NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081188

Metagenome Family F081188

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081188
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 48 residues
Representative Sequence MRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQPQ
Number of Associated Samples 107
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.14 %
% of genes near scaffold ends (potentially truncated) 93.86 %
% of genes from short scaffolds (< 2000 bps) 93.86 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.123 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.544 % of family members)
Environment Ontology (ENVO) Unclassified
(25.439 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.719 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.74%    β-sheet: 7.89%    Coil/Unstructured: 72.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00132Hexapep 70.18
PF14602Hexapep_2 10.53
PF02867Ribonuc_red_lgC 5.26
PF00317Ribonuc_red_lgN 3.51
PF03544TonB_C 2.63
PF02899Phage_int_SAM_1 0.88
PF12833HTH_18 0.88
PF10282Lactonase 0.88
PF00069Pkinase 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 8.77
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.51
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 2.63
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.88
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078002|MGR_F548DK202JYSTAAll Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium533Open in IMG/M
2170459018|G1P06HT02HR122All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium552Open in IMG/M
3300001686|C688J18823_11083090All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300003323|rootH1_10308418All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300004153|Ga0063455_101449145All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300004156|Ga0062589_101091171All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300004156|Ga0062589_102538776All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300004479|Ga0062595_101386058All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300004643|Ga0062591_101265423All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300004779|Ga0062380_10494216All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300004782|Ga0062382_10239566All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005365|Ga0070688_101656949All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005440|Ga0070705_100131139All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300005468|Ga0070707_101502330All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005518|Ga0070699_101066445All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005530|Ga0070679_101501915All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005536|Ga0070697_101775329All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005539|Ga0068853_102098352All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005545|Ga0070695_101146548All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005713|Ga0066905_101936875All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005844|Ga0068862_102182246All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005895|Ga0075277_1041962All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300006755|Ga0079222_10459538All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300006806|Ga0079220_10014628All Organisms → cellular organisms → Bacteria3157Open in IMG/M
3300006853|Ga0075420_101307325All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006854|Ga0075425_100730949All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300006914|Ga0075436_101176930All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009137|Ga0066709_103897776All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium542Open in IMG/M
3300009147|Ga0114129_11493494All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium831Open in IMG/M
3300009147|Ga0114129_12246449All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300009148|Ga0105243_10458040All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300009162|Ga0075423_11650145All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009174|Ga0105241_11843943All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009553|Ga0105249_13463433All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010036|Ga0126305_10108012All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300010037|Ga0126304_10640055All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010039|Ga0126309_10717032All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300010040|Ga0126308_10762322All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010041|Ga0126312_10065427All Organisms → cellular organisms → Bacteria2446Open in IMG/M
3300010045|Ga0126311_11858317All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300010166|Ga0126306_11532426All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010362|Ga0126377_11061368All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300010373|Ga0134128_10489857All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300010397|Ga0134124_10774249All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300010401|Ga0134121_11155798All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300010403|Ga0134123_10407618All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300011444|Ga0137463_1053791All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300012043|Ga0136631_10000919All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis9359Open in IMG/M
3300012362|Ga0137361_10519730All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300012678|Ga0136615_10070679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1730Open in IMG/M
3300012681|Ga0136613_10617294All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012684|Ga0136614_10119531All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300012895|Ga0157309_10267972All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012951|Ga0164300_10109692All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300012955|Ga0164298_10104398All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300012958|Ga0164299_10757458All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium687Open in IMG/M
3300014320|Ga0075342_1000637All Organisms → cellular organisms → Bacteria6447Open in IMG/M
3300015264|Ga0137403_11221884All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300015372|Ga0132256_102560196All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300015372|Ga0132256_102869491All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300017997|Ga0184610_1108616All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300018031|Ga0184634_10426599All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300018051|Ga0184620_10326144All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018071|Ga0184618_10100764All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300018422|Ga0190265_11835325All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300018466|Ga0190268_10092257All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300018466|Ga0190268_11456049All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300019377|Ga0190264_10532381All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300021078|Ga0210381_10064706All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300021418|Ga0193695_1123455All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300022756|Ga0222622_11207559All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025556|Ga0210120_1013537All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300025916|Ga0207663_11114379All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300025920|Ga0207649_11235771All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300025922|Ga0207646_11116957All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025942|Ga0207689_10543824All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300025944|Ga0207661_10462057All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300026089|Ga0207648_11986434All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300026111|Ga0208291_1084322All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300026116|Ga0207674_11907074All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027840|Ga0209683_10034430All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300028380|Ga0268265_11750812All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300028592|Ga0247822_10792751All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300028597|Ga0247820_10569499All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028710|Ga0307322_10212616All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300028714|Ga0307309_10099302All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300028714|Ga0307309_10221932All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300028715|Ga0307313_10008884All Organisms → cellular organisms → Bacteria2505Open in IMG/M
3300028717|Ga0307298_10111351All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300028799|Ga0307284_10236360All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300028807|Ga0307305_10237487All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300028807|Ga0307305_10467529All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300030336|Ga0247826_10295731All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300030619|Ga0268386_10581533All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300031548|Ga0307408_102498633All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031716|Ga0310813_12092567Not Available535Open in IMG/M
3300031731|Ga0307405_11506094All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031852|Ga0307410_11720982All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031901|Ga0307406_11155822All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300031901|Ga0307406_11340918All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300031903|Ga0307407_10835452All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031908|Ga0310900_11516065All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031949|Ga0214473_10100541All Organisms → cellular organisms → Bacteria3377Open in IMG/M
3300031996|Ga0308176_12238394All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031997|Ga0315278_10692591All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300032002|Ga0307416_100330257All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300032005|Ga0307411_10654296All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300032075|Ga0310890_11090603All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300032126|Ga0307415_101462911All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300032180|Ga0307471_104312428All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032211|Ga0310896_10562995All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032421|Ga0310812_10409725All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300033815|Ga0364946_093324All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300034818|Ga0373950_0097689All Organisms → cellular organisms → Bacteria630Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.54%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere7.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.14%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.26%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.51%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.75%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.88%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.88%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.88%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.88%
Switchgrass, Maize And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere0.88%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.88%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078002Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, ILHost-AssociatedOpen in IMG/M
2170459018Litter degradation MG2EngineeredOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025556Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MGR_10917202044078002Switchgrass, Maize And Miscanthus RhizosphereVDVQRLRSSDNADFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPQKP
2MG_003421002170459018Switchgrass, Maize And Mischanthus LitterMRLRPSNDPAFERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPAQNQ
C688J18823_1108309023300001686SoilAFERAVRNFVWTVTWHPALKEGAPVEAWTQMLFPPAQQQ*
rootH1_1030841813300003323Sugarcane Root And Bulk SoilSLLWVKVSSEGRTIDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAPTQ*
Ga0063455_10144914523300004153SoilLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ*
Ga0062589_10109117123300004156SoilTEGRTVDVARLRPSNDPTFERAVRNFVWSMTWHPALKDAAPVEAWTQMLFPPAPK*
Ga0062589_10253877623300004156SoilSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP*
Ga0062595_10138605813300004479SoilLRPSDDPEFERAVRNFVWSVTWHPALKGGQPVEAWTQMLFPPASQ*
Ga0062591_10126542313300004643SoilVDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQPQ*
Ga0062380_1049421623300004779Wetland SedimentSNDSTFERAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK*
Ga0062382_1023956613300004782Wetland SedimentGRTVDVARLRPSNDLAFERAVRNFVWSVTWHPALKDGIPIEAWTQMLFPPAPK*
Ga0070688_10165694923300005365Switchgrass RhizosphereDPAFEREVRNFVWSMSWHPAMKDGAPVEAWTQMQFPPSRP*
Ga0070705_10013113913300005440Corn, Switchgrass And Miscanthus RhizospherePSLLWVKVSAEGRTVDINRLRPSNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK*
Ga0070707_10150233023300005468Corn, Switchgrass And Miscanthus RhizosphereSNDPDFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0070699_10106644523300005518Corn, Switchgrass And Miscanthus RhizosphereEGRTVDVARLRPSNDTGFERAVRNFVWSVTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0070679_10150191523300005530Corn RhizosphereVDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ*
Ga0070697_10177532913300005536Corn, Switchgrass And Miscanthus RhizosphereVDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ*
Ga0068853_10209835223300005539Corn RhizosphereTVDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ*
Ga0070695_10114654823300005545Corn, Switchgrass And Miscanthus RhizosphereAEGRTVDVERLRPSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP*
Ga0066905_10193687513300005713Tropical Forest SoilVSAEGRTIDVQRLRSSDNTEFEHAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP*
Ga0068862_10218224613300005844Switchgrass RhizosphereDVAQLRPSDDPGFERAVRNFVWSLTWHPAIKDGAPVEAWTQMLFPPAPK*
Ga0075277_104196223300005895Rice Paddy SoilKVSSEGRTVDVQRLRPSNDPAFERAVRDFVWTVTWHPALKAGSPVEAWTQMLFPPAPR*
Ga0079222_1045953823300006755Agricultural SoilARLRPSNDPGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0079220_1001462833300006806Agricultural SoilAEGRTVDIMRLKPSNDPAFERAVRNFVWTVTWHPALKDGAPVDAWTQMLFPPTPQ*
Ga0075420_10130732513300006853Populus RhizosphereFERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPAQSQ*
Ga0075425_10073094913300006854Populus RhizosphereVKVSSEGRTVDVQRLRPSNDSAFERAVRDFVWTVTWHPALKAGSPVEAWTQMLFPPAAR*
Ga0075436_10117693023300006914Populus RhizosphereGRTVDVSPFRSSNDPAFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0066709_10389777623300009137Grasslands SoilVDISRLRPSNDLFFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK*
Ga0114129_1149349423300009147Populus RhizosphereVDINRLRPSNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK*
Ga0114129_1224644913300009147Populus RhizosphereERAVRNFVWSMTWHPALKDGTPVEAWTQMLFPPAPK*
Ga0105243_1045804013300009148Miscanthus RhizosphereVDTVCLRQSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ*
Ga0075423_1165014523300009162Populus RhizosphereAVFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0105241_1184394313300009174Corn RhizosphereMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ*
Ga0105249_1346343313300009553Switchgrass RhizosphereTVDLRARQSSNDPAFEREVRSFAWSMSWHPALKDGAPVEAWTQMQFPPSRSDH*
Ga0126305_1010801213300010036Serpentine SoilVKVSAEGRTLDIRRLRPSDDAAYEREVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQE*
Ga0126304_1064005533300010037Serpentine SoilREVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQEQ*
Ga0126309_1071703213300010039Serpentine SoilEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ*
Ga0126308_1076232223300010040Serpentine SoilSNDPAFERAVRNFVWTVTWHPAIKDGAPAEAWTQMLFPPAQQQ*
Ga0126312_1006542733300010041Serpentine SoilSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQTQ*
Ga0126311_1185831713300010045Serpentine SoilEGRTVDIRRLKPSDDPAYEREVQNFVWGVTWHPALKDGAPVDAWTQMLFPPAQDQ*
Ga0126306_1153242623300010166Serpentine SoilSTEGRTVDVAPMRPSNDSTFERAVRNFVWSLTWHPALKAGSPVEAWTQMLFPPAPK*
Ga0126377_1106136813300010362Tropical Forest SoilDVQRLRSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP*
Ga0134128_1048985733300010373Terrestrial SoilDPAFERAVRNFVWTVTWHPALKDGAPVDAWTQMLFPPTPQ*
Ga0134124_1077424913300010397Terrestrial SoilEGRTVDVSRLRPSNDATFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0134121_1115579813300010401Terrestrial SoilMRMETNADPAFEREVRNFVWTVTWHPALKDGAPVE
Ga0134123_1040761833300010403Terrestrial SoilSNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK*
Ga0137463_105379133300011444SoilFERAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK*
Ga0136631_1000091993300012043Polar Desert SandVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ*
Ga0137361_1051973033300012362Vadose Zone SoilEGRTVDVKPLRPSNDTTFERAVRDFVWAVTWHPALKQGAPVEAWTQMLFPPAPK*
Ga0136615_1007067923300012678Polar Desert SandVDVRRLRPSNEGEFERAVQDFVWTLTWHPALKDGAPVEAWTQMLFPPQPIAQLQ*
Ga0136613_1061729423300012681Polar Desert SandAEGRTVDIRRLRPSDDPAYEREVRNFVWAVTWHPALKDGAPVEAWTQMLFPPAQDP*
Ga0136614_1011953133300012684Polar Desert SandVDIRRLRPSDDLAYEREVQNFVWTVTWHPALKDGAPVDAWTQMLFPPAQDQ*
Ga0157309_1026797213300012895SoilSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ*
Ga0164300_1010969233300012951SoilDVTPLRPSNDAVFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0164298_1010439813300012955SoilRAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP*
Ga0164299_1075745813300012958SoilMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQML
Ga0075342_100063763300014320Natural And Restored WetlandsVSVEGRTVDIRRLRPSNNSEYERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP*
Ga0137403_1122188423300015264Vadose Zone SoilLLWVKVSTEGRTVDVARLRPSNDAGFERAVRNFVWSLTWHPAVKDGAPVEAWTQMLFPPAPK*
Ga0132256_10256019613300015372Arabidopsis RhizosphereNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP*
Ga0132256_10286949123300015372Arabidopsis RhizosphereLWVKVSTEGRTVDVARLRPSNDAGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK*
Ga0184610_110861613300017997Groundwater SedimentAEGRTVDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0184634_1042659913300018031Groundwater SedimentEGRTLDTRRLRPSDDSTFERAARDFVWTVTWHPALQDGAPVEAWTQMLFPPQPQ
Ga0184620_1032614423300018051Groundwater SedimentEGRTVDIRRLRPSDDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ
Ga0184618_1010076433300018071Groundwater SedimentRPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0190265_1183532513300018422SoilRTLDLRRLRPSDDSTFERAARDFVWTVSWHPALKDGAAVEAWTQMLFPPQPE
Ga0190268_1009225713300018466SoilQAARDFAWIIAWHPAMKDGTPVEAWAQMLFPPQPQ
Ga0190268_1145604913300018466SoilGRTVDVQRLRPSNDVEYERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPQTQPQDQ
Ga0190264_1053238123300019377SoilRPSNDAEFERAVRNFAWTLAWHPALKDGAPVEAWTQMLFPPQPVPETQ
Ga0210381_1006470633300021078Groundwater SedimentVDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0193695_112345513300021418SoilPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0222622_1120755923300022756Groundwater SedimentFERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPTPQ
Ga0210120_101353733300025556Natural And Restored WetlandsRAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK
Ga0207663_1111437923300025916Corn, Switchgrass And Miscanthus RhizosphereVARLRPSNDTTFERAVRNFVWSVTWHPALKGGEPVEAWTQMLFPPAPK
Ga0207649_1123577123300025920Corn RhizosphereLRASDNPDFARAVRDFVWTVTWHPPLKDGAPVEAWTQMLFPPQKP
Ga0207646_1111695723300025922Corn, Switchgrass And Miscanthus RhizosphereEGRTVDVARLRPSNDPGFERAVRNFVWSLTWHPAVKDGAPVEAWTQMLFPPAPK
Ga0207689_1054382413300025942Miscanthus RhizosphereRAVRDFVWTVTWHPALKDGAPVQAWTQMLFPPQKP
Ga0207661_1046205733300025944Corn RhizosphereLRSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPLKP
Ga0207648_1198643423300026089Miscanthus RhizosphereRTVDVTRLRPSNDTAFERAVRNFVWSVTWHPALKNGAPVEAWTQMLFPPAQE
Ga0208291_108432223300026111Natural And Restored WetlandsAQFEQAARDFAWIVAWHPAMKDGVPVEAWTQMLFPPQPQ
Ga0207674_1190707423300026116Corn RhizosphereVDVSQLRPSNDSTFERAVRNFVWSLTWHPALKAGSPVEAWTQMLFPPAPK
Ga0209683_1003443033300027840Wetland SedimentDLAFERAVRNFVWSVTWHPALKDGIPIEAWTQMLFPPAPK
Ga0268265_1175081213300028380Switchgrass RhizosphereDVAQLRPSDDPGFERAVRNFVWSLTWHPAIKDGAPVEAWTQMLFPPAPK
Ga0247822_1079275123300028592SoilVDIKSLRPSDDPQFEQAARDFAWIIAWHPAMKDGTPVEAWAQMLFPPQQQ
Ga0247820_1056949923300028597SoilLWVKVSAEGRTVDVERLRPSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQK
Ga0307322_1021261613300028710SoilDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQQE
Ga0307309_1009930213300028714SoilVDIMRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARDQ
Ga0307309_1022193223300028714SoilVKVSTEGRTVDIRRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQQE
Ga0307313_1000888433300028715SoilEVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0307298_1011135123300028717SoilYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ
Ga0307284_1023636023300028799SoilVDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKNGAPVEAWTQMLFPPARDQ
Ga0307305_1023748733300028807SoilRTVDIMRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARDQ
Ga0307305_1046752923300028807SoilSNDPAFEREVRNFVWTVTWHPALKDGAPTEAWTQMLFPPARDQ
Ga0247826_1029573133300030336SoilVDVQRLRASDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP
Ga0268386_1058153323300030619SoilKVSAEGRTVDVRRLRPSNDQVYERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQRQ
Ga0307408_10249863313300031548RhizosphereMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQPQ
Ga0310813_1209256713300031716SoilIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPTPQ
Ga0307405_1150609413300031731RhizospherePSDDTVFEQAAHDFVWTVAWHPALKDGAPVEAWTQMLFPPQPQP
Ga0307410_1172098213300031852RhizosphereWVKVSAEGRTVDIRRLRPSDDPAYEREVQNFVWTVTWHPALKDGGPVDAWTQMLFPPAQE
Ga0307406_1115582213300031901RhizosphereSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP
Ga0307406_1134091813300031901RhizosphereVDIMRLRPSNDPAFERSVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ
Ga0307407_1083545213300031903RhizosphereKVSAEGRTVDVQRLRPSDDLEFERAVRNFVWTVTWHPALKEGAPVEAWTQMLFPPQRQ
Ga0310900_1151606523300031908SoilSDDPAFERAVRNFVWGLSWHPAVKDGAPVEAWTQMLFPPAPK
Ga0214473_1010054133300031949SoilGRTVDVARLRPSNDVRFERAVRNFVWSVTWHPAFKNGAPIEAWTQMLFPPTPK
Ga0308176_1223839413300031996SoilVDIMRLRPSNDPAFEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARAQ
Ga0315278_1069259133300031997SedimentSAFERTVRDFVWTVAWHPALKAGAPVEAWTQMLFPPAPR
Ga0307416_10033025713300032002RhizosphereFEQAAHDFVWTVAWHPALKDGAPVEAWTQMLFPPQPQP
Ga0307411_1065429623300032005RhizosphereSTEGRTVDIMRLRPSNDPAFERAVRNFVWTVTWHPAIKDGAPVEAWTQMLFPPAQNQQ
Ga0310890_1109060313300032075SoilRTVDVSRLRPSNDPGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK
Ga0307415_10146291113300032126RhizosphereSDDPAYEREVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQEQ
Ga0307471_10431242823300032180Hardwood Forest SoilLRPSNDTAFERAVRNFVWSVTWHPALKDGAPVEAWTQMLFPPAPK
Ga0310896_1056299523300032211SoilRSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP
Ga0310812_1040972523300032421SoilVSRLRPSNDATFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK
Ga0364946_093324_2_1933300033815SedimentLLWVKVSAEGRTVDIRRLRPSDDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ
Ga0373950_0097689_490_6303300034818Rhizosphere SoilRLRPSDDPVFERAVRNFVWSLSWHPAVKDGAPVEAWTQMLFPPAPK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.