Metagenome / Metatranscriptome Family F082926

Basic Information
Family ID	F082926
Family Type	Metagenome / Metatranscriptome
Number of Sequences	113
Average Sequence Length	41 residues
Representative Sequence	MPDISATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL
Number of Associated Samples	99
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	52.21 %
% of genes near scaffold ends (potentially truncated)	36.28 %
% of genes from short scaffolds (< 2000 bps)	78.76 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Bacteria (62.832 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (7.080 % of family members)
Environment Ontology (ENVO)	Unclassified (34.513 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (42.478 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.14% β-sheet: 18.92% Coil/Unstructured: 45.95%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF02735	Ku	23.89
PF07332	Phage_holin_3_6	7.96
PF12277	DUF3618	2.65
PF13432	TPR_16	1.77
PF01075	Glyco_transf_9	0.88
PF11737	DUF3300	0.88
PF05239	PRC	0.88
PF00534	Glycos_transf_1	0.88
PF13424	TPR_12	0.88
PF04860	Phage_portal	0.88
PF13844	Glyco_transf_41	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	23.89
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.88

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.83 %
Unclassified	root	N/A	37.17 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.83 %
Unclassified	root	N/A	37.17 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.83 %
Unclassified	root	N/A	37.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	35.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.17 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	13.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.17 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.17 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.17 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c0832303	All Organisms → cellular organisms → Bacteria	1128	Open in IMG/M
3300000041\|ARcpr5oldR_c000157	All Organisms → cellular organisms → Bacteria → Proteobacteria	11856	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104786448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	647	Open in IMG/M
3300000891\|JGI10214J12806_10242229	Not Available	1259	Open in IMG/M
3300000891\|JGI10214J12806_13002811	Not Available	545	Open in IMG/M
3300000953\|JGI11615J12901_10646024	Not Available	613	Open in IMG/M
3300004020\|Ga0055440_10211891	Not Available	504	Open in IMG/M
3300004024\|Ga0055436_10143881	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300004156\|Ga0062589_100942264	Not Available	800	Open in IMG/M
3300004157\|Ga0062590_102558814	Not Available	542	Open in IMG/M
3300004463\|Ga0063356_102190536	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300004479\|Ga0062595_102217131	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300005159\|Ga0066808_1025721	Not Available	596	Open in IMG/M
3300005162\|Ga0066814_10015114	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300005332\|Ga0066388_102179637	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300005336\|Ga0070680_100471696	All Organisms → cellular organisms → Bacteria	1073	Open in IMG/M
3300005337\|Ga0070682_102033761	Not Available	506	Open in IMG/M
3300005339\|Ga0070660_100306004	All Organisms → cellular organisms → Bacteria → Proteobacteria	1304	Open in IMG/M
3300005366\|Ga0070659_101011508	Not Available	730	Open in IMG/M
3300005455\|Ga0070663_100147329	All Organisms → cellular organisms → Bacteria → Proteobacteria	1802	Open in IMG/M
3300005458\|Ga0070681_10958560	Not Available	775	Open in IMG/M
3300005543\|Ga0070672_100000781	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18947	Open in IMG/M
3300005549\|Ga0070704_102110168	Not Available	524	Open in IMG/M
3300005564\|Ga0070664_100937220	All Organisms → cellular organisms → Bacteria	812	Open in IMG/M
3300005564\|Ga0070664_101548471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	628	Open in IMG/M
3300005617\|Ga0068859_100185596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2163	Open in IMG/M
3300005713\|Ga0066905_100116189	All Organisms → cellular organisms → Bacteria	1855	Open in IMG/M
3300005713\|Ga0066905_100198842	All Organisms → cellular organisms → Bacteria	1496	Open in IMG/M
3300005713\|Ga0066905_100979367	Not Available	745	Open in IMG/M
3300005764\|Ga0066903_103926848	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
3300005844\|Ga0068862_100584144	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300005937\|Ga0081455_10000051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	123542	Open in IMG/M
3300006038\|Ga0075365_11322155	Not Available	506	Open in IMG/M
3300006048\|Ga0075363_100830739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	563	Open in IMG/M
3300006186\|Ga0075369_10389597	All Organisms → cellular organisms → Bacteria	656	Open in IMG/M
3300006353\|Ga0075370_10562193	Not Available	690	Open in IMG/M
3300006576\|Ga0074047_11979111	Not Available	1030	Open in IMG/M
3300006579\|Ga0074054_12139948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2142	Open in IMG/M
3300006755\|Ga0079222_10363677	Not Available	985	Open in IMG/M
3300006755\|Ga0079222_10731702	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300006806\|Ga0079220_10490530	Not Available	836	Open in IMG/M
3300006854\|Ga0075425_100055985	All Organisms → cellular organisms → Bacteria	4418	Open in IMG/M
3300006931\|Ga0097620_101912344	Not Available	655	Open in IMG/M
3300006954\|Ga0079219_10293876	Not Available	1001	Open in IMG/M
3300009098\|Ga0105245_10985155	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300009156\|Ga0111538_11983252	Not Available	732	Open in IMG/M
3300009156\|Ga0111538_12149667	All Organisms → cellular organisms → Bacteria → Proteobacteria	701	Open in IMG/M
3300009551\|Ga0105238_10676371	Not Available	1043	Open in IMG/M
3300010046\|Ga0126384_10370646	All Organisms → cellular organisms → Bacteria	1200	Open in IMG/M
3300010046\|Ga0126384_11697258	Not Available	597	Open in IMG/M
3300010359\|Ga0126376_10384034	All Organisms → cellular organisms → Bacteria	1258	Open in IMG/M
3300010362\|Ga0126377_10006286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8906	Open in IMG/M
3300010371\|Ga0134125_10016153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8328	Open in IMG/M
3300010371\|Ga0134125_10604230	Not Available	1212	Open in IMG/M
3300010371\|Ga0134125_11094324	Not Available	872	Open in IMG/M
3300010373\|Ga0134128_10541191	All Organisms → cellular organisms → Bacteria	1297	Open in IMG/M
3300010373\|Ga0134128_12242006	All Organisms → cellular organisms → Bacteria → Proteobacteria	602	Open in IMG/M
3300010375\|Ga0105239_11602814	All Organisms → cellular organisms → Bacteria → Proteobacteria	753	Open in IMG/M
3300010400\|Ga0134122_11276331	Not Available	740	Open in IMG/M
3300010403\|Ga0134123_12797811	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300011119\|Ga0105246_10459707	All Organisms → cellular organisms → Bacteria → Proteobacteria	1072	Open in IMG/M
3300012487\|Ga0157321_1009313	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300012492\|Ga0157335_1046032	Not Available	507	Open in IMG/M
3300012493\|Ga0157355_1004032	All Organisms → cellular organisms → Bacteria → Proteobacteria	918	Open in IMG/M
3300012501\|Ga0157351_1003521	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300012513\|Ga0157326_1028059	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300012943\|Ga0164241_10853806	Not Available	664	Open in IMG/M
3300012955\|Ga0164298_10005605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4500	Open in IMG/M
3300014299\|Ga0075303_1004633	All Organisms → cellular organisms → Bacteria	1611	Open in IMG/M
3300014320\|Ga0075342_1001535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4412	Open in IMG/M
3300015200\|Ga0173480_10451039	All Organisms → cellular organisms → Bacteria	759	Open in IMG/M
3300015371\|Ga0132258_10311410	All Organisms → cellular organisms → Bacteria → Proteobacteria	3877	Open in IMG/M
3300015371\|Ga0132258_10838834	Not Available	2319	Open in IMG/M
3300015371\|Ga0132258_13613055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1057	Open in IMG/M
3300019356\|Ga0173481_10000643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7791	Open in IMG/M
3300019356\|Ga0173481_10001273	All Organisms → cellular organisms → Bacteria → Proteobacteria	6011	Open in IMG/M
3300022892\|Ga0247753_1003065	Not Available	1609	Open in IMG/M
3300023072\|Ga0247799_1108151	Not Available	505	Open in IMG/M
3300023077\|Ga0247802_1024185	All Organisms → cellular organisms → Bacteria → Proteobacteria	870	Open in IMG/M
3300025271\|Ga0207666_1009489	All Organisms → cellular organisms → Bacteria → Proteobacteria	1316	Open in IMG/M
3300025315\|Ga0207697_10097072	All Organisms → cellular organisms → Bacteria	1253	Open in IMG/M
3300025558\|Ga0210139_1073481	Not Available	697	Open in IMG/M
3300025885\|Ga0207653_10025413	All Organisms → cellular organisms → Bacteria → Proteobacteria	1894	Open in IMG/M
3300025900\|Ga0207710_10162646	All Organisms → cellular organisms → Bacteria	1088	Open in IMG/M
3300025904\|Ga0207647_10007983	All Organisms → cellular organisms → Bacteria → Proteobacteria	7609	Open in IMG/M
3300025912\|Ga0207707_10570969	Not Available	960	Open in IMG/M
3300025919\|Ga0207657_10010058	All Organisms → cellular organisms → Bacteria → Proteobacteria	9459	Open in IMG/M
3300025921\|Ga0207652_10738237	Not Available	877	Open in IMG/M
3300025944\|Ga0207661_10916479	All Organisms → cellular organisms → Bacteria → Proteobacteria	807	Open in IMG/M
3300025961\|Ga0207712_10053782	All Organisms → cellular organisms → Bacteria → Proteobacteria	2826	Open in IMG/M
3300025972\|Ga0207668_10445511	All Organisms → cellular organisms → Bacteria → Proteobacteria	1104	Open in IMG/M
3300026116\|Ga0207674_11065541	All Organisms → cellular organisms → Bacteria → Proteobacteria	778	Open in IMG/M
3300026142\|Ga0207698_10366830	All Organisms → cellular organisms → Bacteria → Proteobacteria	1365	Open in IMG/M
3300026712\|Ga0207548_101873	Not Available	608	Open in IMG/M
3300027385\|Ga0207540_105026	Not Available	539	Open in IMG/M
3300027411\|Ga0207519_105437	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300027433\|Ga0207618_101603	All Organisms → cellular organisms → Bacteria → Proteobacteria	559	Open in IMG/M
3300027445\|Ga0207554_101040	Not Available	900	Open in IMG/M
3300027765\|Ga0209073_10256293	Not Available	681	Open in IMG/M
3300028592\|Ga0247822_10518003	Not Available	946	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1150079	Not Available	517	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1006369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2809	Open in IMG/M
3300031538\|Ga0310888_10028217	All Organisms → cellular organisms → Bacteria	2444	Open in IMG/M
3300031716\|Ga0310813_10002265	All Organisms → cellular organisms → Bacteria → Proteobacteria	11699	Open in IMG/M
3300031820\|Ga0307473_10965909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	620	Open in IMG/M
3300031854\|Ga0310904_11131269	Not Available	562	Open in IMG/M
3300032000\|Ga0310903_10041375	Not Available	1718	Open in IMG/M
3300032017\|Ga0310899_10413751	All Organisms → cellular organisms → Bacteria → Proteobacteria	648	Open in IMG/M
3300033004\|Ga0335084_10135291	All Organisms → cellular organisms → Bacteria	2564	Open in IMG/M
3300034692\|Ga0373917_0039927	Not Available	690	Open in IMG/M
3300034817\|Ga0373948_0000891	All Organisms → cellular organisms → Bacteria	3984	Open in IMG/M
3300034817\|Ga0373948_0002503	All Organisms → cellular organisms → Bacteria	2728	Open in IMG/M
3300034819\|Ga0373958_0000894	All Organisms → cellular organisms → Bacteria	3845	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.72%
Host-Associated	Host-Associated	35.40%
Engineered	Engineered	0.89%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.06%
Plants	Host-Associated → Plants	35.40%
Aquatic	Environmental → Aquatic	2.65%
Bioremediation	Engineered → Bioremediation	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	61.06%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.70%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.16%
Roots	Host-Associated → Plants → Roots	3.54%
Marine	Environmental → Aquatic → Marine	2.65%
Metal	Engineered → Bioremediation → Metal	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.13%
Loam	Environmental → Terrestrial → Soil → Loam	11.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.62%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.54%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	3.54%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.65%
Sand	Environmental → Terrestrial → Soil → Sand	1.77%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.24%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	14.16%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.08%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.42%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.54%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.65%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.77%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.89%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	7.08%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	6.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.31%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	5.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	5.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.54%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.54%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	3.54%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	2.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.65%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	2.65%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	1.77%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.77%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	1.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.89%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.89%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Host-Associated	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300004020	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2	Environmental	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005159	Soil and rhizosphere microbial communities from Laval, Canada - mgLPB	Environmental	Open in IMG/M
3300005162	Soil and rhizosphere microbial communities from Laval, Canada - mgLAB	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated	Open in IMG/M
3300006186	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Host-Associated	Open in IMG/M
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated	Open in IMG/M
3300006576	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006579	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Host-Associated	Open in IMG/M
3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Host-Associated	Open in IMG/M
3300012493	Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610	Environmental	Open in IMG/M
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental	Open in IMG/M
3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Host-Associated	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300014299	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300022892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5	Environmental	Open in IMG/M
3300023072	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6	Environmental	Open in IMG/M
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental	Open in IMG/M
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025558	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026712	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1w-12 (SPAdes)	Environmental	Open in IMG/M
3300027385	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-11 (SPAdes)	Environmental	Open in IMG/M
3300027411	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-12 (SPAdes)	Environmental	Open in IMG/M
3300027433	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-11 (SPAdes)	Environmental	Open in IMG/M
3300027445	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K3-12 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300031150 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4	Environmental	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300034692	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3	Engineered	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_08323032	2228664021	Soil	MPELSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL
ARcpr5oldR_0001573	3300000041	Arabidopsis Rhizosphere	MPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
INPhiseqgaiiFebDRAFT_1047864482	3300000364	Soil	MQVNVREASMPDISATGQPEQSNIVTWKVISIGTALVLVVFLVLWL*
JGI10214J12806_102422294	3300000891	Soil	RMQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL*
JGI10214J12806_130028112	3300000891	Soil	MPELSATEHSEQSNIVTWKVISIGTAVVLVVFLVLWL*
JGI11615J12901_106460242	3300000953	Soil	MPELSATEQSEQSNIVTWKVISVGTAIVLVVFLFLWL*
Ga0055440_102118912	3300004020	Natural And Restored Wetlands	EASMPDISATEQSEQSNIVTWKATSIGTAIVLAVFLFLWL*
Ga0055436_101438812	3300004024	Natural And Restored Wetlands	MQANVREASMPDISATEQSEQSNIVTWKATSIGTAIVLVVFLFLWL*
Ga0062589_1009422641	3300004156	Soil	MQTNVREASMPDISATGQPEQSNIVTWKVISIGTAIVLVVFLVLWL*
Ga0062590_1025588141	3300004157	Soil	VREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL*
Ga0063356_1021905362	3300004463	Arabidopsis Thaliana Rhizosphere	MQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL*
Ga0062595_1022171312	3300004479	Soil	PPRRYCSCMQANVREASMPELSATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0066808_10257211	3300005159	Soil	MQANVREASVPGLSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0066814_100151141	3300005162	Soil	MQANVREASMPELSATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0066388_1021796371	3300005332	Tropical Forest Soil	MQVNVREASMPDISATGQPEQSNIVTWKVISIGTAVVLVVFLVLWL*
Ga0070680_1004716961	3300005336	Corn Rhizosphere	MQANVREASMPELSATEQPEQSNIVTWKVISVGTAIVLVVFLFLWL*
Ga0070682_1020337611	3300005337	Corn Rhizosphere	MQVNVREASMPDISATGQREQSNVVTWKVISIGTAVVLVVFLFLWL*
Ga0070660_1003060041	3300005339	Corn Rhizosphere	NVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0070659_1010115082	3300005366	Corn Rhizosphere	MQVNVREASMPDISATGQREQSNVVTWKVISIGTAIVLVVFLFLWL*
Ga0070663_1001473294	3300005455	Corn Rhizosphere	SRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0070681_109585601	3300005458	Corn Rhizosphere	SRMQANVREASMPELSATEQPEQSNIVTWKVISVGTAIVLVVFLFLWL*
Ga0070672_10000078111	3300005543	Miscanthus Rhizosphere	MPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL*
Ga0070704_1021101681	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MQANLREASMPDFSAMEQPEQSNIVTWKVISTGTAIVVVVFLFLWL*
Ga0070664_1009372203	3300005564	Corn Rhizosphere	MPELSATEQPQQSNIVTWKVISIGTAIVLIVFLFLWF*
Ga0070664_1015484711	3300005564	Corn Rhizosphere	MPDISATGQREQSNVVTWKVISIGTAVVLVVFLFLWL*
Ga0068859_1001855963	3300005617	Switchgrass Rhizosphere	MPELSATEQPQQSNIVTWKVISIGTAIVLIVLLFLWF*
Ga0066905_1001161893	3300005713	Tropical Forest Soil	MPDISATGQPEQSNIVTWKVISIGTAIVLVVFLVLWL*
Ga0066905_1001988422	3300005713	Tropical Forest Soil	MPDISATGQPEQSNIVTWKVISIGTAVVLVVFLVLWL*
Ga0066905_1009793672	3300005713	Tropical Forest Soil	MQANVREASMPDISATGQPEQSNIVTWKVISIGTAIVLVVFLVLWL*
Ga0066903_1039268481	3300005764	Tropical Forest Soil	MPDISATEPTEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0068862_1005841442	3300005844	Switchgrass Rhizosphere	MPDISATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0081455_1000005150	3300005937	Tabebuia Heterophylla Rhizosphere	MPDISATGQPEQGNIVTWKVISIGTAIVLVVFLVLWL*
Ga0075365_113221551	3300006038	Populus Endosphere	REASMPDISATGQPEQSSIVTWRVISIGTAIVLVVFLFLWL*
Ga0075363_1008307391	3300006048	Populus Endosphere	MPDISATGQREQSNVVTWKVISIGTAIVLVVFLFLWL*
Ga0075369_103895971	3300006186	Populus Endosphere	MPELSATEQSEQSNIVTWKVISVGTAIVLVVFLFLWL
Ga0075370_105621932	3300006353	Populus Endosphere	LSATEQPQQSNIVTWKVISIGTAIVLIVFLFLWF*
Ga0074047_119791111	3300006576	Soil	GLSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0074054_121399483	3300006579	Soil	MPDISATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0079222_103636771	3300006755	Agricultural Soil	TPSCGYRSGMQASAGEASMPDISATEQSEQSSIVTWRVISIGTAIVLVVFLVLWL*
Ga0079222_107317023	3300006755	Agricultural Soil	MPDISATGQPEQSNVVTWKVISIGTAIVLVVFLFLWL*
Ga0079220_104905302	3300006806	Agricultural Soil	MPDISATEQSEQSSIVTWRVISIGTAIVLVVFLVLWL*
Ga0075425_1000559858	3300006854	Populus Rhizosphere	MPDISATGPPEQSNIVTWKVISIGTAIVLTVFLVLWL*
Ga0097620_1019123441	3300006931	Switchgrass Rhizosphere	MPDFSAMEQPEQSNIVTWKVISTGTAIVVVVFLFLWL*
Ga0079219_102938761	3300006954	Agricultural Soil	QVNVREASMPDISATGQREQSNVVTWKVISIGTAVVLVVFLFLWL*
Ga0105245_109851552	3300009098	Miscanthus Rhizosphere	MPDISATEQPEQSHIVTWKVISIGTAVVLVVFLFLWL*
Ga0111538_119832522	3300009156	Populus Rhizosphere	MPDISATGQPEQSSIVTWRVISIGTAIVLVVFLFLWL*
Ga0111538_121496672	3300009156	Populus Rhizosphere	MQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0105238_106763711	3300009551	Corn Rhizosphere	NVREASMPDISATGQREQSNVVTWKVISIGTAVVLVVFLFLWL*
Ga0126384_103706462	3300010046	Tropical Forest Soil	MPDVSATGQPDQSNIVTWKVISIGTAIVLVVFLVLWL*
Ga0126384_116972582	3300010046	Tropical Forest Soil	MQANVREASMPDISATGQPEQSNIVTWKVILIGTAIVLVVFLVLWL*
Ga0126376_103840341	3300010359	Tropical Forest Soil	MPDISATEQPEQSNIVTWKVISIGTAIVLAVFLFLWF*
Ga0126377_100062861	3300010362	Tropical Forest Soil	MPDISATGQPEQSHVVTWKVISIGTAVVLVVFLVLWL*
Ga0134125_100161531	3300010371	Terrestrial Soil	SMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL*
Ga0134125_106042301	3300010371	Terrestrial Soil	MPELSATEQPEQSNIVTWKVISVGTAIVLVVFLFLWL*
Ga0134125_110943241	3300010371	Terrestrial Soil	NVREASMPDISATGQPEQSNVVTWKVISIGTAIVLVVFLFLWL*
Ga0134128_105411912	3300010373	Terrestrial Soil	MPELSATEQPQQSNIVTWKVISIGTAIVLIVFLFLWL*
Ga0134128_122420061	3300010373	Terrestrial Soil	ASRLPDTVSRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0105239_116028142	3300010375	Corn Rhizosphere	MPELSATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0134122_112763311	3300010400	Terrestrial Soil	RRYCSRKQANVREASMPELSATEQPQQSNIVTWKVISIGTAIVLIVFLFLWF*
Ga0134123_127978112	3300010403	Terrestrial Soil	PDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0105246_104597071	3300011119	Miscanthus Rhizosphere	SRLPDTVSRMQANVREASMPELSATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL*
Ga0157321_10093131	3300012487	Arabidopsis Rhizosphere	MPELSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0157335_10460321	3300012492	Arabidopsis Rhizosphere	CSGMPVNVREASMPELSATEQPEQGNIVTWKVISIGTAIVLVVFLFLWL*
Ga0157355_10040321	3300012493	Unplanted Soil	ANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0157351_10035212	3300012501	Unplanted Soil	MPELSATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL*
Ga0157326_10280591	3300012513	Arabidopsis Rhizosphere	MPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFL
Ga0164241_108538061	3300012943	Soil	MPELSATDHTGQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0164298_100056055	3300012955	Soil	MPELSATELPEQSNIVTWKVISIGTAIVVVVFLFLWL*
Ga0075303_10046332	3300014299	Natural And Restored Wetlands	MPDISATEQSEQSNIVTWKATSIGTAIVLVVFLFLWL*
Ga0075342_10015353	3300014320	Natural And Restored Wetlands	MPDISATEQSEQSNIVTWKATSIGTAIVLAVFLFLWL*
Ga0173480_104510392	3300015200	Soil	MPDISATGQPEQSNIVTWKVISIGTAIVLVVFLFLWL*
Ga0132258_103114103	3300015371	Arabidopsis Rhizosphere	MPELSATEQPEQGNIVTWKVISIGTAIVLVVFLVLWL*
Ga0132258_108388341	3300015371	Arabidopsis Rhizosphere	MPDISATEQSEQSNIVTWKVISIGTAIVLLVFLFLWL*
Ga0132258_136130552	3300015371	Arabidopsis Rhizosphere	MPELSATEQPQQSNIVTWKVISIGTAVVLIVFLFLWF*
Ga0173481_100006435	3300019356	Soil	MPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
Ga0173481_1000127314	3300019356	Soil	MPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0247753_10030655	3300022892	Soil	SMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
Ga0247799_11081512	3300023072	Soil	MQANLREASMPDFSAMEQPEQSNIVTWKVISTGTAIVVVVFLFLWL
Ga0247802_10241851	3300023077	Soil	PDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207666_10094893	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	MPELSATEQPQQSNIVTWKVISIGTAIVLVVFLFLWL
Ga0207697_100970722	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MPELSATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL
Ga0210139_10734811	3300025558	Natural And Restored Wetlands	MPDISATEQSEQSNIVTWKATSIGTAIVLAVFLFLWL
Ga0207653_100254135	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	RRKPPRRYCSCMQANVREASMPELSATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207710_101626462	3300025900	Switchgrass Rhizosphere	MPELSATEQPQQSNIVTWKVISIGTAIVLIVFLFLWF
Ga0207647_1000798315	3300025904	Corn Rhizosphere	MPDISATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL
Ga0207707_105709692	3300025912	Corn Rhizosphere	MPELSATEQPEQSNIVTWKVISVGTAIVLVVFLFLWL
Ga0207657_1001005822	3300025919	Corn Rhizosphere	MQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207652_107382371	3300025921	Corn Rhizosphere	MPDISATGQPEQSNVVTWKVISIGTAIVLVVFLFLWL
Ga0207661_109164792	3300025944	Corn Rhizosphere	REASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207712_100537821	3300025961	Switchgrass Rhizosphere	TVSRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207668_104455113	3300025972	Switchgrass Rhizosphere	DTVSRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207674_110655411	3300026116	Corn Rhizosphere	VSRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207698_103668301	3300026142	Corn Rhizosphere	PPRRYCSCMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207548_1018732	3300026712	Soil	MPDISATEQPEQSHIVTWKVISIGTAIVVVVFLFLWL
Ga0207540_1050262	3300027385	Soil	MPELSATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207519_1054372	3300027411	Soil	MPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFL
Ga0207618_1016031	3300027433	Soil	QANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0207554_1010403	3300027445	Soil	PSHRREPPRRYFSRMQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
Ga0209073_102562932	3300027765	Agricultural Soil	MPDISATEQSEQSSIVTWRVISIGTAIVLVVFLVLWL
Ga0247822_105180031	3300028592	Soil	MPELSAMEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
(restricted) Ga0255311_11500792	3300031150	Sandy Soil	MPELSATEQPEQSHIVTWKVISIGTAIVLVVFLFLWV
(restricted) Ga0255312_10063693	3300031248	Sandy Soil	MPELSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWV
Ga0310888_100282174	3300031538	Soil	MPELSAMEQPEQSNIVTWKVISIGTAIVVVVFLFL
Ga0310813_100022658	3300031716	Soil	MPDISATEHPEQSNIVTWKVISIGTAIVLVVFLFLWL
Ga0307473_109659092	3300031820	Hardwood Forest Soil	MPDISATGQPEQSNIVTWKVISIGTAIVLVVFLFLWL
Ga0310904_111312692	3300031854	Soil	MQANVREASVPGLSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWL
Ga0310903_100413751	3300032000	Soil	YCSCMQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
Ga0310899_104137511	3300032017	Soil	SRMQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0335084_101352912	3300033004	Soil	MPDISVTEQSEQSTIVTWKVISIGTAIVLVVFLLLWL
Ga0373917_0039927_521_661	3300034692	Sediment Slurry	MQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVLVVFLFLWI
Ga0373948_0000891_351_491	3300034817	Rhizosphere Soil	MQANVREASMPELSATEQPEQSHIVTWKVISIGTAIVLVVFLFLWL
Ga0373948_0002503_2019_2159	3300034817	Rhizosphere Soil	MQANVREASMPELSATEQPEQSNIVTWKVISIGTAIVVVVFLFLWL
Ga0373958_0000894_3664_3804	3300034819	Rhizosphere Soil	MQANVREASMPDISATEQPEQSHIVTWKVISIGTAIVTVVFLFLWL

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters