| Basic Information | |
|---|---|
| Family ID | F081180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGD |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.49 % |
| % of genes near scaffold ends (potentially truncated) | 63.16 % |
| % of genes from short scaffolds (< 2000 bps) | 99.12 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.982 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (7.895 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.982 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.22% β-sheet: 0.00% Coil/Unstructured: 60.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF05598 | DUF772 | 86.84 |
| PF12833 | HTH_18 | 1.75 |
| PF13586 | DDE_Tnp_1_2 | 0.88 |
| PF12728 | HTH_17 | 0.88 |
| PF12625 | Arabinose_bd | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.98 % |
| Unclassified | root | N/A | 7.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10032246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1561 | Open in IMG/M |
| 3300001686|C688J18823_10477052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300001686|C688J18823_10924760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300001686|C688J18823_10952114 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300001991|JGI24743J22301_10030634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1058 | Open in IMG/M |
| 3300002077|JGI24744J21845_10016799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1456 | Open in IMG/M |
| 3300002568|C688J35102_119168055 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005093|Ga0062594_101977006 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005178|Ga0066688_10917088 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005329|Ga0070683_100724729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 953 | Open in IMG/M |
| 3300005335|Ga0070666_10446520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300005338|Ga0068868_100207647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1635 | Open in IMG/M |
| 3300005347|Ga0070668_101314389 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005356|Ga0070674_100443796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1069 | Open in IMG/M |
| 3300005366|Ga0070659_101119039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300005366|Ga0070659_101186828 | Not Available | 675 | Open in IMG/M |
| 3300005438|Ga0070701_10080963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1758 | Open in IMG/M |
| 3300005441|Ga0070700_101371558 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005455|Ga0070663_101625342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300005456|Ga0070678_101379064 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005535|Ga0070684_101624519 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005543|Ga0070672_101994788 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005548|Ga0070665_102084548 | Not Available | 572 | Open in IMG/M |
| 3300005614|Ga0068856_100925156 | Not Available | 891 | Open in IMG/M |
| 3300005616|Ga0068852_101763057 | Not Available | 641 | Open in IMG/M |
| 3300005617|Ga0068859_101978625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300005844|Ga0068862_101045190 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006755|Ga0079222_11477997 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006806|Ga0079220_10041350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2117 | Open in IMG/M |
| 3300006854|Ga0075425_102456295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300006876|Ga0079217_10180900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1056 | Open in IMG/M |
| 3300006894|Ga0079215_10840466 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009012|Ga0066710_104043580 | Not Available | 548 | Open in IMG/M |
| 3300009100|Ga0075418_12687909 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009101|Ga0105247_10126562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1661 | Open in IMG/M |
| 3300009156|Ga0111538_10464655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1604 | Open in IMG/M |
| 3300009551|Ga0105238_12681297 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009789|Ga0126307_11047103 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009840|Ga0126313_10139011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1824 | Open in IMG/M |
| 3300010036|Ga0126305_10857393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300010040|Ga0126308_10223526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1217 | Open in IMG/M |
| 3300010040|Ga0126308_10640415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300010040|Ga0126308_10684964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300010041|Ga0126312_10865910 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010042|Ga0126314_10560341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300010045|Ga0126311_11158962 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010146|Ga0126320_1326414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
| 3300010321|Ga0134067_10206803 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010326|Ga0134065_10093747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300010371|Ga0134125_11024648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 905 | Open in IMG/M |
| 3300010375|Ga0105239_10551826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1312 | Open in IMG/M |
| 3300010375|Ga0105239_12595044 | Not Available | 591 | Open in IMG/M |
| 3300010396|Ga0134126_10861397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
| 3300010397|Ga0134124_10546493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1127 | Open in IMG/M |
| 3300010399|Ga0134127_11569073 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010400|Ga0134122_10891874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300012210|Ga0137378_10243915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1672 | Open in IMG/M |
| 3300012212|Ga0150985_108198375 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012212|Ga0150985_114307753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1089 | Open in IMG/M |
| 3300012903|Ga0157289_10354337 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012911|Ga0157301_10014190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1652 | Open in IMG/M |
| 3300012972|Ga0134077_10503984 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300013296|Ga0157374_10878472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300013297|Ga0157378_12862065 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300013306|Ga0163162_10248788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1909 | Open in IMG/M |
| 3300013306|Ga0163162_11670150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300013306|Ga0163162_11670151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300013307|Ga0157372_11039675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300014488|Ga0182001_10043933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| 3300014968|Ga0157379_11621261 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300015201|Ga0173478_10071938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1198 | Open in IMG/M |
| 3300015372|Ga0132256_102173550 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300015374|Ga0132255_105133260 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018465|Ga0190269_10859047 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018468|Ga0066662_12585275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300019356|Ga0173481_10574850 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300019362|Ga0173479_10194027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300023071|Ga0247752_1038569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300025899|Ga0207642_10066443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1698 | Open in IMG/M |
| 3300025900|Ga0207710_10112146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1296 | Open in IMG/M |
| 3300025900|Ga0207710_10304562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300025901|Ga0207688_10212659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
| 3300025903|Ga0207680_10714544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300025917|Ga0207660_10473946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1014 | Open in IMG/M |
| 3300025918|Ga0207662_10315387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1043 | Open in IMG/M |
| 3300025919|Ga0207657_11380136 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025921|Ga0207652_11237337 | Not Available | 649 | Open in IMG/M |
| 3300025923|Ga0207681_10889505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300025924|Ga0207694_10920272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300025926|Ga0207659_10797558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300025927|Ga0207687_10193188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1586 | Open in IMG/M |
| 3300025930|Ga0207701_10183533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1844 | Open in IMG/M |
| 3300025931|Ga0207644_10189242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1617 | Open in IMG/M |
| 3300025932|Ga0207690_10168339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1639 | Open in IMG/M |
| 3300025933|Ga0207706_11645995 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025986|Ga0207658_10583429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1003 | Open in IMG/M |
| 3300026023|Ga0207677_10154316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300026035|Ga0207703_10255670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1581 | Open in IMG/M |
| 3300026067|Ga0207678_10373918 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300026075|Ga0207708_10217438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1530 | Open in IMG/M |
| 3300026075|Ga0207708_10560107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
| 3300026142|Ga0207698_10244643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1637 | Open in IMG/M |
| 3300026325|Ga0209152_10222500 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300026805|Ga0207507_100976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300026915|Ga0208838_100146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300027907|Ga0207428_10170662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1648 | Open in IMG/M |
| 3300028379|Ga0268266_10491295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300028380|Ga0268265_12676871 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300028381|Ga0268264_10270693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1587 | Open in IMG/M |
| 3300028608|Ga0247819_11006618 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300030513|Ga0268242_1152066 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031995|Ga0307409_100647278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1050 | Open in IMG/M |
| 3300032080|Ga0326721_10283433 | Not Available | 916 | Open in IMG/M |
| 3300034393|Ga0334914_063302 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026805 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026915 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN106 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300034393 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 10HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100322462 | 3300001305 | Soil | MNRAETEDRSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFGFFT |
| C688J18823_104770521 | 3300001686 | Soil | MNRAETEDRSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFGFFTDD |
| C688J18823_109247601 | 3300001686 | Soil | MNRIETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDDL |
| C688J18823_109521141 | 3300001686 | Soil | MNRAETEDSSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTA |
| JGI24743J22301_100306342 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLRTSA |
| JGI24744J21845_100167991 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQ |
| C688J35102_1191680552 | 3300002568 | Soil | MNRAETEDGSYASARNRKLLTEWAAKAGESEYAEPALNPCQTTAFEFFT |
| Ga0062594_1019770062 | 3300005093 | Soil | MNRAETEDGSYADARNRKLLAGLGLKPGENEYAEPALTRCRTTAYAFFTDDPLQSRREWCHIRLKKR* |
| Ga0066688_109170882 | 3300005178 | Soil | MNRIETEDSPYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDDNL* |
| Ga0070683_1007247292 | 3300005329 | Corn Rhizosphere | MNRTATEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQ |
| Ga0070666_104465202 | 3300005335 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0068868_1002076471 | 3300005338 | Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD |
| Ga0070668_1013143891 | 3300005347 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFF |
| Ga0070674_1004437962 | 3300005356 | Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLQSTP* |
| Ga0070659_1011190392 | 3300005366 | Corn Rhizosphere | MNRVETEDSSYASARNRKLLAEWAAKAGENEYAEPALSPCQTT |
| Ga0070659_1011868281 | 3300005366 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFEFFTDD |
| Ga0070701_100809631 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAF |
| Ga0070700_1013715581 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFF |
| Ga0070663_1016253422 | 3300005455 | Corn Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDD* |
| Ga0070678_1013790642 | 3300005456 | Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNLCQTTAYAFF |
| Ga0070684_1016245192 | 3300005535 | Corn Rhizosphere | MNRIETEDSSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFEFFTDDAPGRQE* |
| Ga0070672_1019947882 | 3300005543 | Miscanthus Rhizosphere | MNRVETEDGSDASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAFEFFTDD* |
| Ga0070665_1020845482 | 3300005548 | Switchgrass Rhizosphere | TEDSSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFVFFTDDAPGRQEW* |
| Ga0068856_1009251561 | 3300005614 | Corn Rhizosphere | MNRTETEDGSYASTRNRKLLAEWAAKAGENETLNQP* |
| Ga0068852_1017630571 | 3300005616 | Corn Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNP |
| Ga0068859_1019786252 | 3300005617 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFAGD* |
| Ga0068862_1010451901 | 3300005844 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0079222_114779971 | 3300006755 | Agricultural Soil | MNRTETEDGSYASTRNRKLLAEWAAKAGENEYAEPALNPCQ |
| Ga0079220_100413503 | 3300006806 | Agricultural Soil | MNRTETEDGSYASTRNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0075425_1024562952 | 3300006854 | Populus Rhizosphere | MNRIETEGGSYASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAYAFFTGD* |
| Ga0079217_101809002 | 3300006876 | Agricultural Soil | MNRAETEDGSYASARNRKLLAGLGLKSGENEYAEPALNPCQTT |
| Ga0079215_108404662 | 3300006894 | Agricultural Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAFEFFTDDQLCASGMELR* |
| Ga0066710_1040435801 | 3300009012 | Grasslands Soil | MNRAETEDGSYASARNRKLLAAWAAKTGENEYAEPALNPCQTTAYAFFTGD |
| Ga0075418_126879092 | 3300009100 | Populus Rhizosphere | MNRAETEDGSYASARNRKLLVGLGLKPGENEYAEPALNSCQTTAYAFFTGDQLAQQATQARTE |
| Ga0105247_101265623 | 3300009101 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQT |
| Ga0111538_104646552 | 3300009156 | Populus Rhizosphere | MNRIETEGGSYASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAYAFFTGD |
| Ga0105238_126812972 | 3300009551 | Corn Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFT |
| Ga0126307_110471032 | 3300009789 | Serpentine Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAFEFFTDD |
| Ga0126313_101390112 | 3300009840 | Serpentine Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAFEFFTDD* |
| Ga0126305_108573931 | 3300010036 | Serpentine Soil | MNRAETEDSSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYTFFTGDQTRP* |
| Ga0126308_102235261 | 3300010040 | Serpentine Soil | MNRAETEDGSYASARNRKLLTKWAAKAGESEYAEPALNPCQTTAFEFFTDDYLFVFGSLI |
| Ga0126308_106404151 | 3300010040 | Serpentine Soil | MNRAETEDGSYASGRNRKLLAEWAAKAGENEYAEPALN |
| Ga0126308_106849642 | 3300010040 | Serpentine Soil | MNRAETEDSSYASARNRKLLAEWAAKAGESEYAEPALNPCQTTAFEFFTDD |
| Ga0126312_108659101 | 3300010041 | Serpentine Soil | MNRAETEDCSYTSARNRKLLAEGASKAGESEYAEPALNPCQTTAFEFFTDDQ |
| Ga0126314_105603411 | 3300010042 | Serpentine Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAFEFFTD |
| Ga0126311_111589622 | 3300010045 | Serpentine Soil | MNRAETEDSSYASARNRKLLAEWAAKAGESEYAEPALNPCQTTAFEFFTDD* |
| Ga0126320_13264142 | 3300010146 | Soil | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDYRKCQEGLH |
| Ga0134067_102068031 | 3300010321 | Grasslands Soil | MNRAETEDGSYARARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0134065_100937471 | 3300010326 | Grasslands Soil | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALSSCQTTAYAFFTGD* |
| Ga0134125_110246481 | 3300010371 | Terrestrial Soil | MNRTETEDGSYASARNRKLSAEWAAKAGENEYAEPALNP |
| Ga0105239_105518261 | 3300010375 | Corn Rhizosphere | MNRAETEDGSYASARNRKLSAKWAAKAGENEYAEPALNPCQTTAYAF |
| Ga0105239_125950442 | 3300010375 | Corn Rhizosphere | QAEEHAIMNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFAGD* |
| Ga0134126_108613972 | 3300010396 | Terrestrial Soil | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNLFRTTAYAFFTGD* |
| Ga0134124_105464931 | 3300010397 | Terrestrial Soil | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGDEMRLGSVWETA |
| Ga0134127_115690732 | 3300010399 | Terrestrial Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0134122_108918742 | 3300010400 | Terrestrial Soil | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGDYLAHVWAKK |
| Ga0137378_102439151 | 3300012210 | Vadose Zone Soil | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0150985_1081983751 | 3300012212 | Avena Fatua Rhizosphere | QAEEHAIMNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0150985_1143077532 | 3300012212 | Avena Fatua Rhizosphere | MNRIETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDD* |
| Ga0157289_103543372 | 3300012903 | Soil | MNRTETEDGSYASARNRKLSAEWAAKAGENEYAEPALSPCQTTAYAFFTGD* |
| Ga0157301_100141902 | 3300012911 | Soil | MNRAETEDSSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGDQLSDLLP* |
| Ga0134077_105039841 | 3300012972 | Grasslands Soil | MNRAETEDGSYASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAYAFFTGD* |
| Ga0157374_108784722 | 3300013296 | Miscanthus Rhizosphere | MNRTETEDSSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFVFFTDDAPGRQEW* |
| Ga0157378_128620652 | 3300013297 | Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0163162_102487883 | 3300013306 | Switchgrass Rhizosphere | TMNRTETEDSSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFEFFTDDAPGRQE* |
| Ga0163162_116701502 | 3300013306 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFT |
| Ga0163162_116701512 | 3300013306 | Switchgrass Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFT |
| Ga0157372_110396752 | 3300013307 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNSCQTTAYAFFTGA* |
| Ga0182001_100439332 | 3300014488 | Soil | MNRSGVEDRSHTRAQNRKLLGGLALNPGENEYAQPAQNRCRTPAYAFFT |
| Ga0157379_116212612 | 3300014968 | Switchgrass Rhizosphere | MNRVETEDGSYASARNRKLLAEWAAKAGENEYAEPALNLCQTTAYAFFTRSSVFGET* |
| Ga0173478_100719382 | 3300015201 | Soil | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDPLVGAP* |
| Ga0132256_1021735502 | 3300015372 | Arabidopsis Rhizosphere | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDD* |
| Ga0132255_1051332602 | 3300015374 | Arabidopsis Rhizosphere | MNRAETEDGSYADARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD* |
| Ga0190269_108590472 | 3300018465 | Soil | MNRAETEDGSYASARNRKLLAEWAAKAGESEYAEPALNPCQTTAFEFFTDDQMTGVTRPEQF |
| Ga0066662_125852752 | 3300018468 | Grasslands Soil | MNRTETEGSSYASARNRKLLAEWAAKAGENEYAEPALNSCQTTAYAFFTGD |
| Ga0173481_105748501 | 3300019356 | Soil | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGD |
| Ga0173479_101940272 | 3300019362 | Soil | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAELALNPCQTTAFGFFTDDNLGPQASRKQIAAGLAGQ |
| Ga0247752_10385692 | 3300023071 | Soil | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGDQLVW |
| Ga0207642_100664431 | 3300025899 | Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDELK |
| Ga0207710_101121461 | 3300025900 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDYLQSAC |
| Ga0207710_103045621 | 3300025900 | Switchgrass Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDDY |
| Ga0207688_102126592 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGD |
| Ga0207680_107145442 | 3300025903 | Switchgrass Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALN |
| Ga0207660_104739462 | 3300025917 | Corn Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALS |
| Ga0207662_103153872 | 3300025918 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGDEVGRLVHTRGH |
| Ga0207657_113801361 | 3300025919 | Corn Rhizosphere | MNRVETEDSSYASARNRKRLAAWAAKAGENEYAEPALNPC |
| Ga0207652_112373371 | 3300025921 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPC |
| Ga0207681_108895052 | 3300025923 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQIGSQSLA |
| Ga0207694_109202721 | 3300025924 | Corn Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGDS |
| Ga0207659_107975582 | 3300025926 | Miscanthus Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALNLCQTTAYAFFTGDEIALDIRILRLIA |
| Ga0207687_101931882 | 3300025927 | Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTG |
| Ga0207701_101835332 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPTLKPCQTTAFEFFTDD |
| Ga0207644_101892422 | 3300025931 | Switchgrass Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAFEFFTDDYA |
| Ga0207690_101683391 | 3300025932 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLHSL |
| Ga0207706_116459951 | 3300025933 | Corn Rhizosphere | MNRVETEDGSYASARNRKLLTAWAAKAGENEYAELALNPCQTTAF |
| Ga0207658_105834291 | 3300025986 | Switchgrass Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFAGDE |
| Ga0207677_101543162 | 3300026023 | Miscanthus Rhizosphere | MNRTETEDGSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFDFFTDDAPGRQEW |
| Ga0207703_102556701 | 3300026035 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQS |
| Ga0207678_103739183 | 3300026067 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLQSTP |
| Ga0207708_102174381 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQ |
| Ga0207708_105601071 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAETEDSSYASARNRKLLAGLGLKPGENEYAEPALNPCQ |
| Ga0207698_102446432 | 3300026142 | Corn Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQIV |
| Ga0209152_102225001 | 3300026325 | Soil | MNRIETEGGSYASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAYAFFTGDYLDRRPRSAEMD |
| Ga0207507_1009761 | 3300026805 | Soil | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYAFFTGDQRRSQRHRLTWERMR |
| Ga0208838_1001461 | 3300026915 | Soil | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYA |
| Ga0207428_101706621 | 3300027907 | Populus Rhizosphere | MNRIETEGGSYASARNRKLLTEWAAKAGENEYAEPTLNPCQTTAYAFF |
| Ga0268266_104912952 | 3300028379 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALSPCQTTAFVFFTDDAPGRQEW |
| Ga0268265_126768711 | 3300028380 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLSAEWAAKAGENEYAEPALNPCQTTAYAFFTGDELV |
| Ga0268264_102706932 | 3300028381 | Switchgrass Rhizosphere | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLRA |
| Ga0247819_110066182 | 3300028608 | Soil | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDPVIS |
| Ga0268242_11520662 | 3300030513 | Soil | MNRSGVEDRSHTRAQNRKLLAGLAPNPGENEYAEPALNPCRTTAYAFFTSDY |
| Ga0307409_1006472781 | 3300031995 | Rhizosphere | MNRAETEDGSYASARNRKLLAAWAAKAGENEDAEPAL |
| Ga0326721_102834331 | 3300032080 | Soil | MNRAETEDGSYASARNRKLLAAWAAKAGENEYAEPALNPCQTTAYAFFTGD |
| Ga0334914_063302_344_508 | 3300034393 | Sub-Biocrust Soil | MNRAETEDGSYASARNRKLLAGLGLKPGENEYAEPALNPCQTTAYAFFTGDQLVR |
| ⦗Top⦘ |