NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082557

Metagenome / Metatranscriptome Family F082557

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082557
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 54 residues
Representative Sequence MLKKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDDW
Number of Associated Samples 97
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 24.78 %
% of genes near scaffold ends (potentially truncated) 40.71 %
% of genes from short scaffolds (< 2000 bps) 84.96 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (36.283 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(24.779 % of family members)
Environment Ontology (ENVO) Unclassified
(75.221 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.186 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 27.78%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF14700RPOL_N 8.85
PF02511Thy1 2.65
PF13619KTSC 1.77
PF01502PRA-CH 0.88
PF00805Pentapeptide 0.88
PF05367Phage_endo_I 0.88
PF05063MT-A70 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 2.65
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.77
COG0139Phosphoribosyl-AMP cyclohydrolaseAmino acid transport and metabolism [E] 0.88
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.49 %
UnclassifiedrootN/A34.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10172968Not Available716Open in IMG/M
3300000117|DelMOWin2010_c10026690All Organisms → Viruses → Predicted Viral2890Open in IMG/M
3300000117|DelMOWin2010_c10040938Not Available2141Open in IMG/M
3300000947|BBAY92_10179293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae553Open in IMG/M
3300000949|BBAY94_10025386All Organisms → Viruses → Predicted Viral1663Open in IMG/M
3300001355|JGI20158J14315_10218830Not Available533Open in IMG/M
3300001460|JGI24003J15210_10142887Not Available623Open in IMG/M
3300002040|GOScombined01_101158860Not Available1720Open in IMG/M
3300004951|Ga0068513_1034318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae555Open in IMG/M
3300005821|Ga0078746_1006871All Organisms → Viruses → Predicted Viral2269Open in IMG/M
3300005822|Ga0078744_1100724Not Available678Open in IMG/M
3300005920|Ga0070725_10511726Not Available541Open in IMG/M
3300006027|Ga0075462_10016751All Organisms → Viruses → Predicted Viral2361Open in IMG/M
3300006734|Ga0098073_1026256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24841Open in IMG/M
3300006734|Ga0098073_1039299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1648Open in IMG/M
3300006735|Ga0098038_1042095All Organisms → Viruses → Predicted Viral1672Open in IMG/M
3300006752|Ga0098048_1033906All Organisms → Viruses → Predicted Viral1653Open in IMG/M
3300006752|Ga0098048_1219081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300006754|Ga0098044_1379858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae533Open in IMG/M
3300006789|Ga0098054_1337207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae536Open in IMG/M
3300006793|Ga0098055_1153461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae885Open in IMG/M
3300006810|Ga0070754_10416295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24586Open in IMG/M
3300006919|Ga0070746_10169871All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300006921|Ga0098060_1030293All Organisms → Viruses → Predicted Viral1648Open in IMG/M
3300006921|Ga0098060_1094408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium850Open in IMG/M
3300006924|Ga0098051_1077871Not Available898Open in IMG/M
3300006925|Ga0098050_1072578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24890Open in IMG/M
3300006925|Ga0098050_1080729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1838Open in IMG/M
3300006990|Ga0098046_1003268All Organisms → Viruses5144Open in IMG/M
3300007864|Ga0105749_1033970Not Available979Open in IMG/M
3300009054|Ga0102826_1164644Not Available529Open in IMG/M
3300009071|Ga0115566_10095220All Organisms → Viruses → Predicted Viral1924Open in IMG/M
3300009508|Ga0115567_10727714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24593Open in IMG/M
3300010149|Ga0098049_1075412All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED881064Open in IMG/M
3300010296|Ga0129348_1338949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24500Open in IMG/M
3300010392|Ga0118731_102402927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae796Open in IMG/M
3300010430|Ga0118733_102249978All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300010430|Ga0118733_106831481Not Available594Open in IMG/M
3300017708|Ga0181369_1005947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP13224Open in IMG/M
3300017713|Ga0181391_1070520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae806Open in IMG/M
3300017713|Ga0181391_1073724Not Available785Open in IMG/M
3300017725|Ga0181398_1103153Not Available680Open in IMG/M
3300017727|Ga0181401_1157139Not Available552Open in IMG/M
3300017730|Ga0181417_1083987All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300017735|Ga0181431_1103174Not Available639Open in IMG/M
3300017740|Ga0181418_1057178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4965Open in IMG/M
3300017741|Ga0181421_1129647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24653Open in IMG/M
3300017742|Ga0181399_1179126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4502Open in IMG/M
3300017744|Ga0181397_1015498All Organisms → Viruses → Predicted Viral2289Open in IMG/M
3300017746|Ga0181389_1015692All Organisms → Viruses → Predicted Viral2430Open in IMG/M
3300017757|Ga0181420_1019634All Organisms → Viruses → Predicted Viral2258Open in IMG/M
3300017757|Ga0181420_1080489Not Available1017Open in IMG/M
3300017762|Ga0181422_1266717Not Available505Open in IMG/M
3300017764|Ga0181385_1201248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4602Open in IMG/M
3300017773|Ga0181386_1195250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Powvirus → Powvirus S08C41610Open in IMG/M
3300017779|Ga0181395_1249322Not Available543Open in IMG/M
3300017781|Ga0181423_1385410Not Available507Open in IMG/M
3300017783|Ga0181379_1188579All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300017783|Ga0181379_1330098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24515Open in IMG/M
3300017786|Ga0181424_10298113Not Available669Open in IMG/M
3300017786|Ga0181424_10307807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4657Open in IMG/M
3300017956|Ga0181580_10551142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae748Open in IMG/M
3300017964|Ga0181589_10947303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24526Open in IMG/M
3300017969|Ga0181585_10447151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.875Open in IMG/M
3300018428|Ga0181568_11442289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24509Open in IMG/M
3300018563|Ga0188861_1001147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1684Open in IMG/M
3300018682|Ga0188851_1013953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS11019Open in IMG/M
3300019025|Ga0193545_10132447Not Available531Open in IMG/M
3300019726|Ga0193974_1048210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24560Open in IMG/M
3300019756|Ga0194023_1036153Not Available998Open in IMG/M
3300019765|Ga0194024_1136454Not Available572Open in IMG/M
3300020431|Ga0211554_10271192Not Available803Open in IMG/M
3300020438|Ga0211576_10002238Not Available14167Open in IMG/M
3300020451|Ga0211473_10370318Not Available733Open in IMG/M
3300020459|Ga0211514_10005274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales7558Open in IMG/M
3300021335|Ga0213867_1037203All Organisms → Viruses → Predicted Viral1907Open in IMG/M
3300021335|Ga0213867_1096401All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300021371|Ga0213863_10003902All Organisms → Viruses10152Open in IMG/M
3300021371|Ga0213863_10005397Not Available8447Open in IMG/M
3300021389|Ga0213868_10055383All Organisms → Viruses → Predicted Viral2726Open in IMG/M
3300021958|Ga0222718_10078658All Organisms → Viruses → Predicted Viral1995Open in IMG/M
3300021958|Ga0222718_10206412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP11069Open in IMG/M
3300021958|Ga0222718_10532378Not Available562Open in IMG/M
3300021964|Ga0222719_10270329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP11118Open in IMG/M
3300022055|Ga0224898_100331Not Available721Open in IMG/M
3300022063|Ga0212029_1046936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24623Open in IMG/M
3300022064|Ga0224899_101040Not Available571Open in IMG/M
3300022066|Ga0224902_100044Not Available5505Open in IMG/M
3300022067|Ga0196895_1001257All Organisms → Viruses → Predicted Viral2632Open in IMG/M
3300022168|Ga0212027_1016649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP11009Open in IMG/M
3300022178|Ga0196887_1099404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4653Open in IMG/M
3300022178|Ga0196887_1113992Not Available589Open in IMG/M
3300022187|Ga0196899_1040546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP11578Open in IMG/M
(restricted) 3300023112|Ga0233411_10303393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24537Open in IMG/M
(restricted) 3300024059|Ga0255040_10183199All Organisms → Viruses853Open in IMG/M
(restricted) 3300024059|Ga0255040_10224781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae773Open in IMG/M
3300024346|Ga0244775_10248942All Organisms → Viruses → Predicted Viral1481Open in IMG/M
(restricted) 3300024519|Ga0255046_10418685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300025057|Ga0208018_129440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1586Open in IMG/M
3300025084|Ga0208298_1087233Not Available575Open in IMG/M
3300025085|Ga0208792_1070824Not Available631Open in IMG/M
3300025102|Ga0208666_1052710All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300025132|Ga0209232_1215750Not Available576Open in IMG/M
3300025137|Ga0209336_10035000All Organisms → Viruses → Predicted Viral1657Open in IMG/M
3300025769|Ga0208767_1198838Not Available675Open in IMG/M
3300025816|Ga0209193_1015847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP12476Open in IMG/M
(restricted) 3300027861|Ga0233415_10528312Not Available572Open in IMG/M
(restricted) 3300027996|Ga0233413_10514945Not Available530Open in IMG/M
(restricted) 3300028045|Ga0233414_10249447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → Ashivirus S45C4806Open in IMG/M
3300029319|Ga0183748_1135678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300029448|Ga0183755_1041672All Organisms → Viruses → Predicted Viral1235Open in IMG/M
3300029787|Ga0183757_1030389Not Available1142Open in IMG/M
3300034418|Ga0348337_064117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP11377Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater24.78%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.35%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.73%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.08%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment4.42%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.54%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.77%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.77%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.89%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.89%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005822Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018563Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022055Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022064Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 (v2)EnvironmentalOpen in IMG/M
3300022066Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1017296823300000116MarineMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
DelMOWin2010_1002669043300000117MarineMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDDW*
DelMOWin2010_1004093833300000117MarineMLKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW*
BBAY92_1017929323300000947Macroalgal SurfaceMWRYVTTDEQVQWLLAPNLEHALWAAAELSGGSSKLKDVYLDNDEW*
BBAY94_1002538643300000949Macroalgal SurfaceMMLKKQTLKMWRYVTTDEQVQWLLAPNLEHALWAAAELSGGSSKLKDVYLDNDEW*
JGI20158J14315_1021883033300001355Pelagic MarineRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
JGI24003J15210_1014288733300001460MarineMEKKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDDDW*
GOScombined01_10115886033300002040MarineMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDV*
Ga0068513_103431833300004951Marine WaterMLKKQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAAELSGGSEYLKDVYLDNDE
Ga0078746_100687113300005821Marine SedimentNHVQEPKQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
Ga0078744_110072433300005822Marine SedimentRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
Ga0070725_1051172613300005920Marine SedimentQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
Ga0075462_1001675163300006027AqueousMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDDDEW*
Ga0098073_102625633300006734MarineMWRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRNVILDDDQW*
Ga0098073_103929913300006734MarineMWRYYTTTDDQARWLLAPNLEHALWAAAELSGGSSKLRDVILDDDQW*
Ga0098038_104209523300006735MarineMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW*
Ga0098048_103390663300006752MarineMLNKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW*
Ga0098048_121908133300006752MarineMQKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW*
Ga0098044_137985833300006754MarineMLKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDLYLDNDEW
Ga0098054_133720713300006789MarineEIMLKKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW*
Ga0098055_115346123300006793MarineMLKKQTLKIWRYTTTDDQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW*
Ga0070754_1041629513300006810AqueousMMLETERQKMWRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRNVILDDDQW*
Ga0070746_1016987143300006919AqueousMQKKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW*
Ga0098060_103029363300006921MarineMLNKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVY
Ga0098060_109440843300006921MarineMLKKQRLKTWRYVTTDEQVQWLLAPDLEHAMFAAAELSGGSSKLKDVYLDDDDW*
Ga0098051_107787123300006924MarineMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW*
Ga0098050_107257833300006925MarineMLKRQKIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSSGSEYLKDVYLDNDEW*
Ga0098050_108072943300006925MarineSLSLYQLLHVNLMLKKQTLKIWRYTTTDDQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW*
Ga0098046_1003268183300006990MarineMLKRQTLKTWRYTTTDGQVQWLLAPDSEHTIWAAVELSGGSEYLQDVYLDNDEW*
Ga0105749_103397023300007864Estuary WaterMLKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLGNDEW*
Ga0102826_116464413300009054EstuarineQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW*
Ga0115566_1009522063300009071Pelagic MarineMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLRDVYLDNDEW*
Ga0115567_1072771413300009508Pelagic MarineLNHVHEPNQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
Ga0098049_107541223300010149MarineMLKKQTIKIWRYTTTDNQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW*
Ga0129348_133894923300010296Freshwater To Marine Saline GradientMWRYYTTTDDQARWLLAPNLEHAAWAAAELSGGSSKLRNVILDDDQW*
Ga0118731_10240292723300010392MarineMLKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLYNDEW*
Ga0118733_10224997833300010430Marine SedimentMLKRQTIKTWRYTTTDGQVRWLLAPNSEHATWAAAELSGGSEYLKDVYLDNDEW*
Ga0118733_10683148113300010430Marine SedimentQEPKQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW*
Ga0181369_100594773300017708MarineMLKRQTLKTWRYTTTDGKVQWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0181391_107052013300017713SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDV
Ga0181391_107372413300017713SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0181398_110315313300017725SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYL
Ga0181401_115713913300017727SeawaterNQMLKRQTIKTWRYTTTDGQVRWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW
Ga0181417_108398723300017730SeawaterMQKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAADELTGGSSKLKEV
Ga0181431_110317433300017735SeawaterAYYKAVCSRIKEQSKRLMEKKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0181418_105717863300017740SeawaterMLKKQRLKTWRYVTTDVQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0181421_112964713300017741SeawaterMLKKQTVKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0181399_117912613300017742SeawaterMEKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLNDVYL
Ga0181397_101549833300017744SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0181389_101569223300017746SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDC
Ga0181420_101963433300017757SeawaterMLKKQPLKVWCFTTTEDQVRCLLAPDSDHAIWAAAELSGGSEYLKDIYLKNYD
Ga0181420_108048923300017757SeawaterMLKKQTLKTWRYTTTDGQVQWLLAPDSEHAVWAATELSGGSEYLKDVYLDNDEW
Ga0181422_126671743300017762SeawaterMQKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDV
Ga0181385_120124843300017764SeawaterMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0181386_119525013300017773SeawaterMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLD
Ga0181395_124932213300017779SeawaterQSKRLMEKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0181423_138541013300017781SeawaterTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0181379_118857913300017783SeawaterMTEKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0181379_133009813300017783SeawaterTWRYTTTNDEQVRFLLAPDLEHAAWAAAELSGGSSKVKNIILDDYEW
Ga0181424_1029811313300017786SeawaterMLNKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDD
Ga0181424_1030780713300017786SeawaterMEKKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDD
Ga0181580_1055114223300017956Salt MarshMLKTERQKMWRYYTTDDAQARWLLAPNLEHALWAAAELSGGTDKLRNVILDDDQW
Ga0181589_1094730313300017964Salt MarshYYSTDDDQARWLLAPNLEHALWSAAELSGGTDKLRNVILDDDEW
Ga0181585_1044715123300017969Salt MarshMKTERQKMWRYYTTDDAQARWLLAPNLEHALWAAAELSGGTDKLRNVILDDDQW
Ga0181568_1144228913300018428Salt MarshMLKTERQQMWRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRNVILDDDQW
Ga0188861_100114723300018563Freshwater LakeMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW
Ga0188851_101395323300018682Freshwater LakeMLKRQTLKTWRYTTTDGQVQWLLAPNLEHAAWAAAELSGGSEYLKDVYLDNDEW
Ga0193545_1013244723300019025MarineMWRYVTTDEQVQWLLAPNLEHALWAAAELSGGSSKLKDVYLDNDEW
Ga0193974_104821013300019726SedimentRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRNVILDDDQW
Ga0194023_103615323300019756FreshwaterMLKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0194024_113645413300019765FreshwaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDDW
Ga0211554_1027119233300020431MarineMLNKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0211576_1000223863300020438MarineMEKKQRLKTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0211473_1037031843300020451MarineMMLKKQTLKMWRYVTTDEQVQWLLAPNLEHALWAAAELSGGSSKLKDVYLDNDEW
Ga0211514_10005274133300020459MarineMLKKQNLKTWCYTTTDGQVRYLLAPDSDVAIWTAVELSGGSQYLRDVYLELNE
Ga0213867_103720333300021335SeawaterMQDKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDEW
Ga0213867_109640143300021335SeawaterMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAAELSGGSEYLKDVYLDNDEW
Ga0213863_1000390253300021371SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHAMFAAAELSGGSSKLKDVYLDDDDW
Ga0213863_1000539773300021371SeawaterMLKKQTLKIWRYVTTDNQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW
Ga0213868_1005538343300021389SeawaterMLKRQTIKTWRYTTTDGQVQWLLAPDSEHAIWAAAELSGGSEYLKDVYLDNDEW
Ga0222718_1007865833300021958Estuarine WaterSPSLYQLLLVNLMLKKQTLKIWRYVTTDNQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW
Ga0222718_1020641213300021958Estuarine WaterSPSLYQLLLVNLMLKKQTLKIWRYTTTDDQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW
Ga0222718_1053237813300021958Estuarine WaterFTQKQSKRLMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDDW
Ga0222719_1027032933300021964Estuarine WaterMLKKQTLKIWRYTTTDDQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW
Ga0224898_10033123300022055SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0212029_104693633300022063AqueousRSFQLNHAQEQNQMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDDDEW
Ga0224899_10104023300022064SeawaterICSRTTKQNRRLMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0224902_100044173300022066SeawaterMQEKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0196895_100125783300022067AqueousMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDDDEW
Ga0212027_101664933300022168AqueousWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0196887_109940413300022178AqueousMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLD
Ga0196887_111399223300022178AqueousMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALYAAAELSGGSSKLKDVYLDDDDW
Ga0196899_104054653300022187AqueousMWRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRNVILDDDQW
(restricted) Ga0233411_1030339313300023112SeawaterMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAVWAAVELSGGSEYLKDVYLDN
(restricted) Ga0255040_1018319913300024059SeawaterYQTICSRTKEQIRRLMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
(restricted) Ga0255040_1022478113300024059SeawaterMLKRQTLKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0244775_1024894233300024346EstuarineLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLKDVYLDNDEW
(restricted) Ga0255046_1041868533300024519SeawaterMLKKQTIKIWRYTTTDNQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
Ga0208018_12944013300025057MarineMWRYYTTTDDQARWLLAPNLEHALWAAAELSGGSSKLRDVILDDDQW
Ga0208298_108723333300025084MarineHQTICSRTTEQNRRLMLNKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0208792_107082433300025085MarineSLSLYQLLHVNLMLKKQTLKIWRYTTTDDQVQWLLAPNSEHAIWSATELAGGSEYLKDVYLDNDEW
Ga0208666_105271013300025102MarineMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLK
Ga0209232_121575033300025132MarineCKAVCSRTTKQNRRLMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0209336_1003500023300025137MarineMEKKQRLRTWRYVTTDEQVQWLLAPDLERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0208767_119883833300025769AqueousMQKKQRLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0209193_101584743300025816Pelagic MarineMLKRQTLKTWRYTTTDGQVQWLLAPDSEHAIWAAVELSGGSEYLRDVYLDNDEW
(restricted) Ga0233415_1052831223300027861SeawaterTKEQNRRLMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
(restricted) Ga0233413_1051494513300027996SeawaterKRQTIKTWRYTTTDGQVRWLLAPDSEHATWAAAELSGGSEYLKDVYLDNDEW
(restricted) Ga0233414_1024944713300028045SeawaterMLKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDD
Ga0183748_113567823300029319MarineMWRYYVTTDDQVRFLLAPDLEHAAWAAAKLSGGTDKLKNVVLDEQG
Ga0183755_104167243300029448MarineMQKKQRLKTWRYVTTDEQVQWLLAPDLEHALHAAVELSGGSSKLKDVYLDDDDW
Ga0183757_103038923300029787MarineMQKKQHLKTWRYVTTDEQVQWLLAPDFERAMFAAAELSGGSSKLKDVYLDDDDW
Ga0348337_064117_1_1173300034418AqueousMWRYYTTDDDQARWLLAPNLEHALWAAAELSGGTSKLRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.