| Basic Information | |
|---|---|
| Family ID | F082653 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MYDSTTVTIGLDVHARSIRLAAVRADELLEERTLPYDEEAVERVL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.04 % |
| % of genes near scaffold ends (potentially truncated) | 76.11 % |
| % of genes from short scaffolds (< 2000 bps) | 92.04 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.841 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.814 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.434 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 7.96 |
| PF01548 | DEDD_Tnp_IS110 | 5.31 |
| PF13668 | Ferritin_2 | 1.77 |
| PF08734 | GYD | 1.77 |
| PF01458 | SUFBD | 0.88 |
| PF07040 | DUF1326 | 0.88 |
| PF01968 | Hydantoinase_A | 0.88 |
| PF06772 | LtrA | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF04185 | Phosphoesterase | 0.88 |
| PF05157 | T2SSE_N | 0.88 |
| PF13340 | DUF4096 | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| PF00753 | Lactamase_B | 0.88 |
| PF01245 | Ribosomal_L19 | 0.88 |
| PF13683 | rve_3 | 0.88 |
| PF03704 | BTAD | 0.88 |
| PF13413 | HTH_25 | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF01551 | Peptidase_M23 | 0.88 |
| PF01336 | tRNA_anti-codon | 0.88 |
| PF14279 | HNH_5 | 0.88 |
| PF11799 | IMS_C | 0.88 |
| PF00211 | Guanylate_cyc | 0.88 |
| PF08327 | AHSA1 | 0.88 |
| PF04055 | Radical_SAM | 0.88 |
| PF14492 | EFG_III | 0.88 |
| PF01642 | MM_CoA_mutase | 0.88 |
| PF00294 | PfkB | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 13.27 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.77 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.88 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.88 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.88 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.88 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.84 % |
| Unclassified | root | N/A | 14.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01AI2TW | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 2070309009|GPKNP_F5JHDJD02JGBTI | Not Available | 520 | Open in IMG/M |
| 2070309009|GPKNP_GG3DY5402JBBUR | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 2170459010|GIO7OMY02HA6TX | Not Available | 534 | Open in IMG/M |
| 2170459010|GIO7OMY02HMSDL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 2170459019|G14TP7Y01D9A8I | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 2199352033|2207089163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300000956|JGI10216J12902_120491104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300003373|JGI25407J50210_10008918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2533 | Open in IMG/M |
| 3300003996|Ga0055467_10114367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300004081|Ga0063454_102055813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300004114|Ga0062593_103475272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300004157|Ga0062590_100857897 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005167|Ga0066672_10946790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300005172|Ga0066683_10470626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| 3300005175|Ga0066673_10417168 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005175|Ga0066673_10728092 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005176|Ga0066679_11021625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300005451|Ga0066681_10982370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 504 | Open in IMG/M |
| 3300005468|Ga0070707_100299037 | Not Available | 1564 | Open in IMG/M |
| 3300005534|Ga0070735_10636470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300005536|Ga0070697_102116598 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005540|Ga0066697_10116522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1565 | Open in IMG/M |
| 3300005569|Ga0066705_10226067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1181 | Open in IMG/M |
| 3300005764|Ga0066903_101103771 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005764|Ga0066903_101823266 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300005937|Ga0081455_10524984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 789 | Open in IMG/M |
| 3300006032|Ga0066696_10744003 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006578|Ga0074059_12115955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300006800|Ga0066660_11010464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300006806|Ga0079220_10973798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300006854|Ga0075425_100235413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2107 | Open in IMG/M |
| 3300006871|Ga0075434_100728516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1009 | Open in IMG/M |
| 3300007076|Ga0075435_100040544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3719 | Open in IMG/M |
| 3300009012|Ga0066710_104809655 | Not Available | 505 | Open in IMG/M |
| 3300009038|Ga0099829_11262530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300009088|Ga0099830_11356012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300009089|Ga0099828_10932077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300009430|Ga0114938_1332506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300009551|Ga0105238_12693432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300009553|Ga0105249_11227624 | Not Available | 821 | Open in IMG/M |
| 3300009807|Ga0105061_1041813 | Not Available | 678 | Open in IMG/M |
| 3300009815|Ga0105070_1062561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300009820|Ga0105085_1016536 | Not Available | 1273 | Open in IMG/M |
| 3300010036|Ga0126305_11129209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300010039|Ga0126309_10704367 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010040|Ga0126308_10259644 | Not Available | 1132 | Open in IMG/M |
| 3300010047|Ga0126382_12080267 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010304|Ga0134088_10537839 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010323|Ga0134086_10187783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300010359|Ga0126376_12856181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300010360|Ga0126372_13314594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300012008|Ga0120174_1022810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1962 | Open in IMG/M |
| 3300012093|Ga0136632_10119275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1218 | Open in IMG/M |
| 3300012189|Ga0137388_11130681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300012201|Ga0137365_11196291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300012206|Ga0137380_10784288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300012206|Ga0137380_11290875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300012211|Ga0137377_10333341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1453 | Open in IMG/M |
| 3300012211|Ga0137377_11131693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300012350|Ga0137372_10011486 | All Organisms → cellular organisms → Bacteria | 8489 | Open in IMG/M |
| 3300012353|Ga0137367_10418035 | Not Available | 950 | Open in IMG/M |
| 3300012353|Ga0137367_11075218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300012356|Ga0137371_10223839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1471 | Open in IMG/M |
| 3300012356|Ga0137371_10310765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1227 | Open in IMG/M |
| 3300012356|Ga0137371_11363181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300012532|Ga0137373_10919530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300012683|Ga0137398_10547548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300012684|Ga0136614_10157707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1718 | Open in IMG/M |
| 3300012684|Ga0136614_10543716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 833 | Open in IMG/M |
| 3300012951|Ga0164300_10964889 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012955|Ga0164298_11412124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300012964|Ga0153916_11214785 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012975|Ga0134110_10361824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300014031|Ga0120173_1047989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300014302|Ga0075310_1089349 | Not Available | 642 | Open in IMG/M |
| 3300014881|Ga0180094_1104833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300015357|Ga0134072_10116526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300015358|Ga0134089_10130065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 983 | Open in IMG/M |
| 3300015359|Ga0134085_10284823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300015372|Ga0132256_103139044 | Not Available | 556 | Open in IMG/M |
| 3300017657|Ga0134074_1319244 | Not Available | 568 | Open in IMG/M |
| 3300017695|Ga0180121_10384155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300017787|Ga0183260_10687176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300017997|Ga0184610_1155303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300018027|Ga0184605_10531569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300018029|Ga0187787_10207112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300018061|Ga0184619_10348077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300018431|Ga0066655_11299514 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018433|Ga0066667_10999312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300018433|Ga0066667_11621049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300019487|Ga0187893_10735014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300022213|Ga0224500_10382043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300025289|Ga0209002_10359379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300025313|Ga0209431_10121932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2058 | Open in IMG/M |
| 3300025552|Ga0210142_1013753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1485 | Open in IMG/M |
| 3300025567|Ga0210076_1083953 | Not Available | 696 | Open in IMG/M |
| 3300025922|Ga0207646_10139416 | Not Available | 2183 | Open in IMG/M |
| 3300025930|Ga0207701_11154007 | Not Available | 640 | Open in IMG/M |
| 3300026295|Ga0209234_1198830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300026343|Ga0209159_1136878 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300026550|Ga0209474_10063173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2598 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10003360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5064 | Open in IMG/M |
| 3300027846|Ga0209180_10567506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300027875|Ga0209283_10514620 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027915|Ga0209069_10505146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300030619|Ga0268386_10814865 | Not Available | 595 | Open in IMG/M |
| 3300031235|Ga0265330_10012002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4054 | Open in IMG/M |
| 3300031247|Ga0265340_10202965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300031249|Ga0265339_10315810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
| 3300032256|Ga0315271_10268656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1392 | Open in IMG/M |
| 3300032256|Ga0315271_10561528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300032828|Ga0335080_10657751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.19% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.77% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.89% |
| Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2199352033 | Cave microbial community (Wet rock wall) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_5076030 | 2035918004 | Soil | MFESTTVSVGLDVHARSIRLAAVRAEELLDERTLPYDEEAV |
| GPKNP_02109700 | 2070309009 | Soil | MYDSTTVAVGLDVHARSIRLAAVRADELLEERSLPYDEEAVERALHCW |
| GPKNP_01853730 | 2070309009 | Soil | MFESMTVTVGLDVHANLVRLAAVRADELLEERTLPYDHDAVERVLRG |
| F62_00593020 | 2170459010 | Grass Soil | MFESMTVSVGLDVHARSVRLAALRVDELLGGADVAV |
| F62_07539860 | 2170459010 | Grass Soil | MVEFMTVAVGVDVHARSIRVAAVCAEELLEERTLPYDEEAVVRLLRRWPGVRCCYEAGPT |
| 4MG_00309100 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MVESTTVTVGLDVHARSIRLAAVRADELLEERTLPCDEQAVERLLRRW |
| 2208897601 | 2199352033 | Speleothem And Rock Wall Surfaces | MYDSTTTVTVGLDVHARSIRLAVVRADELLEERTLAYDEEAVERV |
| JGI10216J12902_1204911042 | 3300000956 | Soil | MYESTAVAVGLDVHARSIRLAAVRADELLEERTLPYD |
| JGI25407J50210_100089181 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MHDCRAGTVSVGLDVHAASIRLAAVRADELLEECTLPYDHEAVERRL |
| Ga0055467_101143671 | 3300003996 | Natural And Restored Wetlands | MVESTTVSVGLDVHARSIRLAAVCADELLVERTLPYDEQAVERLLRRWPRVRCLL* |
| Ga0063454_1020558132 | 3300004081 | Soil | MHESTTVTVGLDVHARSIRLAAVRADELLEERTLPNEEAV |
| Ga0062593_1034752721 | 3300004114 | Soil | MIESMTVTVGLDVHARSIRLAAVRADELVEERTLPYDEDAVARLLGRWPAVRCCYEAG |
| Ga0062590_1008578971 | 3300004157 | Soil | MSESRTVTVSLDVHARSIRFAAVRGEELLEDRTPPCDYEALERALGCWP* |
| Ga0066672_109467902 | 3300005167 | Soil | MYDSTTTVTVGLDVHARSIRVAAVRADELLAERTLPYDEEAVERVLRRWPVVRCCYE |
| Ga0066683_104706262 | 3300005172 | Soil | MCDSTTTVAVGLDVHAGSIRLATVRADELLEERTLAYDGEAVERALRRWPGARCCYRLRPFREGGGVDGL |
| Ga0066673_104171681 | 3300005175 | Soil | MCDSTTTVAVGLDVHARSIRLAAVRADELLEERTLPYDEEAVE |
| Ga0066673_107280921 | 3300005175 | Soil | MYDSRTTVTVGLDVHARSMRLAAVRADELLEERTLPYDEEAVER |
| Ga0066679_110216251 | 3300005176 | Soil | MSESTAVTVGLDVHARSIRLAAVRADELLEERSLPYDEDAVERLLRRWPAVRCCYEA |
| Ga0066681_109823701 | 3300005451 | Soil | MYDCTTVTIGLDVHARSVRLAAVRADQLLEERTLPYDEEAVE |
| Ga0070707_1002990373 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDSTTVSVGLDVHAGSVLLAAVRADELLEERLLAYDLEAVARCLGRWPGVRCCYEAGPPSTGSPARRRR* |
| Ga0070735_106364701 | 3300005534 | Surface Soil | MSESMTVTVGLDVHARSIRLAAVCADELVEERTLPYDEDVVE |
| Ga0070697_1021165981 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDSTTTVAVGLDVHARSIRLAAVRADELLEERTLPYDEEAVE |
| Ga0066697_101165221 | 3300005540 | Soil | MYDSTTTVAVGLDVHARSIRVAAVRADELLEERTLR* |
| Ga0066705_102260672 | 3300005569 | Soil | MYDSTTTVTVGLDVHDRSIRLAVVRADELLEERTPAYDEDAVERVLRRWPSTAARASGRRQG* |
| Ga0066903_1011037713 | 3300005764 | Tropical Forest Soil | MVESTTVTVGLDVHARSIRLAAVRADELLAERTLPYDEEAVERLLQRWPGVRCCYEA |
| Ga0066903_1018232661 | 3300005764 | Tropical Forest Soil | MFESTMVSVGLDVHACSVRFAAVRAEELLEERTLPYDQEAVARV |
| Ga0081455_105249843 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPHTTPVTVGLDVHARSVRLAALRDDELLEECTLPYDHTAIERSIGRWPGARACYE |
| Ga0066696_107440032 | 3300006032 | Soil | MYDSTTVTIGLDVHARSIRLAAVRADQLLEERTLPYDEEAVERVLRRWPGVRCCYE |
| Ga0074059_121159551 | 3300006578 | Soil | MIESMTVTVGLDVHARSIRLAAVRADELLEERTLPYDEEAVARLL |
| Ga0066660_110104642 | 3300006800 | Soil | MYDSTTTVTVGLDVHARSIRLAVVRADELLEERTLAYDEEAVERVLRRWPSTAARASGRRQG* |
| Ga0079220_109737981 | 3300006806 | Agricultural Soil | MVESTTVTVGVAVHARSIRLAAVRGDELLEERSLPFDEEAVERLLRRWPAVRCC* |
| Ga0075425_1002354132 | 3300006854 | Populus Rhizosphere | MSESTTVSVGLDVHARSIRLAAVCADELLEERTLAYDEEAVERLLRRWPAVRCC* |
| Ga0075434_1007285163 | 3300006871 | Populus Rhizosphere | MSESTTVTVGLDVHARSIRLAAVCADELLEERTLAYDEEAVERLLRRWPAVRCCYEA |
| Ga0075435_1000405442 | 3300007076 | Populus Rhizosphere | MSESRTVAIGLDVHAASVRLAVVRGNELLDERTLPYDHEAVERAVRRW |
| Ga0066710_1048096551 | 3300009012 | Grasslands Soil | MTDPRAVAVGLDVHKSSVRLAAVRAGEVLAERTLAHEHEAVIAALASWPGAR |
| Ga0099829_112625301 | 3300009038 | Vadose Zone Soil | MYDSTTTVTVGLDVHARSVRLAAVRADELLEERALPYDEEAVERVL |
| Ga0099830_113560121 | 3300009088 | Vadose Zone Soil | MFESTTVTVGLDVHASSIRLAAVRGDELLDERTLGYDLEAVERFLRRWPAVCCCYEAGP |
| Ga0099828_109320771 | 3300009089 | Vadose Zone Soil | MFESTTVSVGLDVHARSIRLAAVRADELLEERTLPYDEEAVERVLRRWPAVRCC |
| Ga0114938_13325061 | 3300009430 | Groundwater | MHEDTTVTVGLDVHARSIRLAAISADELLDERTLPY |
| Ga0105238_126934321 | 3300009551 | Corn Rhizosphere | MYDSTTTVAVGLDVHAGSIRLAAVRADELLEERTLAYDEEAVEWALRRWPGA |
| Ga0105249_112276241 | 3300009553 | Switchgrass Rhizosphere | MFVSTGVIVGLDVDARSIRLAALRAEELLEERTLPYDEEAVE |
| Ga0105061_10418131 | 3300009807 | Groundwater Sand | MTVAVGLDVHARSIRFAALRADELLEERTLPYDEAAVERALRRW |
| Ga0105070_10625611 | 3300009815 | Groundwater Sand | MFESTTVSVGLDVHARSVRLAAVRADELLEERTLAYDEE |
| Ga0105085_10165361 | 3300009820 | Groundwater Sand | MNESRTVTVGLDVHASSIWLAAVRRDELLDERTLPYEQAAVER |
| Ga0126305_111292092 | 3300010036 | Serpentine Soil | MLESRTVTVGLDVHARSIRLAAVRADELLEERTLPYDEEQVERL |
| Ga0126309_107043672 | 3300010039 | Serpentine Soil | MSESRTVTVGLDVHASPIRLAAVRGEELLEERTLPYDYEAL |
| Ga0126308_102596442 | 3300010040 | Serpentine Soil | MFESTTVAVGLDVHARSVRLAAVRADELLEERTLPYDEEAVERALRR |
| Ga0126382_120802671 | 3300010047 | Tropical Forest Soil | VGLDVHARSIRLAAVRADELLEERSLPYDEQAVERLLRRWPGARCCYE |
| Ga0134088_105378391 | 3300010304 | Grasslands Soil | MDESRTVTVGLDVHAGSIRLAAVRGVELLEERTLPYDHEA |
| Ga0134086_101877832 | 3300010323 | Grasslands Soil | MYDSTTAVTVGLDVHARSIRLAAVRADELLEERTLVYDEEAVARALRRWPVVLLLRG |
| Ga0126376_128561811 | 3300010359 | Tropical Forest Soil | MFESTMVSVGLDVHACSVRFAAVRAEELLEERTLPYDQEAVARVLRRWP |
| Ga0126372_133145941 | 3300010360 | Tropical Forest Soil | MNESRTVTVGLDVHARSVRLAAVRADELLEERTLPYDEAAVERALRRW |
| Ga0120174_10228101 | 3300012008 | Permafrost | MTAVAVGLDVHARSVRLAVVRAGELLEERTLPYDEEALERVLRRWPVVRCCYAAG |
| Ga0136632_101192752 | 3300012093 | Polar Desert Sand | MDDSTMTVAVGLDVHARSIRLAAVRADGLLEERTLPYDERVVERALRR* |
| Ga0137388_111306812 | 3300012189 | Vadose Zone Soil | MDESTTVTVGLDVHARSIRVAAVRADELLEERTLP |
| Ga0137365_111962911 | 3300012201 | Vadose Zone Soil | MTTVTVGLDVHARSVRLAAVCADELLEERTLAYDEEAVERVLRRWPVVRCC* |
| Ga0137380_107842882 | 3300012206 | Vadose Zone Soil | TVTVGLDVHARSIRLAAVRADELLEERTLPYDEDTVERVLRRWPGVRCC* |
| Ga0137380_112908751 | 3300012206 | Vadose Zone Soil | MFESTTVTVGLDVHARSIRLAAVRADELLEERTLPYDEEAVERLLRRWPSVRLLL* |
| Ga0137377_103333412 | 3300012211 | Vadose Zone Soil | MSESTTVTVGLDVHARSIRLAAVRADELLEERTLPYDEDTVERVLRRWPGVRCC* |
| Ga0137377_111316931 | 3300012211 | Vadose Zone Soil | MYDSTTTVTVGLDVHVRSVRLAAVRADELLEERTLPYDEGAVERVLRRWPTVRCC* |
| Ga0137372_100114863 | 3300012350 | Vadose Zone Soil | MVESTTVAVGLDLHARSIRLAVLRADELLEEPTLP* |
| Ga0137367_104180351 | 3300012353 | Vadose Zone Soil | MFESTTVPVGLDARSVRLAAVRGDELLEERTLAYDEEA |
| Ga0137367_110752181 | 3300012353 | Vadose Zone Soil | MYDSTTVTIGLDVHARSIRLAAVRADELLEERTLPYDEEAVERVL |
| Ga0137371_102238392 | 3300012356 | Vadose Zone Soil | MKESAAVTVGLDVHASSIRLAAVRSDELLDERTLA* |
| Ga0137371_103107651 | 3300012356 | Vadose Zone Soil | MREPTPVPVGLDVHARSIRLAAVRADELLEERTLPYDEGAVERVLRRWPTVRCC* |
| Ga0137371_113631811 | 3300012356 | Vadose Zone Soil | LDVHARSIRLAAVRADELLEERTIPYDEGAVERMLRRWPAVRCCYEAGP |
| Ga0137373_109195301 | 3300012532 | Vadose Zone Soil | MYDSTTVTIGLDVHARSIRLAAVRADELLEERTLPYDEE |
| Ga0137398_105475481 | 3300012683 | Vadose Zone Soil | MYDSTTTVTVGLDVHARSIRLAAVRADELLEERTLAYDEDAVERV |
| Ga0136614_101577073 | 3300012684 | Polar Desert Sand | MNDFTSSTVSVGLDVHASSIRVAVVRADELLVERTLPYDHGAVERELKRW |
| Ga0136614_105437163 | 3300012684 | Polar Desert Sand | LDVHATSIRLAAVRADELLDERTLPYDHEAIERAISRWPGAQACYEAGPTGYGFSAI* |
| Ga0164300_109648891 | 3300012951 | Soil | MIESTTVTVGLDVHARSIRLAAVRAEELLEERTLPYDEEGVVRLLRQWPTVR |
| Ga0164298_114121242 | 3300012955 | Soil | MRESRTVTVGLDVHARSIRLAAVRSDELLEERTLPYDEDAVARLLGRWPAVRCC* |
| Ga0153916_112147851 | 3300012964 | Freshwater Wetlands | MYDSTTTVTVGLDVHARSVRLAAVRADELLEERTLPYDEEAVE |
| Ga0134110_103618242 | 3300012975 | Grasslands Soil | MSESTTVTIGLDVHASSIRFAAIRADELLEERTLAY |
| Ga0120173_10479892 | 3300014031 | Permafrost | MYDSTTTVAVGLDVHARSIRLAAVRADELLEERTRPHGQ |
| Ga0075310_10893491 | 3300014302 | Natural And Restored Wetlands | MHEGTSATVYVGLDVHAASIRLAAVRADELLDERT |
| Ga0180094_11048331 | 3300014881 | Soil | MSESRTVTVGLDVHARSIRLAAIRGDELLTERTLPYDEEAVERVLRGWPRVR |
| Ga0134072_101165261 | 3300015357 | Grasslands Soil | MSDFTGATVAVGLDVHAASIRLAAVRADELVDERTLPYDHEAVERAVRCWPGAR |
| Ga0134089_101300653 | 3300015358 | Grasslands Soil | MYDSTTTVAVGLDVHARSIRLAAVRADELLEERTLP |
| Ga0134085_102848231 | 3300015359 | Grasslands Soil | MCDSTTTVAVGLDVHAGSIRLATVRADELLEERTLAYDGEAVERALRRW |
| Ga0132256_1031390441 | 3300015372 | Arabidopsis Rhizosphere | MVESMPVTVGLDVDARSIRLAAVGADELLDERALPYDEVA |
| Ga0134074_13192441 | 3300017657 | Grasslands Soil | MSESMTVAVGLDVHARSIRLAAVRADELLEERTLSYDEEAVERALRRWPAVRCCYEA |
| Ga0180121_103841551 | 3300017695 | Polar Desert Sand | MNDFTSGTVSVGLDVHAASIRLAAVRADELLEERTLPYDHEAV |
| Ga0183260_106871762 | 3300017787 | Polar Desert Sand | MNDFTSSTVSVGLDVHASSIRVAVVRADELLVERTLPYDHGAVERERW |
| Ga0184610_11553032 | 3300017997 | Groundwater Sediment | MYDSTTTTVTVGLDVHARSVRLAAVRADELLEERTLPYDHAAVERALARWQGARVCYEAG |
| Ga0184605_105315691 | 3300018027 | Groundwater Sediment | MNESMTVTVGLDVHARSIRLAAVRVDELLEERTLP |
| Ga0187787_102071121 | 3300018029 | Tropical Peatland | MSESTTVTVGLDVHARSIRLAAVRADELLEERTLPYDEEW |
| Ga0184619_103480771 | 3300018061 | Groundwater Sediment | MYDSTTTVTVGLDVHARSIRLAAIRGDQLLEERTLPYNEEAVEQVLRRWPAARCC |
| Ga0066655_112995142 | 3300018431 | Grasslands Soil | MYDSTTTVAVGLDVHARSIRLAAVRADELLEERTLPYDEEAVERVLRRWPGV |
| Ga0066667_109993121 | 3300018433 | Grasslands Soil | MYDSMTAVAVGLDVHARSIRVAAVRADELLEERTLPYNEEQVERLLRRWPSVRCCYEA |
| Ga0066667_116210491 | 3300018433 | Grasslands Soil | MYDSTTTVAVGLDVHARSIRLAAARADELLEERTLPYDEEAGERAG |
| Ga0187893_107350141 | 3300019487 | Microbial Mat On Rocks | MDEDTTVTVGLDVHAHSIRLAAVRADELVDERTLPYDEA |
| Ga0224500_103820431 | 3300022213 | Sediment | LDVHARSIRLAAFRADEPVEERTPAYDEEAVERQLRRWPGMRC |
| Ga0209002_103593791 | 3300025289 | Soil | MNESTTVTVGLDVHARSIRLAAVRADELLEERTLPYDEEAVERVLRRWPVVRCCFSAS |
| Ga0209431_101219325 | 3300025313 | Soil | MHDPTTNTVSVGLDVHAASVRLAAVRADELLDEHTLPYDHAAVAGVIGRWPGARVCYEAG |
| Ga0210142_10137533 | 3300025552 | Natural And Restored Wetlands | MVESTTVSVGLDVHARSIRLAAVCADELLVERTLPYDEQAVERLLRRWPRVRCLL |
| Ga0210076_10839531 | 3300025567 | Natural And Restored Wetlands | MVESTTVSVGLDVHARSIRLAAVCADELLVERTLPYDEQAVERLLRRWPRVRWLL |
| Ga0207646_101394162 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDSTTVSVGLDVHAGSVLLAAVRADELLEERLLAYDLEAVARCLGRWPGVRCCYEAGPPSTGSPARRRR |
| Ga0207701_111540071 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MFESTAVIVGLDVHARSIRLAALRAEELLEERTLPYDEEAVERLLRRWPSVRCCYE |
| Ga0209234_11988303 | 3300026295 | Grasslands Soil | VPSGTVEAFGLDVHARSIRLAAVRADELLEERTLPYDEEAVERALRRWPGVRCCYEAG |
| Ga0209159_11368781 | 3300026343 | Soil | MVESTTVTVGLDVHARSIRLAAVRADELLEERTLAYDEQAVE |
| Ga0209474_100631731 | 3300026550 | Soil | MRESMTVAVGLDVHARSIRLAAVRADELLEERTLPYDEEAV |
| (restricted) Ga0233416_100033603 | 3300027799 | Sediment | MYDSTTVTVGLDVHARSIRLAAVRADELLEEQTLPYDEEAVEQVLRR |
| Ga0209180_105675061 | 3300027846 | Vadose Zone Soil | MYDSTTTVTVGLDVHARSVRLAAVRADELLEERALPYDEEAVERV |
| Ga0209283_105146201 | 3300027875 | Vadose Zone Soil | MYDSTTTVAVGLDVHAGSIRLAALRADELLEERTLSYDEEAV |
| Ga0209069_105051462 | 3300027915 | Watersheds | MYDSTTTVTVGLDVHARSIRLAAVRADELLEERTLPY |
| Ga0268386_108148651 | 3300030619 | Soil | MHDSTTETVSVGLDVHKSSIRLAAVRADELLDERTLPY |
| Ga0265330_100120022 | 3300031235 | Rhizosphere | MYDSTTTVTVGLDLHTRSIRLAAVRADELLEKRTLPYDHEAVERVLRR |
| Ga0265340_102029651 | 3300031247 | Rhizosphere | MVESMTVAVGLDVHARSIRVAVVRADELLEERTLPYDEEAVER |
| Ga0265339_103158101 | 3300031249 | Rhizosphere | RSPTMYDSTTTVTVGLDLHTRSIRLAAVRADELLEKRTLPYDHEAVERVLRR |
| Ga0315271_102686563 | 3300032256 | Sediment | MPDFVTVSVGLDVHARSIRLAAVRADELLEECTLPYDEAAVERVLRRWP |
| Ga0315271_105615281 | 3300032256 | Sediment | MYDSMTTVAVGLDVHARSIRLAAVCADGLLEERTLPYDEEAVERALRRWPVVRCC |
| Ga0335080_106577512 | 3300032828 | Soil | VHARSIRLDAIRADDLLDERTLPYDQEAVALALRSW |
| ⦗Top⦘ |