NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080674

Metagenome / Metatranscriptome Family F080674

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080674
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 47 residues
Representative Sequence KQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
Number of Associated Samples 105
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 9.65 %
% of genes near scaffold ends (potentially truncated) 92.17 %
% of genes from short scaffolds (< 2000 bps) 84.35 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (64.348 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(21.739 % of family members)
Environment Ontology (ENVO) Unclassified
(43.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(53.913 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF02620YceD 62.61
PF14622Ribonucleas_3_3 12.17
PF01467CTP_transf_like 7.83
PF06188HrpE 4.35
PF03602Cons_hypoth95 3.48
PF00271Helicase_C 3.48
PF06831H2TH 1.74
PF00430ATP-synt_B 0.87
PF04073tRNA_edit 0.87
PF02463SMC_N 0.87
PF01149Fapy_DNA_glyco 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 62.61
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 3.48
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 3.48
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 3.48
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 3.48
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 3.48
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 2.61
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A64.35 %
All OrganismsrootAll Organisms35.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2149837002|Baltic_Sea__contig36228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6741Open in IMG/M
3300002139|M3t2BS2_1535408Not Available585Open in IMG/M
3300002143|M3t6FKB2_10213064Not Available828Open in IMG/M
3300002402|B570J29627_1006657Not Available934Open in IMG/M
3300003388|JGI25910J50241_10001354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8665Open in IMG/M
3300003393|JGI25909J50240_1023173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1413Open in IMG/M
3300003430|JGI25921J50272_10046294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1004Open in IMG/M
3300005527|Ga0068876_10450141Not Available712Open in IMG/M
3300007171|Ga0102977_1099431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1694Open in IMG/M
3300007177|Ga0102978_1239361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA044-D112024Open in IMG/M
3300007544|Ga0102861_1020446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1642Open in IMG/M
3300007545|Ga0102873_1066588All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300007546|Ga0102874_1234074Not Available558Open in IMG/M
3300007548|Ga0102877_1133773Not Available703Open in IMG/M
3300007549|Ga0102879_1023461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2046Open in IMG/M
3300007593|Ga0102918_1017207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1928Open in IMG/M
3300007620|Ga0102871_1008831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3087Open in IMG/M
3300007622|Ga0102863_1204957Not Available580Open in IMG/M
3300007639|Ga0102865_1084716Not Available946Open in IMG/M
3300007642|Ga0102876_1028204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1597Open in IMG/M
3300007649|Ga0102912_1030038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1588Open in IMG/M
3300007972|Ga0105745_1019988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1668Open in IMG/M
3300007973|Ga0105746_1007814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2994Open in IMG/M
3300008996|Ga0102831_1107680Not Available927Open in IMG/M
3300009049|Ga0102911_1229937Not Available521Open in IMG/M
3300009051|Ga0102864_1070329Not Available951Open in IMG/M
3300009051|Ga0102864_1119596Not Available719Open in IMG/M
3300009079|Ga0102814_10122021Not Available1427Open in IMG/M
3300009080|Ga0102815_10366177Not Available800Open in IMG/M
3300009080|Ga0102815_10860203Not Available518Open in IMG/M
3300009155|Ga0114968_10380825Not Available774Open in IMG/M
3300009155|Ga0114968_10565697Not Available605Open in IMG/M
3300009159|Ga0114978_10471695Not Available741Open in IMG/M
3300009160|Ga0114981_10561170Not Available608Open in IMG/M
3300009180|Ga0114979_10093820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71858Open in IMG/M
3300009233|Ga0103856_10109948Not Available528Open in IMG/M
3300012017|Ga0153801_1065425Not Available639Open in IMG/M
3300012716|Ga0157605_1119760Not Available517Open in IMG/M
3300012725|Ga0157610_1210605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71316Open in IMG/M
3300012731|Ga0157616_1331510Not Available568Open in IMG/M
3300012763|Ga0138289_1143861Not Available528Open in IMG/M
3300013004|Ga0164293_10553200Not Available753Open in IMG/M
(restricted) 3300013137|Ga0172375_10627762Not Available690Open in IMG/M
3300020151|Ga0211736_10247573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71857Open in IMG/M
3300020484|Ga0208049_113714Not Available577Open in IMG/M
3300020489|Ga0207910_105698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71412Open in IMG/M
3300020494|Ga0208326_115973Not Available688Open in IMG/M
3300020496|Ga0208230_1002497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72156Open in IMG/M
3300020513|Ga0208090_1032031Not Available718Open in IMG/M
3300020535|Ga0208228_1000299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-78635Open in IMG/M
3300020542|Ga0208857_1059403Not Available568Open in IMG/M
3300020548|Ga0208856_1019892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7986Open in IMG/M
3300020553|Ga0208855_1007324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-61921Open in IMG/M
3300020559|Ga0208083_1051553Not Available676Open in IMG/M
3300020565|Ga0208718_1025027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1200Open in IMG/M
3300020565|Ga0208718_1037042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7955Open in IMG/M
3300021141|Ga0214163_1014434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72512Open in IMG/M
3300023184|Ga0214919_10172972Not Available1670Open in IMG/M
3300024515|Ga0255183_1070592Not Available725Open in IMG/M
3300024571|Ga0256302_1085377Not Available742Open in IMG/M
3300025091|Ga0209616_1019422Not Available687Open in IMG/M
3300027121|Ga0255074_1023255Not Available782Open in IMG/M
3300027124|Ga0255116_1028179Not Available777Open in IMG/M
3300027154|Ga0255111_1016963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus1597Open in IMG/M
3300027155|Ga0255081_1038235Not Available1034Open in IMG/M
3300027205|Ga0208926_1011609Not Available1314Open in IMG/M
3300027212|Ga0208554_1048571Not Available672Open in IMG/M
3300027221|Ga0208557_1019671Not Available1245Open in IMG/M
3300027222|Ga0208024_1020216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus1348Open in IMG/M
3300027242|Ga0208806_1014772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus1663Open in IMG/M
3300027261|Ga0208933_1079502Not Available528Open in IMG/M
3300027281|Ga0208440_1036452Not Available1118Open in IMG/M
3300027285|Ga0255131_1034614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus932Open in IMG/M
3300027292|Ga0255134_1035275Not Available830Open in IMG/M
3300027292|Ga0255134_1064022Not Available584Open in IMG/M
3300027295|Ga0255126_1027482Not Available1242Open in IMG/M
3300027299|Ga0255124_1085243Not Available528Open in IMG/M
3300027329|Ga0255109_1051865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus902Open in IMG/M
3300027375|Ga0255137_1091336Not Available527Open in IMG/M
3300027396|Ga0255146_1011722Not Available1861Open in IMG/M
3300027489|Ga0255095_1064904Not Available636Open in IMG/M
3300027489|Ga0255095_1090012Not Available515Open in IMG/M
3300027493|Ga0255103_1073272Not Available575Open in IMG/M
3300027494|Ga0255094_1037677Not Available932Open in IMG/M
3300027538|Ga0255085_1034144Not Available1148Open in IMG/M
3300027579|Ga0255068_103391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus2090Open in IMG/M
3300027579|Ga0255068_118046Not Available778Open in IMG/M
3300027597|Ga0255088_1078152Not Available622Open in IMG/M
3300027597|Ga0255088_1107312Not Available508Open in IMG/M
3300027598|Ga0255121_1006155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus3003Open in IMG/M
3300027732|Ga0209442_1241504Not Available649Open in IMG/M
3300027733|Ga0209297_1114542Not Available1143Open in IMG/M
3300027770|Ga0209086_10184594Not Available975Open in IMG/M
3300028108|Ga0256305_1171889Not Available514Open in IMG/M
3300028394|Ga0304730_1176079Not Available833Open in IMG/M
3300031758|Ga0315907_10920666Not Available640Open in IMG/M
3300031784|Ga0315899_10311334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes1554Open in IMG/M
3300031963|Ga0315901_11247283Not Available500Open in IMG/M
3300032050|Ga0315906_10772906Not Available758Open in IMG/M
3300032093|Ga0315902_10410128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans1220Open in IMG/M
3300033816|Ga0334980_0005981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans5435Open in IMG/M
3300033978|Ga0334977_0022292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans3613Open in IMG/M
3300033981|Ga0334982_0377023Not Available649Open in IMG/M
3300033984|Ga0334989_0255685Not Available947Open in IMG/M
3300033992|Ga0334992_0045560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans2525Open in IMG/M
3300033992|Ga0334992_0411610Not Available604Open in IMG/M
3300033994|Ga0334996_0017227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes4713Open in IMG/M
3300034019|Ga0334998_0089624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes2063Open in IMG/M
3300034050|Ga0335023_0041658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes2693Open in IMG/M
3300034050|Ga0335023_0503336Not Available627Open in IMG/M
3300034094|Ga0335014_0333308Not Available676Open in IMG/M
3300034095|Ga0335022_0465723Not Available666Open in IMG/M
3300034167|Ga0335017_0572448Not Available588Open in IMG/M
3300034357|Ga0335064_0625672Not Available673Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater21.74%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine21.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater8.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.74%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine1.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.87%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.87%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2149837002Marine microbial communities from the Baltic SeaEnvironmentalOpen in IMG/M
3300002139M3t2BS2 (117f)EnvironmentalOpen in IMG/M
3300002143M3t6FKB2 (118f)EnvironmentalOpen in IMG/M
3300002402Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020484Freshwater microbial communities from Lake Mendota, WI - 8OCT2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020489Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020494Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020496Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020535Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020542Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020559Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020565Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024515Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8dEnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025091Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027124Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027154Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027155Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027221Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027222Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027242Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027261Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027285Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027292Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027295Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300027299Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027329Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027375Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027489Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027493Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027494Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027579Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027597Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300027598Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034094Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Baltic_Sea_002704002149837002MarineVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
M3t2BS2_153540813300002139MarineVVGIADKLQGVQELSSTCYDESECVLATFFALVLA*
M3t6FKB2_1021306423300002143MarineQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA*
B570J29627_100665723300002402FreshwaterISATSWTSYVLQFIVGIADKLQGVQELSSTCFDESEYVLATFFVLELA*
JGI25910J50241_1000135473300003388Freshwater LakeLDKLXVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
JGI25909J50240_102317333300003393Freshwater LakeAGVQIRPLEPGDGCMFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
JGI25921J50272_1004629413300003430Freshwater LakeEPGDGYMFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA*
Ga0068876_1045014113300005527Freshwater LakeMQHVAILVVGIAGKLQGVQELSSTCFDESEYVLAT
Ga0102977_109943143300007171Freshwater LakeGYKFRRLGKQCVATLVVGIADRLQGVQELSSTCYDESECVLATFFALVLA*
Ga0102978_123936113300007177Freshwater LakeGDGYKFRRLDKLCVATLVVGTVHMLPSEQESFSTCFVVSECVLATFSALVLAWSLLLI*
Ga0102861_102044613300007544EstuarineLEPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
Ga0102873_106658833300007545EstuarineLGKLCVVILVAGIAHMLQGVQELSSTCYDESECVLATFFALVLA*
Ga0102874_123407423300007546EstuarineDKLYVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA*
Ga0102877_113377323300007548EstuarineLVAGIAHMLQGVQELSSTCFGESECVLATFFALVLA*
Ga0102879_102346113300007549EstuarinePLKPVDGYMFRRLGKLCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA*
Ga0102918_101720753300007593EstuarineVVILVADIAHMLQGVQELSSTCFGESECVLATFFALVLA*
Ga0102871_100883163300007620EstuarineDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP*
Ga0102863_120495723300007622EstuarineVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA*
Ga0102865_108471633300007639EstuarineLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
Ga0102876_102820443300007642EstuarineATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP*
Ga0102912_103003813300007649EstuarineQIRPLKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP*
Ga0105745_101998843300007972Estuary WaterPLEPGDGCMFHKLDKLCVVILVVGIAHMLQGVQELSSTCFGESECVLATFFALVLA*
Ga0105746_100781463300007973Estuary WaterRVQIRPLKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA*
Ga0102831_110768033300008996EstuarineVVILVADIAHMLQGVQELSSTCFGESEFVLATIFALVLA*
Ga0102911_122993723300009049EstuarineCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA*
Ga0102864_107032933300009051EstuarineGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP*
Ga0102864_111959613300009051EstuarineKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA*
Ga0102814_1012202113300009079EstuarineIRPLEPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
Ga0102815_1036617713300009080EstuarineLCVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA*
Ga0102815_1086020313300009080EstuarineRPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA*
Ga0114968_1038082513300009155Freshwater LakeLKPGDGYKFRRLGKQCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLP*
Ga0114968_1056569713300009155Freshwater LakeMQCVAILVVDIVHMLQGVLELFSTCCDESECVLATFFALVLAWF
Ga0114978_1047169513300009159Freshwater LakeRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP*
Ga0114981_1056117023300009160Freshwater LakeRRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA*
Ga0114979_1009382013300009180Freshwater LakeVQIRPLKPGDGYKFRRLDRLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0103856_1010994823300009233River WaterMQHVAILVAGIADKLQDWQEWSSTCFYESEYVLATFFAL
Ga0153801_106542523300012017FreshwaterLKPGDGYKFRRLGKQCVATLVVGIVHMLPSGQELSSTYYDESECVLATFFALVLP*
Ga0157605_111976013300012716FreshwaterMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFAL
Ga0157610_121060513300012725FreshwaterRRLGKQCVATLAVGIADKLQGVQELSYTCYDGSECVLATFFALVLA*
Ga0157616_133151013300012731FreshwaterMFHKLGKQCAATLVTDTVHMLLGSLELSSTCFDVSECGLATFFALVLA*
Ga0138289_114386113300012763Freshwater LakeMQCVAILVADIVHMLQGVLELSSTCCDESECVLATFFALVLAWFLLL
Ga0164293_1055320013300013004FreshwaterDGYMFRRLGKQYVATLVVGIADKLQDVQELSSTCFDESEYVLATFFALELA*
(restricted) Ga0172375_1062776213300013137FreshwaterIRPLKPVDGCKCHKLDMRCVATLAVGIAHKLQDLQELFSTCCGESECVLATFFALVLA*
Ga0211736_1024757313300020151FreshwaterPLKPVDGYMFRRLGKQCVATLAVGIADKLQGVQELSSTCYDGSECVLATFFALVLA
Ga0208049_11371423300020484FreshwaterVILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA
Ga0207910_10569813300020489FreshwaterMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALV
Ga0208326_11597323300020494FreshwaterLGKQYVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
Ga0208230_100249713300020496FreshwaterDMQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA
Ga0208090_103203123300020513FreshwaterDDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA
Ga0208228_100029943300020535FreshwaterMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA
Ga0208857_105940313300020542FreshwaterMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECV
Ga0208856_101989213300020548FreshwaterKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
Ga0208855_100732413300020553FreshwaterVVGIADKLQGVQELSSTCFDESEYVLATFFVLELA
Ga0208083_105155313300020559FreshwaterQIKPLEPDDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA
Ga0208718_102502733300020565FreshwaterRRLDKLCVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA
Ga0208718_103704233300020565FreshwaterDKLYVVILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA
Ga0214163_101443413300021141FreshwaterVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA
Ga0214919_1017297233300023184FreshwaterMQCVAILVADIVHMLQGVLELSSTCCDESECVLATFFALVL
Ga0255183_107059213300024515FreshwaterIRPLKPGDGYKFRRLDKLYVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0256302_108537723300024571FreshwaterMQCVAILVADIVHMLQGVPELSSTCCDESECVLATFFAL
Ga0209616_101942213300025091FreshwaterRLGKQYVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
Ga0208009_108339713300027114Deep SubsurfaceRVQIKPLEPDDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALEL
Ga0255074_102325523300027121FreshwaterMFRRSDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA
Ga0255116_102817913300027124FreshwaterKQYVAILVVGTVHKLQGVQELFSTCFDESECVLATFSALGLA
Ga0255111_101696313300027154FreshwaterEQIRPLKPGDGYMFRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA
Ga0255081_103823533300027155FreshwaterEPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208926_101160913300027205EstuarineCVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208554_104857123300027212EstuarineMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALEL
Ga0208557_101967133300027221EstuarineKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208024_102021633300027222EstuarineLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208806_101477213300027242EstuarinePGDGCMFHKLDKLCVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208933_107950213300027261EstuarineVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0208440_103645213300027281EstuarineMFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0255131_103461433300027285FreshwaterGKQYVAILVVGTVHKLQGVQELFSTCFDESECVLATFSALGLA
Ga0255134_103527513300027292FreshwaterKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP
Ga0255134_106402213300027292FreshwaterRRLDMQCVAILVTGIVHMLLSEQELFSTCFGESEYVLATFFALELA
Ga0255126_102748213300027295FreshwaterPLKPVDGYKFRRLGKQCVATLAVGIADKLQGVQELSSTCYDGSECVLATFFALVLA
Ga0255124_108524323300027299FreshwaterDYKFHRLGKLCVVILVADIAHMLQDVQELSSTCFVESEFVLATFFALVLA
Ga0255109_105186533300027329FreshwaterDGYKFRRLGKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP
Ga0255137_109133613300027375FreshwaterYKFHRLDRQCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0255146_101172243300027396FreshwaterDKLYVATLVVGIVHMLPSEQELSSTCFDESECVLATFFALVLA
Ga0255095_106490413300027489FreshwaterSDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA
Ga0255095_109001213300027489FreshwaterRRLDKLCVATLVVGIVHKLPSEQELSSTCYDESECVLATFFALVLA
Ga0255103_107327223300027493FreshwaterVVGIVHKLQGVQELFSTCFDESECVLATFSALGLA
Ga0255094_103767733300027494FreshwaterRRSDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA
Ga0255085_103414413300027538FreshwaterRPLEPGDDYKFHRLGKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA
Ga0255068_10339113300027579FreshwaterYKFRRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP
Ga0255068_11804623300027579FreshwaterFRRSDKLYVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA
Ga0255088_107815223300027597FreshwaterLKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0255088_110731223300027597FreshwaterILVVGIVHMLQGGQELSSTCFGESECVLATFFALVLA
Ga0255121_100615513300027598FreshwaterVRVQIRPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA
Ga0209442_124150413300027732Freshwater LakeLKPGDGYKFHRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP
Ga0209297_111454233300027733Freshwater LakeMQCVAILVADIVHMLQGVLELSSTCCDESECVLATF
Ga0209086_1018459413300027770Freshwater LakeMQCVAILVADIVHMLQGVLELSSTCCDESECVLAT
Ga0256305_117188913300028108FreshwaterMLCVVILVAGIAHMLQGVQELSSTCFDESECVLATFFALVLA
Ga0304730_117607913300028394Freshwater LakeMQCVAILVADIVHMLQGVLELSSTCCDESECVLATFF
Ga0315907_1092066613300031758FreshwaterPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDVSECVLATFFALVLA
Ga0315899_1031133443300031784FreshwaterLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0315901_1124728323300031963FreshwaterVVDIADRLQGVLELFSTCYDGSECVLATFFALVLA
Ga0315906_1077290613300032050FreshwaterRPLEPGDDYKFHRLGKLCVVILVAGIAHMLQGVQELSSTCFVESEFVLATFFALVLA
Ga0315902_1041012813300032093FreshwaterEPGDGYMFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA
Ga0334980_0005981_1819_19473300033816FreshwaterMQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA
Ga0334977_0022292_217_3453300033978FreshwaterMQHVAILAVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA
Ga0334982_0377023_463_6483300033981FreshwaterRVQIRPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVL
Ga0334989_0255685_3_1493300033984FreshwaterKFRRLDKLYVVILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA
Ga0334992_0045560_2343_24893300033992FreshwaterMFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA
Ga0334992_0411610_1_1863300033992FreshwaterRVQIRPLKPGDGYKFRRLDRLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVL
Ga0334996_0017227_1562_17083300033994FreshwaterMFRRLGKQCVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA
Ga0334998_0089624_1951_20613300034019FreshwaterLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA
Ga0335023_0041658_3_1253300034050FreshwaterCVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA
Ga0335023_0503336_1_1263300034050FreshwaterMQHVAILAVGIAGKLQGVQELSSTCFDESEYVLATFFALELA
Ga0335014_0333308_5_1333300034094FreshwaterMQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALELA
Ga0335022_0465723_169_3153300034095FreshwaterMFRRLGKQYVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA
Ga0335017_0572448_450_5873300034167FreshwaterRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP
Ga0335064_0625672_510_6713300034357FreshwaterPGDDYKFHRLGKLCVVILVAGIAHMLQGVQELSSTCFVESEFVLATFFALVLA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.