 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F081097 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MNSRRIAASMIACLLTFATSARAELRHVEIKTLGMD |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.96 % |
| % of genes near scaffold ends (potentially truncated) | 7.02 % |
| % of genes from short scaffolds (< 2000 bps) | 86.84 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.175 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.035 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.456 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.509 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 1.75 |
| PF11752 | DUF3309 | 1.75 |
| PF01384 | PHO4 | 0.88 |
| PF01292 | Ni_hydr_CYTB | 0.88 |
| PF03551 | PadR | 0.88 |
| PF05163 | DinB | 0.88 |
| PF08450 | SGL | 0.88 |
| PF00378 | ECH_1 | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF00440 | TetR_N | 0.88 |
| PF13420 | Acetyltransf_4 | 0.88 |
| PF06439 | 3keto-disac_hyd | 0.88 |
| PF04188 | Mannosyl_trans2 | 0.88 |
| PF07090 | GATase1_like | 0.88 |
| PF02522 | Antibiotic_NAT | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.88 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 0.88 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.88 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.88 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.88 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.88 |
| COG5426 | Uncharacterized protein STM3548, contains class I glutamine amidotransferase domain | General function prediction only [R] | 0.88 |
| COG5542 | Mannosyltransferase related to Gpi18 | Carbohydrate transport and metabolism [G] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.18 % |
| All Organisms | root | All Organisms | 29.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.75% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.88% |
| Contaminated Culture | Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.88% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.88% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012921 | Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_06999670 | 2170459007 | Grass Soil | MTLKTVVTSALAMLLFATSARAELRHVEIKTLGMD |
| 2PV_02193810 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MKRMKIAGSTIALTLLLATSAHAELRHVELRTLGMD |
| 4ZMR_01111400 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MKTKIASTTIALLLVFATSGRAELRHVEIKTLGMD |
| C688J18823_102094602 | 3300001686 | Soil | VVEIGAVMNSRRIAAPMIACLLTFATSARAELRHVEIKTLGMD* |
| C688J18823_103240893 | 3300001686 | Soil | MNPRLFGASVLATLLLATPARAELRHLEIKTLGMD* |
| C688J18823_103307772 | 3300001686 | Soil | MNATKMTSTTIALLLVFATAGRAELRHVEIKTLGMD* |
| Ga0062589_1024957781 | 3300004156 | Soil | VLFLAEIGIWMNTKIASTTIALLLVFATSGRAELRHVEIKTLGMD* |
| Ga0070709_105555661 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRANMKGLQITGTAIALTLLLATSARAELRHVELKTLGMD* |
| Ga0070705_1009365703 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEIGVVMRPKTIASAFALILLLATSAGAELRHVEIKTLGMD* |
| Ga0070672_1006600172 | 3300005543 | Miscanthus Rhizosphere | MKTKIASTTIALLLVFATSGRAELRHVEIKTLGMD* |
| Ga0070665_1001948015 | 3300005548 | Switchgrass Rhizosphere | MKSGAIAGTVIATLLLAASARAELRHVEIKTLGMD* |
| Ga0070664_1002481832 | 3300005564 | Corn Rhizosphere | MNTKIASTTIALLLVFATSGRAELRHVEIKTLGMD* |
| Ga0068852_1018484712 | 3300005616 | Corn Rhizosphere | MNKHRIVEFTIALVLIAATSARAELRHVEIKTLGMD* |
| Ga0068861_1017056882 | 3300005719 | Switchgrass Rhizosphere | MKPTIIAFSILAAALLVPASASAELRHVEIKTLGMD* |
| Ga0066903_1000064566 | 3300005764 | Tropical Forest Soil | MRTTTIASTLVVSLMIANSAVAELRHVEIKTLGMD* |
| Ga0066903_1002277612 | 3300005764 | Tropical Forest Soil | MKPRMIAASTFALAVLAASPARAELRHVELKTLGMD* |
| Ga0068862_1026650872 | 3300005844 | Switchgrass Rhizosphere | MKPTIIAFSILAAALLVPASAFAELRHVEIKTLGMD* |
| Ga0081539_101475192 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTWANIVTAFGLMLAAATTAHAELRHVEIKTLGMD* |
| Ga0070717_113141332 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRATMTRMRITGSAIALTLLLSTSARAELRHVELKTLGMD* |
| Ga0066651_104479212 | 3300006031 | Soil | MNNRRIAASMIACLLTFTTSARAELRHVEIKTLGMD* |
| Ga0075368_104477812 | 3300006042 | Populus Endosphere | MTTPRIFAMTIACVLIAAASARAELRHVEIKTLGMD* |
| Ga0066652_1011779571 | 3300006046 | Soil | MKPLMIAASVIAFLLVCASSARAELRHVELKTLGMD* |
| Ga0075417_104261682 | 3300006049 | Populus Rhizosphere | MNTHRIAVGTIALALTFATAAQAELRHVEIKTLGMD* |
| Ga0075417_105784911 | 3300006049 | Populus Rhizosphere | MSTNRITAATAAILLVFATSARAELRHVEIKTLGMD* |
| Ga0066660_105979212 | 3300006800 | Soil | MKPRMIAASVIAFLLVRASSARAELRHVELKTLGMD* |
| Ga0075428_1002368042 | 3300006844 | Populus Rhizosphere | MNIKSVAGTVMALTLVCATSARAELRHVELKTLGMD* |
| Ga0075433_107648752 | 3300006852 | Populus Rhizosphere | MKPTTIAFAIFAVTLLLPASASAELRHVEIKTLGMD* |
| Ga0075425_1000532074 | 3300006854 | Populus Rhizosphere | MNLKPVTGTVVALMLAFATSARAELRHVELKTLGMD* |
| Ga0075434_1002466433 | 3300006871 | Populus Rhizosphere | MRIPRITATSVIVAALLMAAPARAELRHVEIKTLGMD* |
| Ga0075434_1004817283 | 3300006871 | Populus Rhizosphere | MNTNSIVALGIGFVLAFAGSARAELRHVEIKTLGMD* |
| Ga0075434_1024568542 | 3300006871 | Populus Rhizosphere | VNKQTIAGTTIALALVFATSARAELRHVELKTLGMD* |
| Ga0075426_101039603 | 3300006903 | Populus Rhizosphere | VSCKPLAAMLAALFLAPTSAGAELRHVEIRTLGMD* |
| Ga0075424_1001628884 | 3300006904 | Populus Rhizosphere | MRKIPAVAIALLITAASSAHAELRHVEIKTLGMD* |
| Ga0075436_1006304782 | 3300006914 | Populus Rhizosphere | MNRIAASTIALFLGCATSARAELLHVEIKTLGMD* |
| Ga0079219_116273482 | 3300006954 | Agricultural Soil | MNRHRIITTTAIALLLSATSARAELRHVEIKTLGMD* |
| Ga0075435_1004161682 | 3300007076 | Populus Rhizosphere | MRKHTFTASMIAFMLMFATTARAELRHVEIKTLGMD* |
| Ga0105240_105316282 | 3300009093 | Corn Rhizosphere | MKRMKIAGSTIALTLLLATSAHAELRHVELRTLGMD* |
| Ga0105240_107697841 | 3300009093 | Corn Rhizosphere | QSRILLLDQIGAVPMKSGAIAGTVIATLLLAASARAELRHVEIKTLGMD* |
| Ga0105240_110388102 | 3300009093 | Corn Rhizosphere | MKGLQITGTAIAFTLLLATSARAELRHVELKTLGMD* |
| Ga0105245_101000884 | 3300009098 | Miscanthus Rhizosphere | MKPKTAASALAIMLLFATSTRAELRHVEIKTLGMD* |
| Ga0105247_104407422 | 3300009101 | Switchgrass Rhizosphere | MNKHRIAGLTISCLLIAATAARADLRHVEIKTLGMD* |
| Ga0066709_1040642332 | 3300009137 | Grasslands Soil | MKPRMIAASVIAFLLVCASSARAELRHVELKTLGMD* |
| Ga0114129_106562463 | 3300009147 | Populus Rhizosphere | MNTRVIAAGAMALFFTFAGSAHAELRHVEIKTLGMD* |
| Ga0105243_122791352 | 3300009148 | Miscanthus Rhizosphere | LLDQIGAVPMKSGAIAGTVIATLLLAASARAELRHVEIKTLGMD* |
| Ga0075423_1000494113 | 3300009162 | Populus Rhizosphere | MSTNRIAAATAAILLVFATSARAELRHVEIKTLGMD* |
| Ga0105242_118223622 | 3300009176 | Miscanthus Rhizosphere | MKPKTTASALAIMLLLGTSARAELRHLEIKTLGMD* |
| Ga0105248_122231422 | 3300009177 | Switchgrass Rhizosphere | MNSRRIAASMIMVLLTFATSARAELRHVEIKTLGMD* |
| Ga0105238_101352753 | 3300009551 | Corn Rhizosphere | MTRHIIAASTVTLMLAFGGSAQAELRHVEIKTLGMD* |
| Ga0105249_117136262 | 3300009553 | Switchgrass Rhizosphere | MKKRLIGAAAIALTFVFAQPTRAELLHIEIKTLGMD* |
| Ga0105249_133636642 | 3300009553 | Switchgrass Rhizosphere | MKSTIIAFSILAAALLVPASAFAELRHVEIKTLGMD* |
| Ga0126309_107718441 | 3300010039 | Serpentine Soil | LMKKHTIAAATIALTLAVATSARAELLHVEIKTLGMD* |
| Ga0134065_103647102 | 3300010326 | Grasslands Soil | MNNRRIAASMIACLLTFTTSARAELRHLEIKTLGMD* |
| Ga0126377_128566482 | 3300010362 | Tropical Forest Soil | MNKNRIIAITATCLLIAATSARAELRHVEIKTLGMD* |
| Ga0134122_100312666 | 3300010400 | Terrestrial Soil | MNRHTITGMTIALMVAFAPSARAELRHVEIKTLGMD* |
| Ga0134122_115557792 | 3300010400 | Terrestrial Soil | MNLYRIAGPMIAFMLTFATSARAELRHVEIKTLGMD* |
| Ga0134122_129678532 | 3300010400 | Terrestrial Soil | KTHMVAATAMAWLFAFTSPAHAELRHAEIKTLGMD* |
| Ga0134121_116813952 | 3300010401 | Terrestrial Soil | MRPKTIASALAMMLLLATSAQAELRHVEIKTLGMD* |
| Ga0134123_119118202 | 3300010403 | Terrestrial Soil | MRPKTIASAFALILLLATSAGAELRHVEIKTLGMD* |
| Ga0105246_118215821 | 3300011119 | Miscanthus Rhizosphere | IGAVPMKSGAIAGTVIATLLLAASARAELRHVEIKTLGMD* |
| Ga0137383_107143361 | 3300012199 | Vadose Zone Soil | MTMKLKTIALSTFVIALLLPASALAELRHVEIKTLGMD* |
| Ga0137382_101497032 | 3300012200 | Vadose Zone Soil | MKPKTSASALAMMLLLATSARAELRHVEIKTLGMD* |
| Ga0137376_114064662 | 3300012208 | Vadose Zone Soil | MKPKTIASALAIMLLLATSARAELRHVEIKTLGMD* |
| Ga0150985_1206163925 | 3300012212 | Avena Fatua Rhizosphere | MNTRRIAAPMIACLLTFATSARAELRHVEIKTLGMD* |
| Ga0137369_100000611 | 3300012355 | Vadose Zone Soil | MNIKIAAATIALSVLVPTSARAELRHVELKTVGMD* |
| Ga0150984_1083969502 | 3300012469 | Avena Fatua Rhizosphere | MNPRLFSASVLATLLLATPARAELRHLEIKTLGMD* |
| Ga0150984_1217731441 | 3300012469 | Avena Fatua Rhizosphere | EIGAVMNSRRIAAPMIACLLTFATSARAELRHVEIKTLGMD* |
| Ga0164290_1000038131 | 3300012921 | Contaminated Culture | MVKHTVLAFMLVAAVSVPASAELRRVEIKTLGMD* |
| Ga0137394_109678632 | 3300012922 | Vadose Zone Soil | MNRHTIAGMTIALIVAFAPSARAELRHVEIKTLGMD* |
| Ga0137404_117885342 | 3300012929 | Vadose Zone Soil | MNIKSIGATIALGMLLSTSARAELRHVELKTLGMD* |
| Ga0137407_119027232 | 3300012930 | Vadose Zone Soil | MTSTRIAVTTIALLLVFATSGRAELRHVEIKTLGMD* |
| Ga0157375_121293321 | 3300013308 | Miscanthus Rhizosphere | MKTKIASTTIALLLVFAMSGRADLRHVEIKTLGMD* |
| Ga0163163_108376412 | 3300014325 | Switchgrass Rhizosphere | MKLKATVASALAILLLATSARAELRHVEIKTLGMD* |
| Ga0132257_1020557312 | 3300015373 | Arabidopsis Rhizosphere | MNRHTIAGMTIALMVAFAPSARAELRHVEIKTLGMD* |
| Ga0184605_100102675 | 3300018027 | Groundwater Sediment | MRPKTIASALAIMLLLTTSARAELRHVEIKTLGMD |
| Ga0184608_101468072 | 3300018028 | Groundwater Sediment | MRPKTIAASAVAVILLLAAPARAELRHVEITTLGMD |
| Ga0184611_12600632 | 3300018067 | Groundwater Sediment | VNKHIIAGTTIALIFVFAMSARAELRHVELKTLGMD |
| Ga0184618_101326982 | 3300018071 | Groundwater Sediment | MRPKTIPSVLAIMLLLATSARAELRHVEIKTLGMD |
| Ga0184635_103799902 | 3300018072 | Groundwater Sediment | VNKHTIAGTTIALILVFAASARAELRHVELKTLGMD |
| Ga0184632_101617552 | 3300018075 | Groundwater Sediment | MYKHRIAGLMLAFVLAFATSVRADLRHVEIKTLGMD |
| Ga0190274_128801782 | 3300018476 | Soil | VRIGIVAASALALTLLLAASARAELRHVEIKTLGMD |
| Ga0173481_102102212 | 3300019356 | Soil | MRPTIIAFSILAAALLVPASAFAELRHVEIKTLGMD |
| Ga0193723_10344022 | 3300019879 | Soil | VNKHTIAGTTIALIFVFATSARAELRHVELKTLGMD |
| Ga0193753_101454983 | 3300020034 | Soil | MRLNRIVTSAFALALVLLGAAPARAELRHVEIKTLGMD |
| Ga0210409_104858992 | 3300021559 | Soil | MTRKTVLGSALAVVLFATSAQAELRHVEIKTLGMD |
| Ga0222622_100653554 | 3300022756 | Groundwater Sediment | MNTQMIVGTTVALMLALATSARAELRHVEIKTLGMD |
| Ga0222622_101633172 | 3300022756 | Groundwater Sediment | MKKQLIGAAAIALTFVFAQPARAELLHVEIKTLGMD |
| Ga0222622_103117452 | 3300022756 | Groundwater Sediment | MRPKTIASALAIMLLLATSARAELRHVEIKTLGMD |
| Ga0222622_105835142 | 3300022756 | Groundwater Sediment | MKFSKVGAIAMLAVMLNAWSARAELRHVELKTLGMD |
| Ga0247802_10698472 | 3300023077 | Soil | MNTTKIASTTIALLLVFATSGRAELRHVEIKTLGMD |
| Ga0207710_1000147610 | 3300025900 | Switchgrass Rhizosphere | MNTKIASTTIALLLVFATSGRAELRHVEIKTLGMD |
| Ga0207710_102402672 | 3300025900 | Switchgrass Rhizosphere | MNKHRIAGLTISCLLIAATAARADLRHVEIKTLGMD |
| Ga0207684_104437393 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPNTIASALAILLLLAPSAGAELRHVEIKTLGMD |
| Ga0207654_110710422 | 3300025911 | Corn Rhizosphere | MNKHRIVEFTIALVLIAATSARAELRHVEIKTLGMD |
| Ga0207652_110599602 | 3300025921 | Corn Rhizosphere | MNRRLLTASALGFLLIAAPGRAELRHVEIKTLGMD |
| Ga0207670_106060152 | 3300025936 | Switchgrass Rhizosphere | MKPTLIAFSILAAALLVPASAFAELRHVEIKTLGMD |
| Ga0207640_101995853 | 3300025981 | Corn Rhizosphere | MKPKTIASALAIMLLLATSARAELHHVEIKTLGMD |
| Ga0209238_10820642 | 3300026301 | Grasslands Soil | MNSRRIAASMIACLLTFATSARAELRHVEIKTLGMD |
| Ga0209814_103203162 | 3300027873 | Populus Rhizosphere | MNTHRIAVGTIALALTFATAAQAELRHVEIKTLGMD |
| Ga0207428_101420192 | 3300027907 | Populus Rhizosphere | MNIKSVAGTVMALTLVCATSARAELRHVELKTLGMD |
| Ga0268265_120939872 | 3300028380 | Switchgrass Rhizosphere | MKPTIIAFSILAAALLVPASAFAELRHVEIKTLGMD |
| Ga0307313_102541552 | 3300028715 | Soil | MRPKTIASVLAIMLLLATSARAELRHVEIKTLGMD |
| Ga0307280_102113862 | 3300028768 | Soil | VRIGIVAASALALILLLAASARAELRHVEIKTLGMD |
| Ga0307310_105059392 | 3300028824 | Soil | MKPKTIASALAIMLLLATSTRAELRHVEIKTLGMD |
| Ga0307277_103187342 | 3300028881 | Soil | MNTQIIVGTTIALMLALATSARAELRHVEIKTLGMD |
| (restricted) Ga0255311_10790802 | 3300031150 | Sandy Soil | MRLKTITTFTLAVVLLLATSARAELRHVEIKTLGMD |
| Ga0310813_102835642 | 3300031716 | Soil | MKPTIIACSILAAALLVPASAFAELRHVEIKTLGMD |
| Ga0307469_101655933 | 3300031720 | Hardwood Forest Soil | MNSRRIAASMTVVLLTFATSARAELRHVEIKTLGMD |
| Ga0308175_1011791542 | 3300031938 | Soil | MNRTRIIAIAATALLLAATSARAELRHVEIKTLGMD |
| Ga0315910_113643752 | 3300032144 | Soil | MSMPKFTIAFVAALIFASPAQAELRRVEIKTLGMD |
| Ga0307470_108947642 | 3300032174 | Hardwood Forest Soil | MKLKTVATSALAMIFFATSARAELRHVEIKTLGMD |
| Ga0307471_1006696853 | 3300032180 | Hardwood Forest Soil | MKLKTLATSALALLLVATSAHAELRHVEIKTLGMD |
| Ga0307471_1012432482 | 3300032180 | Hardwood Forest Soil | MNKHTVAGITIALMLAFATPARAELRHVEIKTLGMD |
| Ga0307472_1001828112 | 3300032205 | Hardwood Forest Soil | MNSRRIAASMTVVLLTFATSARAELRQVEIKTLGMD |
| Ga0372943_1051660_220_330 | 3300034268 | Soil | MSIKQITSTALALVLLCATTARAELRHAEIKTLGMD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |