| Basic Information | |
|---|---|
| Family ID | F080674 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | KQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.65 % |
| % of genes near scaffold ends (potentially truncated) | 92.17 % |
| % of genes from short scaffolds (< 2000 bps) | 84.35 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.348 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (21.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.478 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02620 | YceD | 62.61 |
| PF14622 | Ribonucleas_3_3 | 12.17 |
| PF01467 | CTP_transf_like | 7.83 |
| PF06188 | HrpE | 4.35 |
| PF03602 | Cons_hypoth95 | 3.48 |
| PF00271 | Helicase_C | 3.48 |
| PF06831 | H2TH | 1.74 |
| PF00430 | ATP-synt_B | 0.87 |
| PF04073 | tRNA_edit | 0.87 |
| PF02463 | SMC_N | 0.87 |
| PF01149 | Fapy_DNA_glyco | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 62.61 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 3.48 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 3.48 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 3.48 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 3.48 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 3.48 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 2.61 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.35 % |
| All Organisms | root | All Organisms | 35.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2149837002|Baltic_Sea__contig36228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6741 | Open in IMG/M |
| 3300002139|M3t2BS2_1535408 | Not Available | 585 | Open in IMG/M |
| 3300002143|M3t6FKB2_10213064 | Not Available | 828 | Open in IMG/M |
| 3300002402|B570J29627_1006657 | Not Available | 934 | Open in IMG/M |
| 3300003388|JGI25910J50241_10001354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8665 | Open in IMG/M |
| 3300003393|JGI25909J50240_1023173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1413 | Open in IMG/M |
| 3300003430|JGI25921J50272_10046294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1004 | Open in IMG/M |
| 3300005527|Ga0068876_10450141 | Not Available | 712 | Open in IMG/M |
| 3300007171|Ga0102977_1099431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1694 | Open in IMG/M |
| 3300007177|Ga0102978_1239361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA044-D11 | 2024 | Open in IMG/M |
| 3300007544|Ga0102861_1020446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1642 | Open in IMG/M |
| 3300007545|Ga0102873_1066588 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300007546|Ga0102874_1234074 | Not Available | 558 | Open in IMG/M |
| 3300007548|Ga0102877_1133773 | Not Available | 703 | Open in IMG/M |
| 3300007549|Ga0102879_1023461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2046 | Open in IMG/M |
| 3300007593|Ga0102918_1017207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1928 | Open in IMG/M |
| 3300007620|Ga0102871_1008831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3087 | Open in IMG/M |
| 3300007622|Ga0102863_1204957 | Not Available | 580 | Open in IMG/M |
| 3300007639|Ga0102865_1084716 | Not Available | 946 | Open in IMG/M |
| 3300007642|Ga0102876_1028204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1597 | Open in IMG/M |
| 3300007649|Ga0102912_1030038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1588 | Open in IMG/M |
| 3300007972|Ga0105745_1019988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1668 | Open in IMG/M |
| 3300007973|Ga0105746_1007814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2994 | Open in IMG/M |
| 3300008996|Ga0102831_1107680 | Not Available | 927 | Open in IMG/M |
| 3300009049|Ga0102911_1229937 | Not Available | 521 | Open in IMG/M |
| 3300009051|Ga0102864_1070329 | Not Available | 951 | Open in IMG/M |
| 3300009051|Ga0102864_1119596 | Not Available | 719 | Open in IMG/M |
| 3300009079|Ga0102814_10122021 | Not Available | 1427 | Open in IMG/M |
| 3300009080|Ga0102815_10366177 | Not Available | 800 | Open in IMG/M |
| 3300009080|Ga0102815_10860203 | Not Available | 518 | Open in IMG/M |
| 3300009155|Ga0114968_10380825 | Not Available | 774 | Open in IMG/M |
| 3300009155|Ga0114968_10565697 | Not Available | 605 | Open in IMG/M |
| 3300009159|Ga0114978_10471695 | Not Available | 741 | Open in IMG/M |
| 3300009160|Ga0114981_10561170 | Not Available | 608 | Open in IMG/M |
| 3300009180|Ga0114979_10093820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1858 | Open in IMG/M |
| 3300009233|Ga0103856_10109948 | Not Available | 528 | Open in IMG/M |
| 3300012017|Ga0153801_1065425 | Not Available | 639 | Open in IMG/M |
| 3300012716|Ga0157605_1119760 | Not Available | 517 | Open in IMG/M |
| 3300012725|Ga0157610_1210605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1316 | Open in IMG/M |
| 3300012731|Ga0157616_1331510 | Not Available | 568 | Open in IMG/M |
| 3300012763|Ga0138289_1143861 | Not Available | 528 | Open in IMG/M |
| 3300013004|Ga0164293_10553200 | Not Available | 753 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10627762 | Not Available | 690 | Open in IMG/M |
| 3300020151|Ga0211736_10247573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1857 | Open in IMG/M |
| 3300020484|Ga0208049_113714 | Not Available | 577 | Open in IMG/M |
| 3300020489|Ga0207910_105698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1412 | Open in IMG/M |
| 3300020494|Ga0208326_115973 | Not Available | 688 | Open in IMG/M |
| 3300020496|Ga0208230_1002497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2156 | Open in IMG/M |
| 3300020513|Ga0208090_1032031 | Not Available | 718 | Open in IMG/M |
| 3300020535|Ga0208228_1000299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 8635 | Open in IMG/M |
| 3300020542|Ga0208857_1059403 | Not Available | 568 | Open in IMG/M |
| 3300020548|Ga0208856_1019892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 986 | Open in IMG/M |
| 3300020553|Ga0208855_1007324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-6 | 1921 | Open in IMG/M |
| 3300020559|Ga0208083_1051553 | Not Available | 676 | Open in IMG/M |
| 3300020565|Ga0208718_1025027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
| 3300020565|Ga0208718_1037042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 955 | Open in IMG/M |
| 3300021141|Ga0214163_1014434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2512 | Open in IMG/M |
| 3300023184|Ga0214919_10172972 | Not Available | 1670 | Open in IMG/M |
| 3300024515|Ga0255183_1070592 | Not Available | 725 | Open in IMG/M |
| 3300024571|Ga0256302_1085377 | Not Available | 742 | Open in IMG/M |
| 3300025091|Ga0209616_1019422 | Not Available | 687 | Open in IMG/M |
| 3300027121|Ga0255074_1023255 | Not Available | 782 | Open in IMG/M |
| 3300027124|Ga0255116_1028179 | Not Available | 777 | Open in IMG/M |
| 3300027154|Ga0255111_1016963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1597 | Open in IMG/M |
| 3300027155|Ga0255081_1038235 | Not Available | 1034 | Open in IMG/M |
| 3300027205|Ga0208926_1011609 | Not Available | 1314 | Open in IMG/M |
| 3300027212|Ga0208554_1048571 | Not Available | 672 | Open in IMG/M |
| 3300027221|Ga0208557_1019671 | Not Available | 1245 | Open in IMG/M |
| 3300027222|Ga0208024_1020216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1348 | Open in IMG/M |
| 3300027242|Ga0208806_1014772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1663 | Open in IMG/M |
| 3300027261|Ga0208933_1079502 | Not Available | 528 | Open in IMG/M |
| 3300027281|Ga0208440_1036452 | Not Available | 1118 | Open in IMG/M |
| 3300027285|Ga0255131_1034614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 932 | Open in IMG/M |
| 3300027292|Ga0255134_1035275 | Not Available | 830 | Open in IMG/M |
| 3300027292|Ga0255134_1064022 | Not Available | 584 | Open in IMG/M |
| 3300027295|Ga0255126_1027482 | Not Available | 1242 | Open in IMG/M |
| 3300027299|Ga0255124_1085243 | Not Available | 528 | Open in IMG/M |
| 3300027329|Ga0255109_1051865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 902 | Open in IMG/M |
| 3300027375|Ga0255137_1091336 | Not Available | 527 | Open in IMG/M |
| 3300027396|Ga0255146_1011722 | Not Available | 1861 | Open in IMG/M |
| 3300027489|Ga0255095_1064904 | Not Available | 636 | Open in IMG/M |
| 3300027489|Ga0255095_1090012 | Not Available | 515 | Open in IMG/M |
| 3300027493|Ga0255103_1073272 | Not Available | 575 | Open in IMG/M |
| 3300027494|Ga0255094_1037677 | Not Available | 932 | Open in IMG/M |
| 3300027538|Ga0255085_1034144 | Not Available | 1148 | Open in IMG/M |
| 3300027579|Ga0255068_103391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 2090 | Open in IMG/M |
| 3300027579|Ga0255068_118046 | Not Available | 778 | Open in IMG/M |
| 3300027597|Ga0255088_1078152 | Not Available | 622 | Open in IMG/M |
| 3300027597|Ga0255088_1107312 | Not Available | 508 | Open in IMG/M |
| 3300027598|Ga0255121_1006155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 3003 | Open in IMG/M |
| 3300027732|Ga0209442_1241504 | Not Available | 649 | Open in IMG/M |
| 3300027733|Ga0209297_1114542 | Not Available | 1143 | Open in IMG/M |
| 3300027770|Ga0209086_10184594 | Not Available | 975 | Open in IMG/M |
| 3300028108|Ga0256305_1171889 | Not Available | 514 | Open in IMG/M |
| 3300028394|Ga0304730_1176079 | Not Available | 833 | Open in IMG/M |
| 3300031758|Ga0315907_10920666 | Not Available | 640 | Open in IMG/M |
| 3300031784|Ga0315899_10311334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes | 1554 | Open in IMG/M |
| 3300031963|Ga0315901_11247283 | Not Available | 500 | Open in IMG/M |
| 3300032050|Ga0315906_10772906 | Not Available | 758 | Open in IMG/M |
| 3300032093|Ga0315902_10410128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 1220 | Open in IMG/M |
| 3300033816|Ga0334980_0005981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 5435 | Open in IMG/M |
| 3300033978|Ga0334977_0022292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 3613 | Open in IMG/M |
| 3300033981|Ga0334982_0377023 | Not Available | 649 | Open in IMG/M |
| 3300033984|Ga0334989_0255685 | Not Available | 947 | Open in IMG/M |
| 3300033992|Ga0334992_0045560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 2525 | Open in IMG/M |
| 3300033992|Ga0334992_0411610 | Not Available | 604 | Open in IMG/M |
| 3300033994|Ga0334996_0017227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes | 4713 | Open in IMG/M |
| 3300034019|Ga0334998_0089624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes | 2063 | Open in IMG/M |
| 3300034050|Ga0335023_0041658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus limnes | 2693 | Open in IMG/M |
| 3300034050|Ga0335023_0503336 | Not Available | 627 | Open in IMG/M |
| 3300034094|Ga0335014_0333308 | Not Available | 676 | Open in IMG/M |
| 3300034095|Ga0335022_0465723 | Not Available | 666 | Open in IMG/M |
| 3300034167|Ga0335017_0572448 | Not Available | 588 | Open in IMG/M |
| 3300034357|Ga0335064_0625672 | Not Available | 673 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 21.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 21.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.74% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.87% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.87% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2149837002 | Marine microbial communities from the Baltic Sea | Environmental | Open in IMG/M |
| 3300002139 | M3t2BS2 (117f) | Environmental | Open in IMG/M |
| 3300002143 | M3t6FKB2 (118f) | Environmental | Open in IMG/M |
| 3300002402 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020484 | Freshwater microbial communities from Lake Mendota, WI - 8OCT2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020489 | Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020496 | Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027124 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027299 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027329 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027493 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027579 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Baltic_Sea_00270400 | 2149837002 | Marine | VATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| M3t2BS2_15354081 | 3300002139 | Marine | VVGIADKLQGVQELSSTCYDESECVLATFFALVLA* |
| M3t6FKB2_102130642 | 3300002143 | Marine | QCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA* |
| B570J29627_10066572 | 3300002402 | Freshwater | ISATSWTSYVLQFIVGIADKLQGVQELSSTCFDESEYVLATFFVLELA* |
| JGI25910J50241_100013547 | 3300003388 | Freshwater Lake | LDKLXVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| JGI25909J50240_10231733 | 3300003393 | Freshwater Lake | AGVQIRPLEPGDGCMFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| JGI25921J50272_100462941 | 3300003430 | Freshwater Lake | EPGDGYMFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA* |
| Ga0068876_104501411 | 3300005527 | Freshwater Lake | MQHVAILVVGIAGKLQGVQELSSTCFDESEYVLAT |
| Ga0102977_10994314 | 3300007171 | Freshwater Lake | GYKFRRLGKQCVATLVVGIADRLQGVQELSSTCYDESECVLATFFALVLA* |
| Ga0102978_12393611 | 3300007177 | Freshwater Lake | GDGYKFRRLDKLCVATLVVGTVHMLPSEQESFSTCFVVSECVLATFSALVLAWSLLLI* |
| Ga0102861_10204461 | 3300007544 | Estuarine | LEPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| Ga0102873_10665883 | 3300007545 | Estuarine | LGKLCVVILVAGIAHMLQGVQELSSTCYDESECVLATFFALVLA* |
| Ga0102874_12340742 | 3300007546 | Estuarine | DKLYVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA* |
| Ga0102877_11337732 | 3300007548 | Estuarine | LVAGIAHMLQGVQELSSTCFGESECVLATFFALVLA* |
| Ga0102879_10234611 | 3300007549 | Estuarine | PLKPVDGYMFRRLGKLCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA* |
| Ga0102918_10172075 | 3300007593 | Estuarine | VVILVADIAHMLQGVQELSSTCFGESECVLATFFALVLA* |
| Ga0102871_10088316 | 3300007620 | Estuarine | DKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP* |
| Ga0102863_12049572 | 3300007622 | Estuarine | VDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA* |
| Ga0102865_10847163 | 3300007639 | Estuarine | LVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| Ga0102876_10282044 | 3300007642 | Estuarine | ATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP* |
| Ga0102912_10300381 | 3300007649 | Estuarine | QIRPLKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP* |
| Ga0105745_10199884 | 3300007972 | Estuary Water | PLEPGDGCMFHKLDKLCVVILVVGIAHMLQGVQELSSTCFGESECVLATFFALVLA* |
| Ga0105746_10078146 | 3300007973 | Estuary Water | RVQIRPLKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA* |
| Ga0102831_11076803 | 3300008996 | Estuarine | VVILVADIAHMLQGVQELSSTCFGESEFVLATIFALVLA* |
| Ga0102911_12299372 | 3300009049 | Estuarine | CVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA* |
| Ga0102864_10703293 | 3300009051 | Estuarine | GDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP* |
| Ga0102864_11195961 | 3300009051 | Estuarine | KPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA* |
| Ga0102814_101220211 | 3300009079 | Estuarine | IRPLEPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| Ga0102815_103661771 | 3300009080 | Estuarine | LCVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA* |
| Ga0102815_108602031 | 3300009080 | Estuarine | RPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA* |
| Ga0114968_103808251 | 3300009155 | Freshwater Lake | LKPGDGYKFRRLGKQCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLP* |
| Ga0114968_105656971 | 3300009155 | Freshwater Lake | MQCVAILVVDIVHMLQGVLELFSTCCDESECVLATFFALVLAWF |
| Ga0114978_104716951 | 3300009159 | Freshwater Lake | RLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP* |
| Ga0114981_105611702 | 3300009160 | Freshwater Lake | RRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA* |
| Ga0114979_100938201 | 3300009180 | Freshwater Lake | VQIRPLKPGDGYKFRRLDRLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0103856_101099482 | 3300009233 | River Water | MQHVAILVAGIADKLQDWQEWSSTCFYESEYVLATFFAL |
| Ga0153801_10654252 | 3300012017 | Freshwater | LKPGDGYKFRRLGKQCVATLVVGIVHMLPSGQELSSTYYDESECVLATFFALVLP* |
| Ga0157605_11197601 | 3300012716 | Freshwater | MQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFAL |
| Ga0157610_12106051 | 3300012725 | Freshwater | RRLGKQCVATLAVGIADKLQGVQELSYTCYDGSECVLATFFALVLA* |
| Ga0157616_13315101 | 3300012731 | Freshwater | MFHKLGKQCAATLVTDTVHMLLGSLELSSTCFDVSECGLATFFALVLA* |
| Ga0138289_11438611 | 3300012763 | Freshwater Lake | MQCVAILVADIVHMLQGVLELSSTCCDESECVLATFFALVLAWFLLL |
| Ga0164293_105532001 | 3300013004 | Freshwater | DGYMFRRLGKQYVATLVVGIADKLQDVQELSSTCFDESEYVLATFFALELA* |
| (restricted) Ga0172375_106277621 | 3300013137 | Freshwater | IRPLKPVDGCKCHKLDMRCVATLAVGIAHKLQDLQELFSTCCGESECVLATFFALVLA* |
| Ga0211736_102475731 | 3300020151 | Freshwater | PLKPVDGYMFRRLGKQCVATLAVGIADKLQGVQELSSTCYDGSECVLATFFALVLA |
| Ga0208049_1137142 | 3300020484 | Freshwater | VILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA |
| Ga0207910_1056981 | 3300020489 | Freshwater | MFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALV |
| Ga0208326_1159732 | 3300020494 | Freshwater | LGKQYVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| Ga0208230_10024971 | 3300020496 | Freshwater | DMQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA |
| Ga0208090_10320312 | 3300020513 | Freshwater | DDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA |
| Ga0208228_10002994 | 3300020535 | Freshwater | MQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA |
| Ga0208857_10594031 | 3300020542 | Freshwater | MFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECV |
| Ga0208856_10198921 | 3300020548 | Freshwater | KQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| Ga0208855_10073241 | 3300020553 | Freshwater | VVGIADKLQGVQELSSTCFDESEYVLATFFVLELA |
| Ga0208083_10515531 | 3300020559 | Freshwater | QIKPLEPDDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA |
| Ga0208718_10250273 | 3300020565 | Freshwater | RRLDKLCVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA |
| Ga0208718_10370423 | 3300020565 | Freshwater | DKLYVVILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA |
| Ga0214163_10144341 | 3300021141 | Freshwater | VATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA |
| Ga0214919_101729723 | 3300023184 | Freshwater | MQCVAILVADIVHMLQGVLELSSTCCDESECVLATFFALVL |
| Ga0255183_10705921 | 3300024515 | Freshwater | IRPLKPGDGYKFRRLDKLYVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0256302_10853772 | 3300024571 | Freshwater | MQCVAILVADIVHMLQGVPELSSTCCDESECVLATFFAL |
| Ga0209616_10194221 | 3300025091 | Freshwater | RLGKQYVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| Ga0208009_10833971 | 3300027114 | Deep Subsurface | RVQIKPLEPDDGYKYRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALEL |
| Ga0255074_10232552 | 3300027121 | Freshwater | MFRRSDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA |
| Ga0255116_10281791 | 3300027124 | Freshwater | KQYVAILVVGTVHKLQGVQELFSTCFDESECVLATFSALGLA |
| Ga0255111_10169631 | 3300027154 | Freshwater | EQIRPLKPGDGYMFRRLDMQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALELA |
| Ga0255081_10382353 | 3300027155 | Freshwater | EPGDGYRFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208926_10116091 | 3300027205 | Estuarine | CVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208554_10485712 | 3300027212 | Estuarine | MQCVAILVIGIVHMLLSEQELFSTCFGESEYVLATFFALEL |
| Ga0208557_10196713 | 3300027221 | Estuarine | KLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208024_10202163 | 3300027222 | Estuarine | LYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208806_10147721 | 3300027242 | Estuarine | PGDGCMFHKLDKLCVVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208933_10795021 | 3300027261 | Estuarine | VVILVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0208440_10364521 | 3300027281 | Estuarine | MFRKLDKLYVATLVVGIAHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0255131_10346143 | 3300027285 | Freshwater | GKQYVAILVVGTVHKLQGVQELFSTCFDESECVLATFSALGLA |
| Ga0255134_10352751 | 3300027292 | Freshwater | KQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP |
| Ga0255134_10640221 | 3300027292 | Freshwater | RRLDMQCVAILVTGIVHMLLSEQELFSTCFGESEYVLATFFALELA |
| Ga0255126_10274821 | 3300027295 | Freshwater | PLKPVDGYKFRRLGKQCVATLAVGIADKLQGVQELSSTCYDGSECVLATFFALVLA |
| Ga0255124_10852432 | 3300027299 | Freshwater | DYKFHRLGKLCVVILVADIAHMLQDVQELSSTCFVESEFVLATFFALVLA |
| Ga0255109_10518653 | 3300027329 | Freshwater | DGYKFRRLGKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP |
| Ga0255137_10913361 | 3300027375 | Freshwater | YKFHRLDRQCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0255146_10117224 | 3300027396 | Freshwater | DKLYVATLVVGIVHMLPSEQELSSTCFDESECVLATFFALVLA |
| Ga0255095_10649041 | 3300027489 | Freshwater | SDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA |
| Ga0255095_10900121 | 3300027489 | Freshwater | RRLDKLCVATLVVGIVHKLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0255103_10732722 | 3300027493 | Freshwater | VVGIVHKLQGVQELFSTCFDESECVLATFSALGLA |
| Ga0255094_10376773 | 3300027494 | Freshwater | RRSDKLYVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA |
| Ga0255085_10341441 | 3300027538 | Freshwater | RPLEPGDDYKFHRLGKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA |
| Ga0255068_1033911 | 3300027579 | Freshwater | YKFRRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP |
| Ga0255068_1180462 | 3300027579 | Freshwater | FRRSDKLYVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA |
| Ga0255088_10781522 | 3300027597 | Freshwater | LKPGDGYKFRRLDKLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0255088_11073122 | 3300027597 | Freshwater | ILVVGIVHMLQGGQELSSTCFGESECVLATFFALVLA |
| Ga0255121_10061551 | 3300027598 | Freshwater | VRVQIRPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVLA |
| Ga0209442_12415041 | 3300027732 | Freshwater Lake | LKPGDGYKFHRLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP |
| Ga0209297_11145423 | 3300027733 | Freshwater Lake | MQCVAILVADIVHMLQGVLELSSTCCDESECVLATF |
| Ga0209086_101845941 | 3300027770 | Freshwater Lake | MQCVAILVADIVHMLQGVLELSSTCCDESECVLAT |
| Ga0256305_11718891 | 3300028108 | Freshwater | MLCVVILVAGIAHMLQGVQELSSTCFDESECVLATFFALVLA |
| Ga0304730_11760791 | 3300028394 | Freshwater Lake | MQCVAILVADIVHMLQGVLELSSTCCDESECVLATFF |
| Ga0315907_109206661 | 3300031758 | Freshwater | PVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDVSECVLATFFALVLA |
| Ga0315899_103113344 | 3300031784 | Freshwater | LCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0315901_112472832 | 3300031963 | Freshwater | VVDIADRLQGVLELFSTCYDGSECVLATFFALVLA |
| Ga0315906_107729061 | 3300032050 | Freshwater | RPLEPGDDYKFHRLGKLCVVILVAGIAHMLQGVQELSSTCFVESEFVLATFFALVLA |
| Ga0315902_104101281 | 3300032093 | Freshwater | EPGDGYMFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESECVLATFSALVLA |
| Ga0334980_0005981_1819_1947 | 3300033816 | Freshwater | MQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA |
| Ga0334977_0022292_217_345 | 3300033978 | Freshwater | MQHVAILAVGIAGKLQGVQELSSTCFDESEYVLATFFALGLA |
| Ga0334982_0377023_463_648 | 3300033981 | Freshwater | RVQIRPLKPVDGYMFRRLGKQCVATLVVGIADKLQGVQELSSTCYDESECVLATFFALVL |
| Ga0334989_0255685_3_149 | 3300033984 | Freshwater | KFRRLDKLYVVILVADIAHMLQGVQELSSTCFVESEFVLATFFALVLA |
| Ga0334992_0045560_2343_2489 | 3300033992 | Freshwater | MFRRLDKLCVVILVADIAHMLQGVQELSSTCFGESEFVLATFFALVLA |
| Ga0334992_0411610_1_186 | 3300033992 | Freshwater | RVQIRPLKPGDGYKFRRLDRLCVATLVVGIVHMLPSEQELSSTCYDESECVLATFFALVL |
| Ga0334996_0017227_1562_1708 | 3300033994 | Freshwater | MFRRLGKQCVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA |
| Ga0334998_0089624_1951_2061 | 3300034019 | Freshwater | LVVGIVHMLPSEQELSSTCYDESECVLATFFALVLA |
| Ga0335023_0041658_3_125 | 3300034050 | Freshwater | CVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA |
| Ga0335023_0503336_1_126 | 3300034050 | Freshwater | MQHVAILAVGIAGKLQGVQELSSTCFDESEYVLATFFALELA |
| Ga0335014_0333308_5_133 | 3300034094 | Freshwater | MQHVAILVVGIAGKLQGVQELSSTCFDESEYVLATFFALELA |
| Ga0335022_0465723_169_315 | 3300034095 | Freshwater | MFRRLGKQYVATLVVGIADKLQDVQELSSTCYDESECVLATFFALVLA |
| Ga0335017_0572448_450_587 | 3300034167 | Freshwater | RLDKQCVATLVVGIVHMLPSEQELSSTYYDESECVLATFFALVLP |
| Ga0335064_0625672_510_671 | 3300034357 | Freshwater | PGDDYKFHRLGKLCVVILVAGIAHMLQGVQELSSTCFVESEFVLATFFALVLA |
| ⦗Top⦘ |