| Basic Information | |
|---|---|
| Family ID | F080821 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 52 residues |
| Representative Sequence | VIGILFLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGIAFVTLAARRK |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.14 % |
| % of genes near scaffold ends (potentially truncated) | 22.81 % |
| % of genes from short scaffolds (< 2000 bps) | 69.30 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.123 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.790 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.386 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.772 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF01916 | DS | 31.58 |
| PF08241 | Methyltransf_11 | 19.30 |
| PF00005 | ABC_tran | 7.89 |
| PF02784 | Orn_Arg_deC_N | 4.39 |
| PF00278 | Orn_DAP_Arg_deC | 3.51 |
| PF15919 | HicB_lk_antitox | 3.51 |
| PF03681 | Obsolete Pfam Family | 2.63 |
| PF04138 | GtrA | 1.75 |
| PF00160 | Pro_isomerase | 0.88 |
| PF00571 | CBS | 0.88 |
| PF01066 | CDP-OH_P_transf | 0.88 |
| PF12802 | MarR_2 | 0.88 |
| PF13174 | TPR_6 | 0.88 |
| PF07927 | HicA_toxin | 0.88 |
| PF06831 | H2TH | 0.88 |
| PF00291 | PALP | 0.88 |
| PF13579 | Glyco_trans_4_4 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 31.58 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 7.89 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 7.89 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.88 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.88 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.88 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.88 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908006|FWIROz_GJ87FRN02GAJQD | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 507 | Open in IMG/M |
| 3300000887|AL16A1W_10095540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3213 | Open in IMG/M |
| 3300001326|A2835W6_1053756 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300002886|JGI25612J43240_1038999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300002897|JGI24804J43974_1008443 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300002907|JGI25613J43889_10000796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7646 | Open in IMG/M |
| 3300004156|Ga0062589_100067808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2103 | Open in IMG/M |
| 3300004156|Ga0062589_101094489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 753 | Open in IMG/M |
| 3300004479|Ga0062595_101204406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300004778|Ga0062383_10180518 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005293|Ga0065715_10822355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005330|Ga0070690_100601791 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005331|Ga0070670_100003858 | All Organisms → cellular organisms → Bacteria | 12500 | Open in IMG/M |
| 3300005334|Ga0068869_100003799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 9306 | Open in IMG/M |
| 3300005334|Ga0068869_100009108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6431 | Open in IMG/M |
| 3300005345|Ga0070692_10528040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300005353|Ga0070669_100959095 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005354|Ga0070675_100464208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300005355|Ga0070671_100452038 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005364|Ga0070673_100332231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
| 3300005440|Ga0070705_100848791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300005441|Ga0070700_100092927 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300005444|Ga0070694_100306788 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005444|Ga0070694_100609754 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005456|Ga0070678_101629066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300005467|Ga0070706_100042282 | All Organisms → cellular organisms → Bacteria | 4209 | Open in IMG/M |
| 3300005471|Ga0070698_100024457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6302 | Open in IMG/M |
| 3300005518|Ga0070699_100057985 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300005518|Ga0070699_100896258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300005546|Ga0070696_100079149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2325 | Open in IMG/M |
| 3300005546|Ga0070696_100346299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300005548|Ga0070665_100666852 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005549|Ga0070704_101358514 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005564|Ga0070664_100153337 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300005577|Ga0068857_101103618 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005616|Ga0068852_101896356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300005617|Ga0068859_101473052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300005618|Ga0068864_101885726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005719|Ga0068861_100800621 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005719|Ga0068861_101224774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300009036|Ga0105244_10372742 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300009137|Ga0066709_101682530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300009148|Ga0105243_11113479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300009176|Ga0105242_12750060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010045|Ga0126311_11635389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 543 | Open in IMG/M |
| 3300010373|Ga0134128_11952782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300010396|Ga0134126_10100197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3561 | Open in IMG/M |
| 3300010399|Ga0134127_10188085 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300010400|Ga0134122_10847871 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010400|Ga0134122_11678431 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010403|Ga0134123_13528078 | Not Available | 507 | Open in IMG/M |
| 3300011119|Ga0105246_11021679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300011438|Ga0137451_1157952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300011444|Ga0137463_1009392 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300011444|Ga0137463_1061268 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300012198|Ga0137364_10155725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1655 | Open in IMG/M |
| 3300012199|Ga0137383_10307670 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012353|Ga0137367_10084430 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300012354|Ga0137366_10684433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012355|Ga0137369_10080619 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300012360|Ga0137375_10488176 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300012362|Ga0137361_10214337 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300012532|Ga0137373_10136701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2087 | Open in IMG/M |
| 3300012582|Ga0137358_11090154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012685|Ga0137397_10616248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012922|Ga0137394_10620783 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300012923|Ga0137359_11077033 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012925|Ga0137419_10599193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300012930|Ga0137407_12319753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012944|Ga0137410_10000934 | All Organisms → cellular organisms → Bacteria | 20080 | Open in IMG/M |
| 3300012961|Ga0164302_10348936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300013294|Ga0120150_1017344 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300013764|Ga0120111_1000563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 18595 | Open in IMG/M |
| 3300014488|Ga0182001_10008087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2209 | Open in IMG/M |
| 3300015069|Ga0167633_101639 | All Organisms → cellular organisms → Bacteria | 5288 | Open in IMG/M |
| 3300015161|Ga0167623_1000030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 121786 | Open in IMG/M |
| 3300015245|Ga0137409_11544464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300015264|Ga0137403_10053087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4172 | Open in IMG/M |
| 3300018027|Ga0184605_10006428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 4304 | Open in IMG/M |
| 3300018052|Ga0184638_1134231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300018056|Ga0184623_10257915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300018059|Ga0184615_10228784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300018084|Ga0184629_10142704 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300018084|Ga0184629_10686368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300018476|Ga0190274_13371417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300018920|Ga0190273_12268778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300019789|Ga0137408_1371503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2351 | Open in IMG/M |
| 3300019882|Ga0193713_1051305 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300019883|Ga0193725_1013109 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
| 3300019998|Ga0193710_1032145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025910|Ga0207684_10029750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4650 | Open in IMG/M |
| 3300025934|Ga0207686_11775944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300025935|Ga0207709_10524495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300025942|Ga0207689_10011916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7450 | Open in IMG/M |
| 3300025942|Ga0207689_10024611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5049 | Open in IMG/M |
| 3300025942|Ga0207689_11183857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300025960|Ga0207651_10059329 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300026088|Ga0207641_10012505 | All Organisms → cellular organisms → Bacteria | 6957 | Open in IMG/M |
| 3300026116|Ga0207674_11014338 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300026121|Ga0207683_10057343 | All Organisms → cellular organisms → Bacteria | 3419 | Open in IMG/M |
| 3300026142|Ga0207698_11290034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300026142|Ga0207698_11851692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300026285|Ga0209438_1022072 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300026320|Ga0209131_1000046 | All Organisms → cellular organisms → Bacteria | 107528 | Open in IMG/M |
| 3300026377|Ga0257171_1009812 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300026377|Ga0257171_1027355 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300028379|Ga0268266_11398967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031152|Ga0307501_10025375 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031731|Ga0307405_10404136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1070 | Open in IMG/M |
| 3300031740|Ga0307468_100023794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2773 | Open in IMG/M |
| 3300031740|Ga0307468_100282527 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300034000|Ga0334918_023299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300034174|Ga0334932_000001 | All Organisms → cellular organisms → Bacteria | 890101 | Open in IMG/M |
| 3300034176|Ga0364931_0159822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.39% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.88% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001326 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002897 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um Nextera | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIROz_05568950 | 2124908006 | Soil | HGGGNLSAGTLRVFGFLFLVAAAVVAILNLKRVANLGMMWLSPPLMIIGIAFVAMAGRRK |
| AL16A1W_100955402 | 3300000887 | Permafrost | MVAAAVVAVLNLKRVANLGMLWLSPPLLIVGMVFVALAKRHK* |
| A2835W6_10537561 | 3300001326 | Permafrost | MVAAAVVAVLNLKRVANLGMLWLSPPLLIVGMVFV |
| JGI25612J43240_10389992 | 3300002886 | Grasslands Soil | LSATALRLIGILFMVAAAVVVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRKAQRPPD* |
| JGI24804J43974_10084431 | 3300002897 | Soil | LSAKTLRLLGIVCLIAAAIVAVLNLKRVADLGAFWLSAPLLVIGIGLVAASRRKADRLGP |
| JGI25613J43889_100007963 | 3300002907 | Grasslands Soil | MVAAAVVVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRKAQRPPD* |
| Ga0062589_1000678082 | 3300004156 | Soil | LSAQTLRLLGIIILVAAAVIALLNLKRTANLGMLWLNALLVIGIALIVAARRRS* |
| Ga0062589_1010944892 | 3300004156 | Soil | VSAKTLRLLGIVCLIAAAIVAVLNLKRVANLGMFWLSPPLLVVGLGFIAAARRKS* |
| Ga0062595_1012044061 | 3300004479 | Soil | LSATTLRLIGFLFLVAAAIVAIMNLKRVANLGMVWLSPPLMILGIVLLAASRRKA* |
| Ga0062383_101805181 | 3300004778 | Wetland Sediment | LSASTLRVIGFLFLVAAAVVAVLNLKRVANLGMIWLSPPLMIIGIALVAMAGRESENGLL |
| Ga0065715_108223551 | 3300005293 | Miscanthus Rhizosphere | RLIGFLFLVAAAIVAIMNLKRVANLGMVWLSPPLMILGIVLLAASRRKA* |
| Ga0070690_1006017912 | 3300005330 | Switchgrass Rhizosphere | LSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIFGLALVAIAARRR* |
| Ga0070670_10000385811 | 3300005331 | Switchgrass Rhizosphere | LSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLILGLALVAVAARRR* |
| Ga0068869_1000037998 | 3300005334 | Miscanthus Rhizosphere | MAAAAVVGILNLKRVANLGMLGLSAPLLIIGMGFLAASRRRARG* |
| Ga0068869_1000091082 | 3300005334 | Miscanthus Rhizosphere | MVAAAVVAVLNLKRVANLGMLGLSAPLLIVGMGFLAASRRKAQRPPH* |
| Ga0070692_105280401 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAQTLRILGILMLVAAAVIAILNLKRVANLGLLWLNAPLLVIGIALIVAARRRA* |
| Ga0070669_1009590951 | 3300005353 | Switchgrass Rhizosphere | MEVANLSPATLRGIGIGFLVAAVVIALLNLKRVANLGMLWLNAPLLVIGVALIFLARRRS |
| Ga0070675_1004642082 | 3300005354 | Miscanthus Rhizosphere | MDKTLSAKTLRLLGIVCLIAAAVVAVLNLKRVANLGIFWLSAPLLVIGIGLVAASRRRSIP* |
| Ga0070671_1004520382 | 3300005355 | Switchgrass Rhizosphere | VSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLILGLALVAIAARRR* |
| Ga0070673_1003322314 | 3300005364 | Switchgrass Rhizosphere | LSPKTLRVLGILLLVAAAIVAVLNLKRVANLGMMWLSPPLLIVGLALVAIAARRRR* |
| Ga0070705_1008487911 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LSATTLRVIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK* |
| Ga0070700_1000929271 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIFGLALVAIAARRR* |
| Ga0070694_1003067882 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPATLRGIGIGFLVAAVVIALLNLKRVANLGMLWLNAPLLVIGIALIFLARRRT* |
| Ga0070694_1006097542 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RVIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK* |
| Ga0070678_1016290661 | 3300005456 | Miscanthus Rhizosphere | LSVTALRLIGILFMVAAAVVAVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRTAKRPPP |
| Ga0070706_1000422822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGILVLVTAAVVAVLNLKRLANLGMMWLSPPLLIVGVGLVTLAARKK* |
| Ga0070698_1000244577 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSATALRVIGILFMVAAAVVAVLNLKRVANLGMLGLSAPLLVIGMGFLAASRRKAQRPPH |
| Ga0070699_1000579853 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK* |
| Ga0070699_1008962582 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSKTLRVIGILLLVAAAVVAVMNLKRVANLGMLWLSPPLLIVGIAFVALAARRK* |
| Ga0070696_1000791493 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAQTLRILGILILVAAAVIAVLNLKRVANLGMLWLNAPLLVIGIALIVAARRRSL* |
| Ga0070696_1003462992 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAQTLRILGILMLLAAAVIAVLNLKRVANLGMLWLNAPLLVIGIALIVAARRRA* |
| Ga0070665_1006668522 | 3300005548 | Switchgrass Rhizosphere | LSAKTVRLLGIVCLIAAAIVAVLNLKRVANLGTFWLSAPLLVIGIGLVAASRRKT* |
| Ga0070704_1013585141 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPATLRGIGIGFLVAAVVIALLNLKRVANLGMLWLNAPLLVIGVALILLARRRT* |
| Ga0070664_1001533372 | 3300005564 | Corn Rhizosphere | VSATTFRVIGILFMAAAAVVGILNLKRVANLGMLGLSAPLLIIGMGFLAASRRRARG* |
| Ga0068857_1011036182 | 3300005577 | Corn Rhizosphere | LSPKTLRVLGILLLVAAAIVAVLNLKRVANLGMVWLSPPLLIVGLALVAIAARRR* |
| Ga0068852_1018963561 | 3300005616 | Corn Rhizosphere | VLGILLLVCAAVVAVLNLKRVANLGMMWLSPPLLIIGLALVAIAARRR* |
| Ga0068859_1014730522 | 3300005617 | Switchgrass Rhizosphere | LVAAAILAVLNLKRVANLGMMWLSPPLLIVGLALVAIAARRRR* |
| Ga0068864_1018857261 | 3300005618 | Switchgrass Rhizosphere | VSATTFRVIGILFMAAAAVVGILNLKRVANLGMLGLSAPLLIIGMGFLAASRRRAR |
| Ga0068861_1008006211 | 3300005719 | Switchgrass Rhizosphere | LSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLIVGLALVAIAARRR* |
| Ga0068861_1012247741 | 3300005719 | Switchgrass Rhizosphere | LSAKTLRILGFVFLVAAAVVAILNLKRVAGLGMFWLSAPLLIVGVALMASSRRKSTLS* |
| Ga0105244_103727422 | 3300009036 | Miscanthus Rhizosphere | LVAAAIVAVLNLKRVANLGMVWLSPPLLIVGLALVAIAARRR* |
| Ga0066709_1016825302 | 3300009137 | Grasslands Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLNAPLLVIGILFVGLSARRK* |
| Ga0105243_111134792 | 3300009148 | Miscanthus Rhizosphere | VQPGGKNNLSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIVGLALVAIAARRRR* |
| Ga0105242_127500602 | 3300009176 | Miscanthus Rhizosphere | MVAAALVAVLNLKRVANLGMLGLSAPLVIIGMGFLAASRRTAKRPPP* |
| Ga0126311_116353891 | 3300010045 | Serpentine Soil | IGIVFLVAAAVLAILNLKRVANLGMFWVSPPLMIIGLAFVTLARRRG* |
| Ga0134128_119527821 | 3300010373 | Terrestrial Soil | MEVANLSPAMLRGIGIGFLVAAVVIALLNLKRVANLGMLWLNAPLLVIGVALIFLARRRS |
| Ga0134126_101001973 | 3300010396 | Terrestrial Soil | LSVTTLRVIGLLFLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVALAARKK* |
| Ga0134127_101880853 | 3300010399 | Terrestrial Soil | VAAAVVAVLNLKRVANLGMMWLSPPLLIFGLALVAIAARRR* |
| Ga0134122_108478711 | 3300010400 | Terrestrial Soil | MVAAAVVAVLNLKRVANLGMLGLSAPLLIIGMGFLAVSRRTAKRPPP* |
| Ga0134122_116784312 | 3300010400 | Terrestrial Soil | MVAAAFVAVLNLKRVANLGMLLRSAPLLVIGMGFLAASRKKSQRPPT* |
| Ga0134123_135280781 | 3300010403 | Terrestrial Soil | SHCFVEPESGGTITLSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIFGLALVAIAARRR* |
| Ga0105246_110216791 | 3300011119 | Miscanthus Rhizosphere | VQPGGKNNLSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIMGLALVAIAARRR* |
| Ga0137451_11579522 | 3300011438 | Soil | LSATTLRVIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLIVGMAFVVLAARRK* |
| Ga0137463_10093921 | 3300011444 | Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGIAFVTLAARRK* |
| Ga0137463_10612682 | 3300011444 | Soil | VVGILFLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGLAFVALAARRK* |
| Ga0137364_101557251 | 3300012198 | Vadose Zone Soil | MIGILFLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGVAFVALAGRRK* |
| Ga0137383_103076702 | 3300012199 | Vadose Zone Soil | MSAKTLRMIGILFLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGVAFVALAGRRK* |
| Ga0137367_100844302 | 3300012353 | Vadose Zone Soil | VIGILFLVAAGVVAVLNLKRVANLGMLWLNAPLLVIGIAFIAMSARRK* |
| Ga0137366_106844331 | 3300012354 | Vadose Zone Soil | VIGILFLVTAAVVAILNLKRVANLGMLWLNAPLLVIGIAFVALSGRRK* |
| Ga0137369_100806194 | 3300012355 | Vadose Zone Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLNAPLLVIGIAFIAMSARRK* |
| Ga0137375_104881761 | 3300012360 | Vadose Zone Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLNAPLLVIGIAFMAMSARRK* |
| Ga0137361_102143372 | 3300012362 | Vadose Zone Soil | MSAKTLRMIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIVGVAFVALAGRRK* |
| Ga0137373_101367013 | 3300012532 | Vadose Zone Soil | RVIGILLLVTAAAVAVLNLKRVANLGMLWLSPPLLIAGIAFVALAGRRK* |
| Ga0137358_110901541 | 3300012582 | Vadose Zone Soil | VIGFLFLVAAMVIAVLNLKRVANLGMLWLNAPLLVIGVA |
| Ga0137397_106162481 | 3300012685 | Vadose Zone Soil | VIGFLFLVAAAVVAVLNLQRVANLGMMWLPPPLLIVGLAFVGLA |
| Ga0137394_106207832 | 3300012922 | Vadose Zone Soil | VIGFLFLVAAAVVAVLNLKRVADLGMMWLSPPLLIVGIAFVTLAARKK* |
| Ga0137359_110770332 | 3300012923 | Vadose Zone Soil | VLGILVLATAAVIAVLNLKRVANLGMLWLNAPLLVIGVALIVLARRRT* |
| Ga0137419_105991932 | 3300012925 | Vadose Zone Soil | VIGFLFLVAAMVIAVLNLKRVANLGMLWLNAPLLVIGVALIVLARRRT* |
| Ga0137407_123197532 | 3300012930 | Vadose Zone Soil | KILSATTLRVIGILFLVSAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK* |
| Ga0137410_100009348 | 3300012944 | Vadose Zone Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLNAPLLVIGILFVALSARRR* |
| Ga0164302_103489362 | 3300012961 | Soil | VILVLVAAAVVAVLNLKRVANLGMMWLSPPLLIVGIALITLAARKK* |
| Ga0120150_10173441 | 3300013294 | Permafrost | FMVAAAVVAVLNLKRVANLGMLWLSPPLLIVGMVFVVLAKRRK* |
| Ga0120111_10005635 | 3300013764 | Permafrost | MVAAAVVAVLNLKRVANLGMLWLSPPLLIVGMVFVVLAKRRK* |
| Ga0182001_100080873 | 3300014488 | Soil | VSPTALRLIGIILLVAAAVLAVLNLKRVANLGTFWLGAPLLILGVAFVTLARRRR* |
| Ga0167633_1016393 | 3300015069 | Glacier Forefield Soil | MIGVLFLVSAAVVAVLNLKRVANLGMMWLSPPLLIVGLAFVAMAARKK* |
| Ga0167623_100003070 | 3300015161 | Glacier Forefield Soil | MSPKTLSLIGILFLVAAAVVAVLNLKRVADLGMLWLSPILLIFGAALLALSRRQGNSSSR |
| Ga0137409_115444641 | 3300015245 | Vadose Zone Soil | LSAKTLRVIGILVLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGVALLALAARKK* |
| Ga0137403_100530871 | 3300015264 | Vadose Zone Soil | LDNYRIMEVENLSATTLRVIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLIVGMAFVVLAARRK* |
| Ga0184605_100064282 | 3300018027 | Groundwater Sediment | VIGFLFLVAAAVVAVLNLKRVANLGMMWLSPPLMIVGLAFVAFAARKK |
| Ga0184638_11342312 | 3300018052 | Groundwater Sediment | LSGKTLRLIGILVLVAGATVAVLNLKRVADLRMIWLPPVLLVIGIGLVVNSRRR |
| Ga0184623_102579152 | 3300018056 | Groundwater Sediment | VIGILVLVAAAVVAVLNLKRVANLGMMWLSPPLLIVGLALVTLAARKK |
| Ga0184615_102287841 | 3300018059 | Groundwater Sediment | LSATTLRVIGILFLVAAAVVAILNLKRVANLGMLWLNAPLLVIGIAFVV |
| Ga0184629_101427041 | 3300018084 | Groundwater Sediment | VIGILFLVAAAVVAVLNLKRVANLGMLWLSPPLLIVGIVFVTLAGRRK |
| Ga0184629_106863681 | 3300018084 | Groundwater Sediment | VIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVALAARKK |
| Ga0190274_133714172 | 3300018476 | Soil | MRAIGIGFLVAAVVIALLNLKRVANLGMLWLNAPLLVIGVALILLARRRR |
| Ga0190273_122687782 | 3300018920 | Soil | GFLFLVTAAIVAVMNLKRVANLGMMWLSPPLMIVGLAFVAFAARKK |
| Ga0137408_13715033 | 3300019789 | Vadose Zone Soil | MEVENLSATTLRVIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLIVGMAFVVLAARRK |
| Ga0193713_10513051 | 3300019882 | Soil | TTLGVIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK |
| Ga0193725_10131092 | 3300019883 | Soil | VIGILFLVAAAVVAVLNLKRVANLGMTWLSPPLLIVGVALFTLAARKK |
| Ga0193710_10321452 | 3300019998 | Soil | SEDKNLSATTLRVIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK |
| Ga0207684_100297503 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGILVLVTAAVVAVLNLKRLANLGMMWLSPPLLIVGVGLVTLAARKK |
| Ga0207686_117759442 | 3300025934 | Miscanthus Rhizosphere | LSATTLRLIGFLFLVAAAIVAIMNLKRVANLGMVWLSPPLMILG |
| Ga0207709_105244951 | 3300025935 | Miscanthus Rhizosphere | VQPGGKNNLSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMMWLSPPLLIVGLALVAIAARRRR |
| Ga0207689_100119162 | 3300025942 | Miscanthus Rhizosphere | VSATTFRVIGILFMAAAAVVGILNLKRVANLGMLGLSAPLLIIGMGFLAASRRRARG |
| Ga0207689_100246113 | 3300025942 | Miscanthus Rhizosphere | MVAAAVVAVLNLKRVANLGMLGLSAPLLIVGMGFLAASRRKAQRPPH |
| Ga0207689_111838572 | 3300025942 | Miscanthus Rhizosphere | LSAQTLRILGILMLVAAAVIAILNLKRVANLGLLWLNAPLLVIGIALIVAARRRA |
| Ga0207651_100593291 | 3300025960 | Switchgrass Rhizosphere | LSPKTLRVLGILLLVAAAIVAVLNLKRVANLGMMWLSPPLLIVGLALVAIAARRRR |
| Ga0207641_100125053 | 3300026088 | Switchgrass Rhizosphere | VSPTTLRIIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLILGLALVAIAARRR |
| Ga0207674_110143382 | 3300026116 | Corn Rhizosphere | LSPKTLRVLGILLLVAAAIVAVLNLKRVANLGMVWLSPPLLIVGLALVAIAARRR |
| Ga0207683_100573431 | 3300026121 | Miscanthus Rhizosphere | TALRLIGILFMVAAAVVAVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRTAKRPPP |
| Ga0207698_112900341 | 3300026142 | Corn Rhizosphere | WAGSNQNGGKTLSAKTLRLLGIVCLIAAAIVAVLNLKRVANLGIFWLSAPLLVIGIALVTASRRRS |
| Ga0207698_118516922 | 3300026142 | Corn Rhizosphere | LSAKTLRVLGILLLVCAAVVAVLNLKRVANLGMMWLSPPLLIIGLALVAIAARRR |
| Ga0209438_10220721 | 3300026285 | Grasslands Soil | MVAAAVVVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRKAQRPPD |
| Ga0209131_100004678 | 3300026320 | Grasslands Soil | LSATALRLIGILFMVAAAVVVLNLKRVANLGMLGLSAPLLIIGMGFLAASRRKAQRPPD |
| Ga0257171_10098125 | 3300026377 | Soil | VIGILFLVAAAVVAVLNLKRVANLGMLWLNAPLLVIGIAFVVLAARRK |
| Ga0257171_10273552 | 3300026377 | Soil | PLPNNGGRNLSATTLRVIGILFLVAAAVVAVLNLKRVANLGMVWLSPPLLIVGMAFVVLARRK |
| Ga0268266_113989672 | 3300028379 | Switchgrass Rhizosphere | LSAKTVRLLGIVCLIAAAIVAVLNLKRVANLGTFWLSAPLLVIGIGLVAASRRKT |
| Ga0307501_100253752 | 3300031152 | Soil | MTRQATHTNYSTEVMNLSSKTLRFLGILLLVAAAVVAVLNLKRVANLGMMWLSPPLLIIGLALVAIAARRR |
| Ga0307405_104041363 | 3300031731 | Rhizosphere | IAAIISAVLNLKRVADLGMTWLTPVLLICGVVLVAAAKRRRA |
| Ga0307468_1000237942 | 3300031740 | Hardwood Forest Soil | LSPTALRVIGILFLVSAAVVAILNLKRVANLGLMWLSPVLLVVGIAFVVNARRRS |
| Ga0307468_1002825272 | 3300031740 | Hardwood Forest Soil | VIGFLFIVAAAVVAILNLKRVANLGMMWLSPPLLIVGIAFVSLALRQKKGT |
| Ga0334918_023299_279_446 | 3300034000 | Hypolithic Biocrust | LSPNILRLIGIIFLLAAAVLAVLNLKRVANLGLPWLSPPLMIIGMAFVIMARRQK |
| Ga0334932_000001_198427_198573 | 3300034174 | Sub-Biocrust Soil | LIGIVLLIAAAVLAVLNLKRVANLGTFWSVPPLLILGIAFVTLARRRR |
| Ga0364931_0159822_537_683 | 3300034176 | Sediment | VIGILVLVTAAVVAVLNLKRVANLGMMWLSPPLLIVGVALVTLAARKK |
| ⦗Top⦘ |