| Basic Information | |
|---|---|
| Family ID | F081188 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQPQ |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.14 % |
| % of genes near scaffold ends (potentially truncated) | 93.86 % |
| % of genes from short scaffolds (< 2000 bps) | 93.86 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.123 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.544 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.439 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.74% β-sheet: 7.89% Coil/Unstructured: 72.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00132 | Hexapep | 70.18 |
| PF14602 | Hexapep_2 | 10.53 |
| PF02867 | Ribonuc_red_lgC | 5.26 |
| PF00317 | Ribonuc_red_lgN | 3.51 |
| PF03544 | TonB_C | 2.63 |
| PF02899 | Phage_int_SAM_1 | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| PF10282 | Lactonase | 0.88 |
| PF00069 | Pkinase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 8.77 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.51 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.63 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.88 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078002|MGR_F548DK202JYSTA | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 533 | Open in IMG/M |
| 2170459018|G1P06HT02HR122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 552 | Open in IMG/M |
| 3300001686|C688J18823_11083090 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300003323|rootH1_10308418 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300004153|Ga0063455_101449145 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300004156|Ga0062589_101091171 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300004156|Ga0062589_102538776 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300004479|Ga0062595_101386058 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004643|Ga0062591_101265423 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300004779|Ga0062380_10494216 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300004782|Ga0062382_10239566 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005365|Ga0070688_101656949 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005440|Ga0070705_100131139 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300005468|Ga0070707_101502330 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005518|Ga0070699_101066445 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005530|Ga0070679_101501915 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005536|Ga0070697_101775329 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005539|Ga0068853_102098352 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005545|Ga0070695_101146548 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005713|Ga0066905_101936875 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005844|Ga0068862_102182246 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005895|Ga0075277_1041962 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300006755|Ga0079222_10459538 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300006806|Ga0079220_10014628 | All Organisms → cellular organisms → Bacteria | 3157 | Open in IMG/M |
| 3300006853|Ga0075420_101307325 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006854|Ga0075425_100730949 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300006914|Ga0075436_101176930 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009137|Ga0066709_103897776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 542 | Open in IMG/M |
| 3300009147|Ga0114129_11493494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 831 | Open in IMG/M |
| 3300009147|Ga0114129_12246449 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300009148|Ga0105243_10458040 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300009162|Ga0075423_11650145 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009174|Ga0105241_11843943 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009553|Ga0105249_13463433 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010036|Ga0126305_10108012 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300010037|Ga0126304_10640055 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300010039|Ga0126309_10717032 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010040|Ga0126308_10762322 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010041|Ga0126312_10065427 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300010045|Ga0126311_11858317 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010166|Ga0126306_11532426 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010362|Ga0126377_11061368 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010373|Ga0134128_10489857 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300010397|Ga0134124_10774249 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010401|Ga0134121_11155798 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300010403|Ga0134123_10407618 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300011444|Ga0137463_1053791 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300012043|Ga0136631_10000919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9359 | Open in IMG/M |
| 3300012362|Ga0137361_10519730 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012678|Ga0136615_10070679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1730 | Open in IMG/M |
| 3300012681|Ga0136613_10617294 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012684|Ga0136614_10119531 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300012895|Ga0157309_10267972 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012951|Ga0164300_10109692 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300012955|Ga0164298_10104398 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300012958|Ga0164299_10757458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 687 | Open in IMG/M |
| 3300014320|Ga0075342_1000637 | All Organisms → cellular organisms → Bacteria | 6447 | Open in IMG/M |
| 3300015264|Ga0137403_11221884 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300015372|Ga0132256_102560196 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300015372|Ga0132256_102869491 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300017997|Ga0184610_1108616 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300018031|Ga0184634_10426599 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300018051|Ga0184620_10326144 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018071|Ga0184618_10100764 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300018422|Ga0190265_11835325 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018466|Ga0190268_10092257 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300018466|Ga0190268_11456049 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300019377|Ga0190264_10532381 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300021078|Ga0210381_10064706 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300021418|Ga0193695_1123455 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300022756|Ga0222622_11207559 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025556|Ga0210120_1013537 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300025916|Ga0207663_11114379 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025920|Ga0207649_11235771 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025922|Ga0207646_11116957 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025942|Ga0207689_10543824 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300025944|Ga0207661_10462057 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300026089|Ga0207648_11986434 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026111|Ga0208291_1084322 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026116|Ga0207674_11907074 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027840|Ga0209683_10034430 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300028380|Ga0268265_11750812 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300028592|Ga0247822_10792751 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300028597|Ga0247820_10569499 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300028710|Ga0307322_10212616 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028714|Ga0307309_10099302 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300028714|Ga0307309_10221932 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300028715|Ga0307313_10008884 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
| 3300028717|Ga0307298_10111351 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300028799|Ga0307284_10236360 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300028807|Ga0307305_10237487 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300028807|Ga0307305_10467529 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300030336|Ga0247826_10295731 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300030619|Ga0268386_10581533 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031548|Ga0307408_102498633 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031716|Ga0310813_12092567 | Not Available | 535 | Open in IMG/M |
| 3300031731|Ga0307405_11506094 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031852|Ga0307410_11720982 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031901|Ga0307406_11155822 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031901|Ga0307406_11340918 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031903|Ga0307407_10835452 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031908|Ga0310900_11516065 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031949|Ga0214473_10100541 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300031996|Ga0308176_12238394 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031997|Ga0315278_10692591 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300032002|Ga0307416_100330257 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300032005|Ga0307411_10654296 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300032075|Ga0310890_11090603 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032126|Ga0307415_101462911 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300032180|Ga0307471_104312428 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032211|Ga0310896_10562995 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032421|Ga0310812_10409725 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300033815|Ga0364946_093324 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300034818|Ga0373950_0097689 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 7.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.51% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.88% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.88% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere | 0.88% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078002 | Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Host-Associated | Open in IMG/M |
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MGR_1091720 | 2044078002 | Switchgrass, Maize And Miscanthus Rhizosphere | VDVQRLRSSDNADFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPQKP |
| 2MG_00342100 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MRLRPSNDPAFERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPAQNQ |
| C688J18823_110830902 | 3300001686 | Soil | AFERAVRNFVWTVTWHPALKEGAPVEAWTQMLFPPAQQQ* |
| rootH1_103084181 | 3300003323 | Sugarcane Root And Bulk Soil | SLLWVKVSSEGRTIDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAPTQ* |
| Ga0063455_1014491452 | 3300004153 | Soil | LRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ* |
| Ga0062589_1010911712 | 3300004156 | Soil | TEGRTVDVARLRPSNDPTFERAVRNFVWSMTWHPALKDAAPVEAWTQMLFPPAPK* |
| Ga0062589_1025387762 | 3300004156 | Soil | SDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP* |
| Ga0062595_1013860581 | 3300004479 | Soil | LRPSDDPEFERAVRNFVWSVTWHPALKGGQPVEAWTQMLFPPASQ* |
| Ga0062591_1012654231 | 3300004643 | Soil | VDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQPQ* |
| Ga0062380_104942162 | 3300004779 | Wetland Sediment | SNDSTFERAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK* |
| Ga0062382_102395661 | 3300004782 | Wetland Sediment | GRTVDVARLRPSNDLAFERAVRNFVWSVTWHPALKDGIPIEAWTQMLFPPAPK* |
| Ga0070688_1016569492 | 3300005365 | Switchgrass Rhizosphere | DPAFEREVRNFVWSMSWHPAMKDGAPVEAWTQMQFPPSRP* |
| Ga0070705_1001311391 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PSLLWVKVSAEGRTVDINRLRPSNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK* |
| Ga0070707_1015023302 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SNDPDFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0070699_1010664452 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGRTVDVARLRPSNDTGFERAVRNFVWSVTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0070679_1015019152 | 3300005530 | Corn Rhizosphere | VDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ* |
| Ga0070697_1017753291 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ* |
| Ga0068853_1020983522 | 3300005539 | Corn Rhizosphere | TVDIMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ* |
| Ga0070695_1011465482 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGRTVDVERLRPSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP* |
| Ga0066905_1019368751 | 3300005713 | Tropical Forest Soil | VSAEGRTIDVQRLRSSDNTEFEHAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP* |
| Ga0068862_1021822461 | 3300005844 | Switchgrass Rhizosphere | DVAQLRPSDDPGFERAVRNFVWSLTWHPAIKDGAPVEAWTQMLFPPAPK* |
| Ga0075277_10419622 | 3300005895 | Rice Paddy Soil | KVSSEGRTVDVQRLRPSNDPAFERAVRDFVWTVTWHPALKAGSPVEAWTQMLFPPAPR* |
| Ga0079222_104595382 | 3300006755 | Agricultural Soil | ARLRPSNDPGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0079220_100146283 | 3300006806 | Agricultural Soil | AEGRTVDIMRLKPSNDPAFERAVRNFVWTVTWHPALKDGAPVDAWTQMLFPPTPQ* |
| Ga0075420_1013073251 | 3300006853 | Populus Rhizosphere | FERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPAQSQ* |
| Ga0075425_1007309491 | 3300006854 | Populus Rhizosphere | VKVSSEGRTVDVQRLRPSNDSAFERAVRDFVWTVTWHPALKAGSPVEAWTQMLFPPAAR* |
| Ga0075436_1011769302 | 3300006914 | Populus Rhizosphere | GRTVDVSPFRSSNDPAFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0066709_1038977762 | 3300009137 | Grasslands Soil | VDISRLRPSNDLFFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK* |
| Ga0114129_114934942 | 3300009147 | Populus Rhizosphere | VDINRLRPSNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK* |
| Ga0114129_122464491 | 3300009147 | Populus Rhizosphere | ERAVRNFVWSMTWHPALKDGTPVEAWTQMLFPPAPK* |
| Ga0105243_104580401 | 3300009148 | Miscanthus Rhizosphere | VDTVCLRQSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ* |
| Ga0075423_116501452 | 3300009162 | Populus Rhizosphere | AVFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0105241_118439431 | 3300009174 | Corn Rhizosphere | MRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ* |
| Ga0105249_134634331 | 3300009553 | Switchgrass Rhizosphere | TVDLRARQSSNDPAFEREVRSFAWSMSWHPALKDGAPVEAWTQMQFPPSRSDH* |
| Ga0126305_101080121 | 3300010036 | Serpentine Soil | VKVSAEGRTLDIRRLRPSDDAAYEREVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQE* |
| Ga0126304_106400553 | 3300010037 | Serpentine Soil | REVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQEQ* |
| Ga0126309_107170321 | 3300010039 | Serpentine Soil | EREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ* |
| Ga0126308_107623222 | 3300010040 | Serpentine Soil | SNDPAFERAVRNFVWTVTWHPAIKDGAPAEAWTQMLFPPAQQQ* |
| Ga0126312_100654273 | 3300010041 | Serpentine Soil | SNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQTQ* |
| Ga0126311_118583171 | 3300010045 | Serpentine Soil | EGRTVDIRRLKPSDDPAYEREVQNFVWGVTWHPALKDGAPVDAWTQMLFPPAQDQ* |
| Ga0126306_115324262 | 3300010166 | Serpentine Soil | STEGRTVDVAPMRPSNDSTFERAVRNFVWSLTWHPALKAGSPVEAWTQMLFPPAPK* |
| Ga0126377_110613681 | 3300010362 | Tropical Forest Soil | DVQRLRSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP* |
| Ga0134128_104898573 | 3300010373 | Terrestrial Soil | DPAFERAVRNFVWTVTWHPALKDGAPVDAWTQMLFPPTPQ* |
| Ga0134124_107742491 | 3300010397 | Terrestrial Soil | EGRTVDVSRLRPSNDATFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0134121_111557981 | 3300010401 | Terrestrial Soil | MRMETNADPAFEREVRNFVWTVTWHPALKDGAPVE |
| Ga0134123_104076183 | 3300010403 | Terrestrial Soil | SNDLIFERAVRNFVWSVTWHPALKAGAPVEAWTQMLFPPAPK* |
| Ga0137463_10537913 | 3300011444 | Soil | FERAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK* |
| Ga0136631_100009199 | 3300012043 | Polar Desert Sand | VRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ* |
| Ga0137361_105197303 | 3300012362 | Vadose Zone Soil | EGRTVDVKPLRPSNDTTFERAVRDFVWAVTWHPALKQGAPVEAWTQMLFPPAPK* |
| Ga0136615_100706792 | 3300012678 | Polar Desert Sand | VDVRRLRPSNEGEFERAVQDFVWTLTWHPALKDGAPVEAWTQMLFPPQPIAQLQ* |
| Ga0136613_106172942 | 3300012681 | Polar Desert Sand | AEGRTVDIRRLRPSDDPAYEREVRNFVWAVTWHPALKDGAPVEAWTQMLFPPAQDP* |
| Ga0136614_101195313 | 3300012684 | Polar Desert Sand | VDIRRLRPSDDLAYEREVQNFVWTVTWHPALKDGAPVDAWTQMLFPPAQDQ* |
| Ga0157309_102679721 | 3300012895 | Soil | SNDPAFERAVRNFVWTVTWHPALKDGAPVEGWTQMLFPPAQQ* |
| Ga0164300_101096923 | 3300012951 | Soil | DVTPLRPSNDAVFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0164298_101043981 | 3300012955 | Soil | RAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQQP* |
| Ga0164299_107574581 | 3300012958 | Soil | MRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQML |
| Ga0075342_10006376 | 3300014320 | Natural And Restored Wetlands | VSVEGRTVDIRRLRPSNNSEYERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP* |
| Ga0137403_112218842 | 3300015264 | Vadose Zone Soil | LLWVKVSTEGRTVDVARLRPSNDAGFERAVRNFVWSLTWHPAVKDGAPVEAWTQMLFPPAPK* |
| Ga0132256_1025601961 | 3300015372 | Arabidopsis Rhizosphere | NPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP* |
| Ga0132256_1028694912 | 3300015372 | Arabidopsis Rhizosphere | LWVKVSTEGRTVDVARLRPSNDAGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK* |
| Ga0184610_11086161 | 3300017997 | Groundwater Sediment | AEGRTVDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0184634_104265991 | 3300018031 | Groundwater Sediment | EGRTLDTRRLRPSDDSTFERAARDFVWTVTWHPALQDGAPVEAWTQMLFPPQPQ |
| Ga0184620_103261442 | 3300018051 | Groundwater Sediment | EGRTVDIRRLRPSDDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ |
| Ga0184618_101007643 | 3300018071 | Groundwater Sediment | RPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0190265_118353251 | 3300018422 | Soil | RTLDLRRLRPSDDSTFERAARDFVWTVSWHPALKDGAAVEAWTQMLFPPQPE |
| Ga0190268_100922571 | 3300018466 | Soil | QAARDFAWIIAWHPAMKDGTPVEAWAQMLFPPQPQ |
| Ga0190268_114560491 | 3300018466 | Soil | GRTVDVQRLRPSNDVEYERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPQTQPQDQ |
| Ga0190264_105323812 | 3300019377 | Soil | RPSNDAEFERAVRNFAWTLAWHPALKDGAPVEAWTQMLFPPQPVPETQ |
| Ga0210381_100647063 | 3300021078 | Groundwater Sediment | VDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0193695_11234551 | 3300021418 | Soil | PAYEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0222622_112075592 | 3300022756 | Groundwater Sediment | FERAVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPTPQ |
| Ga0210120_10135373 | 3300025556 | Natural And Restored Wetlands | RAVRNFVWSLTWHPALKDGAPVEAWTQMLFPPAPK |
| Ga0207663_111143792 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VARLRPSNDTTFERAVRNFVWSVTWHPALKGGEPVEAWTQMLFPPAPK |
| Ga0207649_112357712 | 3300025920 | Corn Rhizosphere | LRASDNPDFARAVRDFVWTVTWHPPLKDGAPVEAWTQMLFPPQKP |
| Ga0207646_111169572 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EGRTVDVARLRPSNDPGFERAVRNFVWSLTWHPAVKDGAPVEAWTQMLFPPAPK |
| Ga0207689_105438241 | 3300025942 | Miscanthus Rhizosphere | RAVRDFVWTVTWHPALKDGAPVQAWTQMLFPPQKP |
| Ga0207661_104620573 | 3300025944 | Corn Rhizosphere | LRSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPLKP |
| Ga0207648_119864342 | 3300026089 | Miscanthus Rhizosphere | RTVDVTRLRPSNDTAFERAVRNFVWSVTWHPALKNGAPVEAWTQMLFPPAQE |
| Ga0208291_10843222 | 3300026111 | Natural And Restored Wetlands | AQFEQAARDFAWIVAWHPAMKDGVPVEAWTQMLFPPQPQ |
| Ga0207674_119070742 | 3300026116 | Corn Rhizosphere | VDVSQLRPSNDSTFERAVRNFVWSLTWHPALKAGSPVEAWTQMLFPPAPK |
| Ga0209683_100344303 | 3300027840 | Wetland Sediment | DLAFERAVRNFVWSVTWHPALKDGIPIEAWTQMLFPPAPK |
| Ga0268265_117508121 | 3300028380 | Switchgrass Rhizosphere | DVAQLRPSDDPGFERAVRNFVWSLTWHPAIKDGAPVEAWTQMLFPPAPK |
| Ga0247822_107927512 | 3300028592 | Soil | VDIKSLRPSDDPQFEQAARDFAWIIAWHPAMKDGTPVEAWAQMLFPPQQQ |
| Ga0247820_105694992 | 3300028597 | Soil | LWVKVSAEGRTVDVERLRPSDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQK |
| Ga0307322_102126161 | 3300028710 | Soil | DPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQQE |
| Ga0307309_100993021 | 3300028714 | Soil | VDIMRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARDQ |
| Ga0307309_102219322 | 3300028714 | Soil | VKVSTEGRTVDIRRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQQE |
| Ga0307313_100088843 | 3300028715 | Soil | EVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0307298_101113512 | 3300028717 | Soil | YEREVRNFVWTVTWHPAVKDGAPVEAWTQMLFPPARDQ |
| Ga0307284_102363602 | 3300028799 | Soil | VDIMRLRPSNDPAYEREVRNFVWTVTWHPAVKNGAPVEAWTQMLFPPARDQ |
| Ga0307305_102374873 | 3300028807 | Soil | RTVDIMRLRPSNDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARDQ |
| Ga0307305_104675292 | 3300028807 | Soil | SNDPAFEREVRNFVWTVTWHPALKDGAPTEAWTQMLFPPARDQ |
| Ga0247826_102957313 | 3300030336 | Soil | VDVQRLRASDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP |
| Ga0268386_105815332 | 3300030619 | Soil | KVSAEGRTVDVRRLRPSNDQVYERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQRQ |
| Ga0307408_1024986331 | 3300031548 | Rhizosphere | MRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQPQ |
| Ga0310813_120925671 | 3300031716 | Soil | IMRLRPSNDPAFERAVRNFVWTVTWHPALKDGAPVEAWTQMLFPPTPQ |
| Ga0307405_115060941 | 3300031731 | Rhizosphere | PSDDTVFEQAAHDFVWTVAWHPALKDGAPVEAWTQMLFPPQPQP |
| Ga0307410_117209821 | 3300031852 | Rhizosphere | WVKVSAEGRTVDIRRLRPSDDPAYEREVQNFVWTVTWHPALKDGGPVDAWTQMLFPPAQE |
| Ga0307406_111558221 | 3300031901 | Rhizosphere | SDNPDFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP |
| Ga0307406_113409181 | 3300031901 | Rhizosphere | VDIMRLRPSNDPAFERSVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQNQ |
| Ga0307407_108354521 | 3300031903 | Rhizosphere | KVSAEGRTVDVQRLRPSDDLEFERAVRNFVWTVTWHPALKEGAPVEAWTQMLFPPQRQ |
| Ga0310900_115160652 | 3300031908 | Soil | SDDPAFERAVRNFVWGLSWHPAVKDGAPVEAWTQMLFPPAPK |
| Ga0214473_101005413 | 3300031949 | Soil | GRTVDVARLRPSNDVRFERAVRNFVWSVTWHPAFKNGAPIEAWTQMLFPPTPK |
| Ga0308176_122383941 | 3300031996 | Soil | VDIMRLRPSNDPAFEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPARAQ |
| Ga0315278_106925913 | 3300031997 | Sediment | SAFERTVRDFVWTVAWHPALKAGAPVEAWTQMLFPPAPR |
| Ga0307416_1003302571 | 3300032002 | Rhizosphere | FEQAAHDFVWTVAWHPALKDGAPVEAWTQMLFPPQPQP |
| Ga0307411_106542962 | 3300032005 | Rhizosphere | STEGRTVDIMRLRPSNDPAFERAVRNFVWTVTWHPAIKDGAPVEAWTQMLFPPAQNQQ |
| Ga0310890_110906031 | 3300032075 | Soil | RTVDVSRLRPSNDPGFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK |
| Ga0307415_1014629111 | 3300032126 | Rhizosphere | SDDPAYEREVQNFVWTVTWHPALKDGAPVEAWTQMLFPPAQEQ |
| Ga0307471_1043124282 | 3300032180 | Hardwood Forest Soil | LRPSNDTAFERAVRNFVWSVTWHPALKDGAPVEAWTQMLFPPAPK |
| Ga0310896_105629952 | 3300032211 | Soil | RSSDNADFERAVRDFVWTVTWHPALKDGAPVEAWTQMLFPPQKP |
| Ga0310812_104097252 | 3300032421 | Soil | VSRLRPSNDATFERAVRNFVWSMTWHPALKDGSPVEAWTQMLFPPAPK |
| Ga0364946_093324_2_193 | 3300033815 | Sediment | LLWVKVSAEGRTVDIRRLRPSDDPAYEREVRNFVWTVTWHPALKDGAPVEAWTQMLFPPAQDQ |
| Ga0373950_0097689_490_630 | 3300034818 | Rhizosphere Soil | RLRPSDDPVFERAVRNFVWSLSWHPAVKDGAPVEAWTQMLFPPAPK |
| ⦗Top⦘ |