3300011119|Ga0105246_10342541	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1222
3300011332|Ga0126317_11019954	All Organisms → cellular organisms → Bacteria → Acidobacteria	1673
3300011333|Ga0127502_11001969	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	585
3300012201|Ga0137365_10606001	All Organisms → cellular organisms → Bacteria → Acidobacteria	802
3300012918|Ga0137396_10636189	Not Available	788
3300012922|Ga0137394_10747119	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	822
3300012931|Ga0153915_13198578	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	532
3300013100|Ga0157373_10464775	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	912
3300013102|Ga0157371_11207100	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	583
3300013102|Ga0157371_11471265	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	531
3300013306|Ga0163162_11020513	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	936
3300013308|Ga0157375_11828141	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	720
3300013308|Ga0157375_12611430	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	603
3300014320|Ga0075342_1238469	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	525
3300014745|Ga0157377_10130606	All Organisms → cellular organisms → Bacteria → Acidobacteria	1534
3300015371|Ga0132258_12375665	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1328
3300015371|Ga0132258_13193886	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1131
3300015372|Ga0132256_101491574	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	787
3300015374|Ga0132255_102110401	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	859
3300018071|Ga0184618_10327028	Not Available	654
3300018466|Ga0190268_11877253	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	544
3300025903|Ga0207680_10207050	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1339
3300025903|Ga0207680_10687888	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	733
3300025908|Ga0207643_10614472	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	700
3300025924|Ga0207694_11180650	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	648
3300025927|Ga0207687_11954337	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	501
3300025934|Ga0207686_10186937	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1474
3300025937|Ga0207669_11217467	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	638
3300025937|Ga0207669_11303984	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	617
3300025940|Ga0207691_10971512	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	709
3300025960|Ga0207651_10185240	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1656
3300025960|Ga0207651_11863914	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	541
3300025961|Ga0207712_11506280	All Organisms → cellular organisms → Bacteria → Acidobacteria	603
3300026023|Ga0207677_11344668	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	657
3300026035|Ga0207703_11305997	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	698
3300026088|Ga0207641_11587254	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	656
3300026095|Ga0207676_10938029	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	850
3300026095|Ga0207676_11225234	All Organisms → cellular organisms → Bacteria → Acidobacteria	744
3300026118|Ga0207675_101868757	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	619
3300027514|Ga0208338_1000047	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	57461
3300027637|Ga0209818_1140538	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	670
3300027691|Ga0209485_1029209	All Organisms → cellular organisms → Bacteria	1318
3300027876|Ga0209974_10423523	All Organisms → cellular organisms → Bacteria → Acidobacteria	525
3300027880|Ga0209481_10476750	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	643
3300028380|Ga0268265_12322156	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	543
3300028381|Ga0268264_10139103	All Organisms → cellular organisms → Bacteria → Acidobacteria	2163
3300028381|Ga0268264_10983204	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	850
3300030511|Ga0268241_10070051	All Organisms → cellular organisms → Bacteria → Acidobacteria	778
3300031716|Ga0310813_11134035	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	718
3300031716|Ga0310813_11834306	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	570
3300031852|Ga0307410_10266897	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1337
3300031944|Ga0310884_11084993	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	500
3300033412|Ga0310810_10174023	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2469
3300033412|Ga0310810_11214466	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	609
3300034172|Ga0334913_145971	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	506

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	61.95%
Environmental	Environmental	38.05%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	61.95%
Terrestrial	Environmental → Terrestrial	34.51%
Aquatic	Environmental → Aquatic	3.54%

Category

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	38.94%
Soil	Environmental → Terrestrial → Soil	34.51%
Rhizoplane	Host-Associated → Plants → Rhizoplane	23.01%
Freshwater	Environmental → Aquatic → Freshwater	2.65%
Sediment	Environmental → Aquatic → Sediment	0.89%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	27.43%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	26.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.47%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.50%
Loam	Environmental → Terrestrial → Soil → Loam	7.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.54%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.77%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	27.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.47%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.16%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.50%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.08%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.19%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.77%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.89%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.89%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.89%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.89%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	10.62%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.73%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.54%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.65%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.77%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.77%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	1.77%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.77%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.89%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.89%
Switchgrass, Maize And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere	0.89%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.89%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2044078002	Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL	Host-Associated
2067725003	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300003319	Sugarcane bulk soil Sample L2	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006169	Termite nest microbial communities from Madurai, India	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300027514	Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes)	Environmental
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300034172	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MGR_184430	2044078002	Switchgrass, Maize And Miscanthus Rhizosphere	MSFLDRFRKKTEDEASRIARLSRTGRMADGSIIDAASDAAGRIIQVTYTYT
GPWSG_00271130	2067725003	Soil	MSFLDRFRKKTEDETSRIARLSRTGRMTDGNIIDAESDGDGKIIQ
INPhiseqgaiiFebDRAFT_1013636561	3300000364	Soil	MSFIDRFRKKKEDEASRIARLSKTGRMADGRIIDAVST
JGI10216J12902_1034384091	3300000956	Soil	MSFLDRFRKKVEDEASRFARLSKTGRMTDGNIIDAVS
JGI10216J12902_1094596391	3300000956	Soil	MSFLDRFRKKTEDESSRIERLSKTGRMTDGEIIDAVSDDSG
soilL2_101843281	3300003319	Sugarcane Root And Bulk Soil	MSFLNRFRRKTEDEASRIARLSKTGRMTDGQIIDAVSDGDGKIVQ
soilH2_102076143	3300003324	Sugarcane Root And Bulk Soil	MSFLDRFRKRVEDEASRIARLSKTGRMTDGNIIDAVSDNSGRITQVTYTYML
Ga0062591_1012937302	3300004643	Soil	MSFLDRFRKKTEDEASRIARLSRTGRMADGSIIDAASDAAGRIIQVTYT
Ga0065707_106811142	3300005295	Switchgrass Rhizosphere	MSFLDRFRKKIEDEASRIERLSKTGRMGDGRIIDAVSDNDGR
Ga0065707_107656352	3300005295	Switchgrass Rhizosphere	MSFLDRFRKKIEDEASRIARLSKTGRMVDGKIIDAVSDNEGRLLHVN
Ga0070676_110735912	3300005328	Miscanthus Rhizosphere	MSFLDRFRRKTEDETTRIARLSRTGRMADGRILDAVSDNDGRIL
Ga0068868_1016443072	3300005338	Miscanthus Rhizosphere	MSFLDRFRKKPEDEASRIERLSKTGRMADGRIIDAVSDNEGR
Ga0070660_1000907005	3300005339	Corn Rhizosphere	MSFLDRFRKKKEDEPARIARLSKTGRMADGRILDAVSDNDGRILQVIYTYT
Ga0070691_108020382	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRRKTEDETTRIARLSRTGRMADGRILDAVSDNDGRILQVTY
Ga0070661_1005409002	3300005344	Corn Rhizosphere	MSFLDRFRKKPEDEASRIARLSKTGRMADGRIIDAVSDNE
Ga0070692_104712702	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRKKTEDEASRIARLSKTGRMTDGNIIDAVSDNHGHI
Ga0070692_107181932	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRKKKEDEASRIARLSKTGRMADGRIIDAVSMDDGTITQVT
Ga0070668_1015705652	3300005347	Switchgrass Rhizosphere	MSFLDRFRKKKEDEPARIARLSKTGRMADGRILDAVSDNDGRILQVIYTY
Ga0070674_1020509232	3300005356	Miscanthus Rhizosphere	MSFLDRFRKKREDEASRIVRLSKTGRMADGRIIDAVSADDGTITQV
Ga0068867_1006254422	3300005459	Miscanthus Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMTDGNIIDAVSDNDGR
Ga0068867_1012595841	3300005459	Miscanthus Rhizosphere	MSFLDRFRKKVEDEASRIARLSKTGRMTDGNIIDAVSDNNG
Ga0070706_1014992311	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRRKTEDEASRIARLSRTGRMIDGSIIDAVSDPDGKI
Ga0070695_1010030722	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRKRVEDEASRIARLSKTGRMTDGNIIDAVSDNSGRITQVTY
Ga0070693_1013606762	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAISDHNG
Ga0070704_1016430792	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSFLDRFRKRVEDEASRVARLSKTGRMTDGSIIDAVSDNNGRITQVTYT
Ga0068854_1008890651	3300005578	Corn Rhizosphere	MSFLDRFRKKPEDEASRIARLSKTGRMADGQIIDAISH
Ga0068852_1003304663	3300005616	Corn Rhizosphere	MSFLDRFRKKREDEASRIARLSKTGRMADGRVIDAVSSDD
Ga0068859_1003719631	3300005617	Switchgrass Rhizosphere	MSFLDRFRKKFEDEASRIERLSKTGRMADGRIIDAESDNDGRITQVSYTYIL
Ga0068866_106659251	3300005718	Miscanthus Rhizosphere	MSFLDRFRKKREDEASRIARLSKTGRMADGRVIDAVSSDDGTITQ
Ga0068861_1009045851	3300005719	Switchgrass Rhizosphere	MSFLDRFRKKVEDEASRIARLSKTGRMTDGNIIDAVSD
Ga0068858_1015456182	3300005842	Switchgrass Rhizosphere	MSFLDRFRKKVEDEASRIARLSKTGRMTDGNIIDAVSDN
Ga0068862_1023925422	3300005844	Switchgrass Rhizosphere	MSFLDRFRKKTEDEASRIERLSKTGRMADGRIIDAVSDNDGRITEVTYTYI
Ga0075417_107546051	3300006049	Populus Rhizosphere	MSFLDRFRRKNEDEASRIARLAKTGRITDGKILDVTTDKDGQIIQVNYNYM
Ga0082029_12026321	3300006169	Termite Nest	MSFLDRFRKKIEDEASRIARLSKTGRMTDGNIIDAVSD
Ga0082029_14485231	3300006169	Termite Nest	MSFLDRFRKKSEDEPSRIARLSRTGRMADGKIIDAVSDNDGRI
Ga0079222_108255021	3300006755	Agricultural Soil	MSFLDRFRKKTEDEASRIERLSKAGRMADGRIIDAVSENDGRITQVTYT
Ga0075431_1002989153	3300006847	Populus Rhizosphere	MSFLDRFRKKTEDEASRIARLSKTGRMGDGKIIDAVTASDGR
Ga0075433_112386851	3300006852	Populus Rhizosphere	MSFLDRFRRKTEDEASRIARLSKTGRITDGSIIDAVTEN
Ga0075433_116655092	3300006852	Populus Rhizosphere	MSFLDRFRKKPEDEASRIARLAKTGRMADGRIIDAVSDTEGRISQV
Ga0075424_1007940481	3300006904	Populus Rhizosphere	MSFLDRFRKKIEDEASRIARLSKTGRMADGRIIDAVSDNNGRITHVS
Ga0079219_102680671	3300006954	Agricultural Soil	MSFLDRFRKKQEDEASRIARLSKTGRMADGRIIDA
Ga0079219_115343342	3300006954	Agricultural Soil	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAV
Ga0075419_108482622	3300006969	Populus Rhizosphere	MSFLNRFRKKREDEASRIERLSKTGRIADGRIIDVVSTDDGTITHVTYAY
Ga0111539_103545381	3300009094	Populus Rhizosphere	MSFLDRFRKKTEDEASRIARLSKTGRMTDGHIIDAVSDNDGR
Ga0105245_117888571	3300009098	Miscanthus Rhizosphere	MSFLDRFRKKPEDEASRIERLSKTGRMADGRIIDAVSDNDGRITQVTYTY
Ga0075418_118031061	3300009100	Populus Rhizosphere	MSFLDRFRRKNEDEASRIARLAKTGRITDGKILDVT
Ga0075418_119741681	3300009100	Populus Rhizosphere	MSFLDRFRKRVEDEASRIARLSKTGRMTDGSIIDAVSDNNGRITQVTYTYML
Ga0105247_110656892	3300009101	Switchgrass Rhizosphere	MSFLTRFRKKTEDEASRIARLSQTGRMADGRIVDAVSDDDGH
Ga0114129_107099341	3300009147	Populus Rhizosphere	MSFLDRFRKKTEDEASRIARLSKTGRMADGKIIDAVTA
Ga0105241_107810701	3300009174	Corn Rhizosphere	MSFLDRFRKKTEDEASRIARLSRTGRMVDGKIIDAVSDDNGRLL
Ga0105241_113801361	3300009174	Corn Rhizosphere	MSFLNRFRRKTEDEPSRIARLAKTGRMTDGQIIDAISNRDGKIVQVT
Ga0105241_123287722	3300009174	Corn Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMTDGNIIDAVS
Ga0105242_128738962	3300009176	Miscanthus Rhizosphere	MSFLDRFRKRPEDEASRIARLSKTGRMVDGKIIDAVSDNEGRIL
Ga0126313_118341382	3300009840	Serpentine Soil	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSDKDGRLL
Ga0105239_133179282	3300010375	Corn Rhizosphere	MSFLDRFRKKPEDEASRIERLSKTGRMADGRIIDA
Ga0134127_114133262	3300010399	Terrestrial Soil	MSFLDRFRKKVEDEASRVARLSKSGRMTDGNIIDAESDNNGRITQV
Ga0134127_114361071	3300010399	Terrestrial Soil	MSFLDRFRKKTEDEASRIERLSKTGRMADGRIIDAVSDNDGRI
Ga0105246_102962881	3300011119	Miscanthus Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSDNDGRI
Ga0105246_103425411	3300011119	Miscanthus Rhizosphere	MSFLDRFRKKTEDEASRIARLSRTGRMADGKIIDAVSA
Ga0126317_110199543	3300011332	Soil	MSFLDRFRKKKEDEASRIARLSKTGRMADGRIIDAVSADDGTITQVTY
Ga0127502_110019691	3300011333	Soil	MSFLDRFRKKTEDEASRITRLSKTGRMTDGNIIDAASDS
Ga0137365_106060011	3300012201	Vadose Zone Soil	MSFLDRFRRKKEDEASRFARLLRTGRITEGSIIDVTLDRSRVSDKI
Ga0137396_106361891	3300012918	Vadose Zone Soil	MSFLDRFRHKQEDETARVARISKTGRIADGVVLDATSDSNGLITQVC
Ga0137394_107471191	3300012922	Vadose Zone Soil	MSFFDRFRKKKEDETARVARLSKTGRIADGVVLDATSDSNG
Ga0153915_131985781	3300012931	Freshwater Wetlands	MSFLDRFRSKKEDEASRISRLLKTGRMVDGRVLDAVCDS
Ga0157373_104647752	3300013100	Corn Rhizosphere	MSFLDRFRKKIEDEASRIERLSKTGRMADGKIIDAVSDN
Ga0157371_112071001	3300013102	Corn Rhizosphere	MSFLDRFRKKTEDEASRIARLSRTGRMVDGKIIDAVSDNDGRL
Ga0157371_114712651	3300013102	Corn Rhizosphere	MSFLDRFRKKKEDEPARIARLSKTGRMADGRILDAMSDNDGR
Ga0163162_110205132	3300013306	Switchgrass Rhizosphere	MSFLDRFRRKTEDETSRIARLARTGRITDGQIIDAVSDRNGKIIQ
Ga0157375_118281412	3300013308	Miscanthus Rhizosphere	MSFLNRFRKKREDEPSRIARLSKTGRMTDGRIIDAVTIDDGTITQV
Ga0157375_126114302	3300013308	Miscanthus Rhizosphere	MSFLDRFRRKVEDEASRIARLSKTGRMTDGSIIDATSDLDGKITQVTY
Ga0075342_12384692	3300014320	Natural And Restored Wetlands	MSFLDRFRKKTEDEASRIARLSKTGRIADGRVIDAISSEDGTILQVVYT
Ga0157377_101306061	3300014745	Miscanthus Rhizosphere	MSFLDRFRKKVEDEASRIARLSRTGRMTDGNIIDAVSDNS
Ga0132258_123756651	3300015371	Arabidopsis Rhizosphere	MSFLNRFRRKTEDESSRIARLSKTGRMTDGNIIDAVSDGDGKIIQVTY
Ga0132258_131938861	3300015371	Arabidopsis Rhizosphere	MSFLDRFRKKQEDEASRIARLSKTGRMADGRIIDAMSAAD
Ga0132256_1014915742	3300015372	Arabidopsis Rhizosphere	MSFLDRFRRKKEDEASRVARLSKTGRMIDGKILDAASDRD
Ga0132255_1021104012	3300015374	Arabidopsis Rhizosphere	MSFLDRFRKKKEDEASRIARLAKTGRMVDGRIIDAESDRDGKILQVTYTY
Ga0184618_103270281	3300018071	Groundwater Sediment	MSFFDRFRKKKEDETARVARLSKTGRIADGVVLDATSDSN
Ga0190268_118772531	3300018466	Soil	MSFLDRFRKKTEDEASRIARLSRTGRMADGKIIDAVTASD
Ga0207680_102070501	3300025903	Switchgrass Rhizosphere	MSFLDRFRKKKEDEASRIARLSKTGRMADGRIIDAVSSDDGAITQV
Ga0207680_106878882	3300025903	Switchgrass Rhizosphere	MSFLDRFRKRVEDEASRIARLSKTGRMTDGNIIDAVSDNNGRITQVTY
Ga0207643_106144721	3300025908	Miscanthus Rhizosphere	MSFLNRFRKKPEDEASRIERLSKTGRMTDGRIIDAVSDNEGRISQVTYTYI
Ga0207694_111806502	3300025924	Corn Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSDD
Ga0207687_119543371	3300025927	Miscanthus Rhizosphere	MSFLDRFRKKIEDVASRIERLSKTGRMGDGRIIDA
Ga0207686_101869371	3300025934	Miscanthus Rhizosphere	MSFLDRFRRKTEDETTRIARLSRTGRMADGRILDAVSDNDGRILQ
Ga0207669_112174671	3300025937	Miscanthus Rhizosphere	MSFLNRFRKKKEDEPSRIARLSKTGRMTDGRIIDAVTIDDGTITQVTYTYT
Ga0207669_113039841	3300025937	Miscanthus Rhizosphere	MSFLDRFRRKTEDESARIARLSKTGRMADGKILDAVSD
Ga0207691_109715122	3300025940	Miscanthus Rhizosphere	MSFLDRFRKKPEDEASRIERLSKTGRMADGRIIDAVSDNDGRITQVTY
Ga0207651_101852403	3300025960	Switchgrass Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSD
Ga0207651_118639142	3300025960	Switchgrass Rhizosphere	MSFLDRFRKKKEDEASRITRLSKTGRMADGRIIDA
Ga0207712_115062801	3300025961	Switchgrass Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSDNEGRILQVNYAYEI
Ga0207677_113446681	3300026023	Miscanthus Rhizosphere	MSFLDRFRKRPEDEASRIARLSKTGRMVDGKIIDAVSD
Ga0207703_113059972	3300026035	Switchgrass Rhizosphere	MSFLDRFRKKPEDEASRIARLSKTGRMADGQIIDAVSDNEGRISQVT
Ga0207641_115872541	3300026088	Switchgrass Rhizosphere	MSFLDRFRKKPEDEASRIARLSKTGRMADGRIIDAVSDNEGRISQVTYTY
Ga0207676_109380291	3300026095	Switchgrass Rhizosphere	MSFLDRFRKKREDEASRIARLSKTGRMADGRVIDAVSTNDGTIT
Ga0207676_112252342	3300026095	Switchgrass Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDAKIIDAVSDNDGRILQV
Ga0207675_1018687572	3300026118	Switchgrass Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVSDDA
Ga0208338_10000471	3300027514	Soil	MSFLDRFRKRTEDEASRIARLSKTGRMVDGKIIDAVYDN
Ga0209818_11405381	3300027637	Agricultural Soil	MSFLDRFRRKTEDEASRIARLAKTGRMTDGNIIDAVSDRDGKII
Ga0209485_10292091	3300027691	Agricultural Soil	MSFLDRFRRKTEDEASRIARLAKTGRMTDGNIIDAVSDRDGKI
Ga0209974_104235232	3300027876	Arabidopsis Thaliana Rhizosphere	MSFLDRFRRKTEDESARIARLSKTGRMADGKILDAVSDNDGRILQVTYAYTL
Ga0209481_104767502	3300027880	Populus Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMTDGNIIDAVSDNSGQ
Ga0268265_123221562	3300028380	Switchgrass Rhizosphere	MSFLDRFRKKPEDEASRIARLSRTGRMADGKILDAVSENDGR
Ga0268264_101391031	3300028381	Switchgrass Rhizosphere	MSFLDRFRRKTEDETTRIARLSRTGRMADGRILDAVSDNDGRILQV
Ga0268264_109832041	3300028381	Switchgrass Rhizosphere	MSFLDRFRKRTEDEASRIARLSKTGRMTDGNIIDAVSDNDG
Ga0268241_100700512	3300030511	Soil	MSFLNRFRRKTEDEPSRIARLSKTGRITDGQIVDAVSNGDGK
Ga0310813_111340352	3300031716	Soil	MSFLDRFRKKIEDEPSRIARLSKTGRMTDGNIIDAVSDRDGKITEV
Ga0310813_118343062	3300031716	Soil	MSFLDRFRKKIEDEASRIARLSKTGRMTDGNIIDAVSDNDGRI
Ga0307410_102668971	3300031852	Rhizosphere	MSFLDRFREKTEDEASRIERLSKTGRMGDGRIIDAVSDNDGRITEVVYTY
Ga0310884_110849931	3300031944	Soil	MSFLDRFRKKPEDEASRIERLSKTGRMADGRIIDAVSDNEGRITQ
Ga0310810_101740231	3300033412	Soil	MSFLDRFRKKTEDEASRIARLSKTGRMTDGNIIDAVSDNEGRIT
Ga0310810_112144662	3300033412	Soil	MSFLDRFRKKIEDEASRIERLSKTGRMADGRIIDAVSENDGRITQVT
Ga0334913_145971_392_505	3300034172	Sub-Biocrust Soil	MSFLDRFRKKTEDEASRIARLSKTGRMADGRIIDAVSD