| Basic Information | |
|---|---|
| Family ID | F080660 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPEKKRSIEEFEAYLKAMLDQDYPKVKYQSPDAWRLRAFKDKKSR |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.35 % |
| % of genes near scaffold ends (potentially truncated) | 17.39 % |
| % of genes from short scaffolds (< 2000 bps) | 77.39 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.391 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment (16.522 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.261 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.62% β-sheet: 0.00% Coil/Unstructured: 64.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00365 | PFK | 3.48 |
| PF10137 | TIR-like | 2.61 |
| PF14947 | HTH_45 | 1.74 |
| PF01909 | NTP_transf_2 | 1.74 |
| PF02673 | BacA | 1.74 |
| PF03477 | ATP-cone | 1.74 |
| PF02872 | 5_nucleotid_C | 0.87 |
| PF01928 | CYTH | 0.87 |
| PF06271 | RDD | 0.87 |
| PF13416 | SBP_bac_8 | 0.87 |
| PF12675 | DUF3795 | 0.87 |
| PF06745 | ATPase | 0.87 |
| PF08461 | HTH_12 | 0.87 |
| PF05552 | TM_helix | 0.87 |
| PF13404 | HTH_AsnC-type | 0.87 |
| PF00881 | Nitroreductase | 0.87 |
| PF00724 | Oxidored_FMN | 0.87 |
| PF00476 | DNA_pol_A | 0.87 |
| PF01935 | DUF87 | 0.87 |
| PF01906 | YbjQ_1 | 0.87 |
| PF08327 | AHSA1 | 0.87 |
| PF00271 | Helicase_C | 0.87 |
| PF01842 | ACT | 0.87 |
| PF10988 | DUF2807 | 0.87 |
| PF01494 | FAD_binding_3 | 0.87 |
| PF00041 | fn3 | 0.87 |
| PF01402 | RHH_1 | 0.87 |
| PF04055 | Radical_SAM | 0.87 |
| PF00199 | Catalase | 0.87 |
| PF04993 | TfoX_N | 0.87 |
| PF07155 | ECF-ribofla_trS | 0.87 |
| PF02635 | DrsE | 0.87 |
| PF06941 | NT5C | 0.87 |
| PF00072 | Response_reg | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 3.48 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.74 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 1.74 |
| COG4720 | ECF-type riboflavin transporter, membrane (S) component | Coenzyme transport and metabolism [H] | 0.87 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.87 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.87 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.87 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.87 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.87 |
| COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.87 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.87 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.87 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.87 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.39 % |
| All Organisms | root | All Organisms | 42.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001371|BBDRAFT_10344967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1850 | Open in IMG/M |
| 3300001371|BBDRAFT_10400343 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 829 | Open in IMG/M |
| 3300001687|WOR8_10010321 | All Organisms → cellular organisms → Archaea | 9660 | Open in IMG/M |
| 3300001751|JGI2172J19969_10012281 | All Organisms → cellular organisms → Archaea | 3383 | Open in IMG/M |
| 3300001751|JGI2172J19969_10180344 | Not Available | 584 | Open in IMG/M |
| 3300004008|Ga0055446_10069659 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-15 → miscellaneous Crenarchaeota group-15 archaeon DG-45 | 908 | Open in IMG/M |
| 3300004008|Ga0055446_10208466 | Not Available | 583 | Open in IMG/M |
| 3300004023|Ga0055441_10159045 | Not Available | 611 | Open in IMG/M |
| 3300004026|Ga0055443_10219320 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 600 | Open in IMG/M |
| 3300004028|Ga0055447_10098981 | Not Available | 840 | Open in IMG/M |
| 3300004028|Ga0055447_10202931 | Not Available | 639 | Open in IMG/M |
| 3300004028|Ga0055447_10320404 | Not Available | 529 | Open in IMG/M |
| 3300004028|Ga0055447_10353743 | Not Available | 507 | Open in IMG/M |
| 3300005182|Ga0069000_10187988 | Not Available | 554 | Open in IMG/M |
| 3300005214|Ga0069002_10130164 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 655 | Open in IMG/M |
| 3300005782|Ga0079367_1015241 | Not Available | 3675 | Open in IMG/M |
| 3300005832|Ga0074469_10641926 | Not Available | 706 | Open in IMG/M |
| 3300005832|Ga0074469_10868999 | All Organisms → cellular organisms → Bacteria | 8253 | Open in IMG/M |
| 3300005832|Ga0074469_11184033 | All Organisms → cellular organisms → Bacteria | 3130 | Open in IMG/M |
| 3300007896|Ga0111484_1004784 | All Organisms → cellular organisms → Archaea → TACK group | 3160 | Open in IMG/M |
| 3300007896|Ga0111484_1012822 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1831 | Open in IMG/M |
| 3300007896|Ga0111484_1033624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1070 | Open in IMG/M |
| 3300007906|Ga0111482_1009779 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1950 | Open in IMG/M |
| 3300007918|Ga0111545_1060693 | Not Available | 670 | Open in IMG/M |
| 3300008516|Ga0111033_1256135 | All Organisms → cellular organisms → Archaea → TACK group | 1840 | Open in IMG/M |
| 3300009034|Ga0115863_1570266 | All Organisms → cellular organisms → Archaea | 1285 | Open in IMG/M |
| 3300009488|Ga0114925_10190423 | Not Available | 1355 | Open in IMG/M |
| 3300009528|Ga0114920_10271069 | Not Available | 1140 | Open in IMG/M |
| 3300009528|Ga0114920_10988699 | Not Available | 576 | Open in IMG/M |
| 3300010291|Ga0129302_1249607 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 505 | Open in IMG/M |
| 3300010413|Ga0136851_10227502 | Not Available | 1914 | Open in IMG/M |
| 3300010995|Ga0139323_151857 | Not Available | 688 | Open in IMG/M |
| 3300011118|Ga0114922_11372219 | Not Available | 569 | Open in IMG/M |
| 3300011118|Ga0114922_11620188 | Not Available | 520 | Open in IMG/M |
| 3300013089|Ga0163203_1044834 | Not Available | 1289 | Open in IMG/M |
| 3300013089|Ga0163203_1171156 | Not Available | 660 | Open in IMG/M |
| 3300018080|Ga0180433_10944901 | Not Available | 631 | Open in IMG/M |
| 3300022208|Ga0224495_10330079 | Not Available | 609 | Open in IMG/M |
| 3300022553|Ga0212124_10165093 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1213 | Open in IMG/M |
| 3300022553|Ga0212124_10478474 | Not Available | 650 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10010259 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2218 | Open in IMG/M |
| 3300024429|Ga0209991_10043934 | Not Available | 2201 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10601295 | Not Available | 530 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10304779 | Not Available | 641 | Open in IMG/M |
| 3300025539|Ga0210109_1051782 | Not Available | 649 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10511745 | Not Available | 582 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10193898 | Not Available | 979 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10075643 | All Organisms → cellular organisms → Archaea | 1866 | Open in IMG/M |
| 3300027888|Ga0209635_10010902 | All Organisms → cellular organisms → Archaea | 7180 | Open in IMG/M |
| 3300027888|Ga0209635_10271213 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1357 | Open in IMG/M |
| 3300027888|Ga0209635_10405096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 1060 | Open in IMG/M |
| 3300027893|Ga0209636_10095713 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2862 | Open in IMG/M |
| 3300027893|Ga0209636_10177122 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1979 | Open in IMG/M |
| 3300027901|Ga0209427_10161007 | Not Available | 1919 | Open in IMG/M |
| 3300027901|Ga0209427_10163840 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1898 | Open in IMG/M |
| 3300027917|Ga0209536_100011411 | All Organisms → cellular organisms → Archaea | 13016 | Open in IMG/M |
| 3300027917|Ga0209536_100298389 | Not Available | 2016 | Open in IMG/M |
| 3300027917|Ga0209536_100307044 | Not Available | 1985 | Open in IMG/M |
| 3300028167|Ga0268285_1136540 | Not Available | 537 | Open in IMG/M |
| 3300028883|Ga0272443_10004638 | All Organisms → cellular organisms → Archaea | 14783 | Open in IMG/M |
| 3300028883|Ga0272443_10387353 | Not Available | 655 | Open in IMG/M |
| 3300028883|Ga0272443_10441987 | Not Available | 604 | Open in IMG/M |
| 3300028920|Ga0272441_10049404 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4732 | Open in IMG/M |
| 3300028920|Ga0272441_10105205 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2787 | Open in IMG/M |
| 3300028920|Ga0272441_10147285 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2208 | Open in IMG/M |
| 3300028920|Ga0272441_10666139 | Not Available | 821 | Open in IMG/M |
| 3300028920|Ga0272441_10716680 | Not Available | 784 | Open in IMG/M |
| 3300028920|Ga0272441_10744838 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Heimdallarchaeota → Candidatus Heimdallarchaeota archaeon | 765 | Open in IMG/M |
| 3300028920|Ga0272441_10813817 | Not Available | 724 | Open in IMG/M |
| 3300028920|Ga0272441_11206824 | Not Available | 566 | Open in IMG/M |
| 3300028920|Ga0272441_11236024 | Not Available | 558 | Open in IMG/M |
| 3300030616|Ga0272442_10096700 | Not Available | 2633 | Open in IMG/M |
| 3300030616|Ga0272442_10105250 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2475 | Open in IMG/M |
| 3300030616|Ga0272442_10308819 | Not Available | 1119 | Open in IMG/M |
| 3300030616|Ga0272442_10324213 | Not Available | 1080 | Open in IMG/M |
| 3300030616|Ga0272442_10397672 | Not Available | 931 | Open in IMG/M |
| 3300030616|Ga0272442_10441308 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-1 → miscellaneous Crenarchaeota group-1 archaeon SG8-32-1 | 863 | Open in IMG/M |
| 3300030616|Ga0272442_10861834 | Not Available | 541 | Open in IMG/M |
| 3300031257|Ga0315555_1005922 | All Organisms → cellular organisms → Archaea | 8095 | Open in IMG/M |
| 3300031274|Ga0307442_1062350 | Not Available | 1143 | Open in IMG/M |
| 3300031276|Ga0307441_1199323 | Not Available | 573 | Open in IMG/M |
| 3300031277|Ga0307425_1016102 | All Organisms → cellular organisms → Archaea | 3156 | Open in IMG/M |
| 3300031278|Ga0307431_1026474 | Not Available | 1914 | Open in IMG/M |
| 3300031281|Ga0307420_1233019 | Not Available | 565 | Open in IMG/M |
| 3300031358|Ga0307438_1080691 | Not Available | 985 | Open in IMG/M |
| 3300031364|Ga0307445_10302048 | Not Available | 543 | Open in IMG/M |
| 3300031365|Ga0307443_1182684 | Not Available | 518 | Open in IMG/M |
| 3300031371|Ga0307423_1021763 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2412 | Open in IMG/M |
| 3300031537|Ga0307419_10155233 | All Organisms → cellular organisms → Archaea | 865 | Open in IMG/M |
| 3300031539|Ga0307380_10073267 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3635 | Open in IMG/M |
| 3300031539|Ga0307380_10102513 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-1 → miscellaneous Crenarchaeota group-1 archaeon SG8-32-1 | 2946 | Open in IMG/M |
| 3300031539|Ga0307380_10490484 | All Organisms → cellular organisms → Archaea | 1083 | Open in IMG/M |
| 3300031539|Ga0307380_11172356 | Not Available | 598 | Open in IMG/M |
| 3300031552|Ga0315542_1112345 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1025 | Open in IMG/M |
| 3300031552|Ga0315542_1157502 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 823 | Open in IMG/M |
| 3300031554|Ga0315544_1070255 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1212 | Open in IMG/M |
| 3300031565|Ga0307379_10516395 | Not Available | 1114 | Open in IMG/M |
| 3300031565|Ga0307379_10529287 | Not Available | 1096 | Open in IMG/M |
| 3300031565|Ga0307379_10849098 | Not Available | 798 | Open in IMG/M |
| 3300031565|Ga0307379_11115123 | All Organisms → cellular organisms → Archaea → TACK group | 662 | Open in IMG/M |
| 3300031566|Ga0307378_11016542 | Not Available | 674 | Open in IMG/M |
| 3300031578|Ga0307376_10443380 | All Organisms → cellular organisms → Archaea | 848 | Open in IMG/M |
| 3300031578|Ga0307376_10924712 | Not Available | 530 | Open in IMG/M |
| 3300031650|Ga0315539_1199911 | Not Available | 584 | Open in IMG/M |
| 3300031651|Ga0315543_1022237 | All Organisms → cellular organisms → Archaea | 3214 | Open in IMG/M |
| 3300031665|Ga0316575_10305020 | Not Available | 674 | Open in IMG/M |
| 3300031699|Ga0315535_1317090 | Not Available | 528 | Open in IMG/M |
| 3300031727|Ga0316576_10691408 | Not Available | 740 | Open in IMG/M |
| 3300031728|Ga0316578_10011243 | All Organisms → cellular organisms → Archaea | 4673 | Open in IMG/M |
| 3300031728|Ga0316578_10202209 | Not Available | 1196 | Open in IMG/M |
| 3300032137|Ga0316585_10222474 | Not Available | 625 | Open in IMG/M |
| 3300032259|Ga0316190_10044193 | All Organisms → cellular organisms → Archaea | 3181 | Open in IMG/M |
| 3300032262|Ga0316194_10846633 | Not Available | 576 | Open in IMG/M |
| 3300032263|Ga0316195_10239857 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 953 | Open in IMG/M |
| 3300033291|Ga0307417_10247117 | Not Available | 684 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 16.52% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 11.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 9.57% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 9.57% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 6.09% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 5.22% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 4.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.48% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.48% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.61% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.74% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.74% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.74% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.87% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.87% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.87% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.87% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment | 0.87% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.87% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.87% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
| 3300005214 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 | Environmental | Open in IMG/M |
| 3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300007906 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_1 | Environmental | Open in IMG/M |
| 3300007918 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 | Environmental | Open in IMG/M |
| 3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300010291 | Hot spring sediment bacterial and archeal communities from California, USA to study Microbial Dark Matter (Phase II) - Blank Spring sediment metaG | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010995 | ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025539 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028167 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_120m | Environmental | Open in IMG/M |
| 3300028883 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300030616 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-2O | Environmental | Open in IMG/M |
| 3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031276 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20 | Environmental | Open in IMG/M |
| 3300031277 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30 | Environmental | Open in IMG/M |
| 3300031278 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170 | Environmental | Open in IMG/M |
| 3300031281 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-40 | Environmental | Open in IMG/M |
| 3300031358 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-110 | Environmental | Open in IMG/M |
| 3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
| 3300031365 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220 | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031537 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-30 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031650 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150 | Environmental | Open in IMG/M |
| 3300031651 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-210 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBDRAFT_103449673 | 3300001371 | Marine Estuarine | LTYELFSVDMPEKKRSREEFEAYLKAMLDQDYPKVKYQSPDAWHQRVFRKNKTD* |
| BBDRAFT_104003431 | 3300001371 | Marine Estuarine | MPYKKRSREEFEAYLKVMLDQDYPKVKYQSPDAWRLRAFKNNKGR* |
| WOR8_100103214 | 3300001687 | Marine Sediment | MHNVTWVTMPEKRRTREEFEAYLKAMLDQDYPKVKYQSPDAWQARANKKSGTS* |
| JGI2172J19969_100122813 | 3300001751 | Marine Sediment | MPKKKRSREEFEAYLKAMLDQEYPKVKYQSPDAWRLRAFKESKAP* |
| JGI2172J19969_101803442 | 3300001751 | Marine Sediment | MPEKKRSSKEFEAYLKAMLKQDYPKVKYQSPDAWRLRVSKEKSNR* |
| Ga0055446_100696592 | 3300004008 | Natural And Restored Wetlands | MPEKRRTREEFEAYLKAMLNQDYPTIKYQSPDAWQARANKKSRTS* |
| Ga0055446_102084661 | 3300004008 | Natural And Restored Wetlands | MPKKKRSNEEFLTYLRAMLDQDYPKIKYNSPDAWRQRVTKNSQK* |
| Ga0055441_101590452 | 3300004023 | Natural And Restored Wetlands | MPDKKRSREEFEAYLKPMSNQDYPKVNYSNPDAWRIRASKEKQT |
| Ga0055443_102193202 | 3300004026 | Natural And Restored Wetlands | RTREEFEAYLKAMLNQDYPKVKYQSPDAWQARANKKSRTS* |
| Ga0055447_100989813 | 3300004028 | Natural And Restored Wetlands | MREKRRSKEEFEAYLKAMLNQDYPKVKYSNPDAWRQRIIRKNRSS* |
| Ga0055447_102029311 | 3300004028 | Natural And Restored Wetlands | MTMPEKRRTREEFEAYLKAMLNQDYPKIKYQSPDAWQARANKKSRTS |
| Ga0055447_103204041 | 3300004028 | Natural And Restored Wetlands | MPEKKRSREEFEAYLKAMLEQDYPKVKYSNPDAWRLRASKEKQAH* |
| Ga0055447_103537431 | 3300004028 | Natural And Restored Wetlands | MPEKRLSNKEFEAYLKAMLNQDYPKTKYQSPDAWRTRASKNSNSS* |
| Ga0069000_101879881 | 3300005182 | Natural And Restored Wetlands | MPKNKLSREDFEAYLKALLDQDYPKVKYQGPDSWRLRASKESRAT* |
| Ga0069002_101301641 | 3300005214 | Natural And Restored Wetlands | MPKKKLSREDFEAYLKALLDQDYPKVKYQCPDSWRLRASKESRAT* |
| Ga0079367_10152411 | 3300005782 | Marine Sediment | MPEKKRSREKFEAYLKAMLDQDYPKVKYQSPDAWRLRATKRKARKIDFNNKPC* |
| Ga0074469_106419261 | 3300005832 | Sediment (Intertidal) | KEFEAYLKAVLDQDYPKVKYQSPDSWRLRASKESRAT* |
| Ga0074469_108689998 | 3300005832 | Sediment (Intertidal) | LTYELFSVDMPEKKRSREEFEAYLKAMLDQDYPKVKYQSPDAWHQRVFRKNKTH* |
| Ga0074469_111840331 | 3300005832 | Sediment (Intertidal) | MSEKKRSREEFEAYLKVMLDQDYPKVKYQSPDAWRLRAFKNNKGR* |
| Ga0111484_10047844 | 3300007896 | Sediment | MTKKKLSREDFEAYLKAMLDQDYPKVKYQSPDSWRLRASKERMAT* |
| Ga0111484_10128223 | 3300007896 | Sediment | MPEKKRSREDFEAYLKAMLDQDYPKVKYQSPDAWHQRAFRKNKTQ* |
| Ga0111484_10336242 | 3300007896 | Sediment | MPDKKRSREEFEAYLKPMLNQDYPKVKYSNPDAWRIRASKEKQTH* |
| Ga0111482_10097793 | 3300007906 | Sediment | MPKKKLSREDFEAYLKAVLDQDYPKVKYQSPDSWRLRASKESGAT* |
| Ga0111545_10606931 | 3300007918 | Sediment | MPEKKRSREEFEAYLKAMLDQDYPKVKYQSPDAWH |
| Ga0111033_12561353 | 3300008516 | Marine Sediment | VPEKKRSSKEFEAYLKAMLNQEYPKVKYQSPDAWRLRAFKKSKSR* |
| Ga0115863_15702662 | 3300009034 | Sediment, Intertidal | MPKKKRSGKEFEAFLKAQLEQDYPKVKYQSPDAWRLRAVRKSKTH* |
| Ga0114925_101904233 | 3300009488 | Deep Subsurface | MPEKKRSSKEFEEFLKAQLEQDYPKVKYQSPDAWRIRALKGSKKR* |
| Ga0114920_102710691 | 3300009528 | Deep Subsurface | MPEKKRSSKEFEEFLKAQLEQDYPKVKYHSPDAWRIRALKGSKKR* |
| Ga0114920_109886992 | 3300009528 | Deep Subsurface | MPEKKRSREEFEAFLKVMLEQKYPKVKYQNPDAWRIRALKGTKKR* |
| Ga0129302_12496071 | 3300010291 | Hot Spring Sediment | CFIIDSVEMPEKKRSREEFEAYLKAMLDQDYPEVKYSNPDAWRLRVSREK* |
| Ga0136851_102275022 | 3300010413 | Mangrove Sediment | MPDKKRSNKEFEAYLKAMLNQNYPKTKYQSPDAWRARAPNSSNSS* |
| Ga0139323_1518571 | 3300010995 | Sediment | MPEKKRSSKEFEAYLKAMLKQDYPKVKYSNPDAWRLRASKEKQAH* |
| Ga0114922_113722191 | 3300011118 | Deep Subsurface | MPEKKRSKEEFEAYLNAMLDQEYPKVKYQSPDAWRRRAFKKSVTR* |
| Ga0114922_116201882 | 3300011118 | Deep Subsurface | MPEKKRSIEEFEAYLKAMLDQDYPKVKYQSPDAWRLRAFKDKKSR* |
| Ga0163203_10448343 | 3300013089 | Freshwater | MPDSIGYSIVMPEKKRSREEFEAYLNAMLDQDYPKVKYQSPDAWRRRAFKKSVTR* |
| Ga0163203_11711563 | 3300013089 | Freshwater | VPEKKRSSKEFEAYLKAMLNQEYPKVKYQSPDAWRLRAFKKRLAK* |
| Ga0180433_109449011 | 3300018080 | Hypersaline Lake Sediment | MPDFTVYSIVMSEKKRSREDFEAYLKAVLDQDYPKVKYQSPDAWRLRVSREK |
| Ga0224495_103300791 | 3300022208 | Sediment | RVTMPKKKLSREEFDAYLKALLEQDYPKVKYQTPDCWRLRAYKKSNSQ |
| Ga0212124_101650932 | 3300022553 | Freshwater | VPEKKRSSKEFEAYLKAMLNHEYPKVKYQSPDAWRLRAFKKSKSR |
| Ga0212124_104784741 | 3300022553 | Freshwater | MPDSIGYSIVMPEKKRSREEFEAYLNAMLDQDYPKVKYQSPDAWRRRAFKKSVTR |
| (restricted) Ga0233409_100102591 | 3300022938 | Seawater | MADKKRSREEFEAYLKAMLDQDYPKVKYHSPDAWYKRALKGKSIR |
| Ga0209991_100439341 | 3300024429 | Deep Subsurface | MPEKKRSSKEFEEFLKAQLEQDYPKVKYHSPDAWRIRALKGSKKR |
| (restricted) Ga0255046_106012951 | 3300024519 | Seawater | SNVNRVTMPEKKRSREEFEAYLKAMLEQDYPKVKYQSPDAWRLRAFKKK |
| (restricted) Ga0255045_103047791 | 3300024528 | Seawater | ILLYSNVNRVTMPEKKRSREEFEAYLKAMLEQDYPKVKYQSPDAWRLRAFNKK |
| Ga0210109_10517821 | 3300025539 | Natural And Restored Wetlands | MPDKKRSREEFEAYLKPMSNQDYPKVNYSNPDAWRIRASKEKQTH |
| (restricted) Ga0255054_105117451 | 3300027856 | Seawater | MVLQCQKKRSREEFEAYIKAMLEQEYPKVKYQNPEAWRQRAFKKSKVR |
| (restricted) Ga0255053_101938981 | 3300027868 | Seawater | MPEKKRSKKEFEAFLKVMLEQKYPKVKYQSPDAWRIRAHKNHNKR |
| (restricted) Ga0255055_100756431 | 3300027881 | Seawater | MPEKKRSREEFEAYLKAMLEQDFPKVKYQSPDAWRLRAFKKK |
| Ga0209635_100109022 | 3300027888 | Marine Sediment | MPKKKRSREEFEAYLKAMLDQEYPKVKYQSPDAWRLRAFKESKAP |
| Ga0209635_102712132 | 3300027888 | Marine Sediment | MPEKKRSGKEFKAFLKAQLEQDYPKVKYQSPDAWRLRAIKKSKTH |
| Ga0209635_104050962 | 3300027888 | Marine Sediment | MPEKKRSSKEFEAYLKAMLKQDYPKVKYQSPDAWRLRVSKEKSNR |
| Ga0209636_100957132 | 3300027893 | Marine Sediment | MPEKKRSSKEFEAYLKAMLKQDYPKVKYQRPDAWRLRVSKEKSNR |
| Ga0209636_101771222 | 3300027893 | Marine Sediment | MPEKKRSGKEFEAFLKAQLEQDYPKVKYQSPDAWRLRAIKKSKTH |
| Ga0209427_101610072 | 3300027901 | Marine Sediment | MPEKKRSREEFEAYLKTMLDQDYPKVKYQSPDAWRLRAFKK |
| Ga0209427_101638402 | 3300027901 | Marine Sediment | MSEKKRSNKEFEAYLKAMLNQDYPKVKYQRPDAWRRRASKEELDH |
| Ga0209536_1000114117 | 3300027917 | Marine Sediment | MHNVTWVTMPEKRRTREEFEAYLKAMLDQDYPKVKYQSPDAWQARANKKSGTS |
| Ga0209536_1002983892 | 3300027917 | Marine Sediment | MPKKKLSREEFDAYLKALLDQDYPKVKYQTPDCWRLRAYKKSNSQ |
| Ga0209536_1003070444 | 3300027917 | Marine Sediment | MPEKKRSREEFEAYLKAMLDQDYPKVKYQSPDAWRQRASKSNIR |
| Ga0268285_11365402 | 3300028167 | Saline Water | VPEKKRSSKEFEAYLKAMLNQEYPKVKYQSPDAWRLRAFKKRLAK |
| Ga0272443_100046382 | 3300028883 | Marine Sediment | LSKALFVMPEKKRSRKDFELYLKAMLDQDYPKVKYSSPDAWRRRITKNNQRQ |
| Ga0272443_103873532 | 3300028883 | Marine Sediment | SIFMPKKKRSREEFEAYLRAMLNQDYPKVKYNSPDAWRKRVANNRS |
| Ga0272443_104419871 | 3300028883 | Marine Sediment | MPEKKRSREEFDAYLRAMLNQDYPEVKYRRPDAWRMRALKKTVRTSDG |
| Ga0272441_100494042 | 3300028920 | Marine Sediment | MPEKKRSRKDFELYLKAMLDQDYPKVKYSSPDAWRRRITKNNQRQ |
| Ga0272441_101052054 | 3300028920 | Marine Sediment | MQEKKRSREEFEAYLRAMLNQDYPEVKYRRPDAWRMRALKNTVRKTDG |
| Ga0272441_101472852 | 3300028920 | Marine Sediment | MPEKKRSREDFEAYLRAMLNQDYPRVKYRRPDAWRMRALKNTMRKTDG |
| Ga0272441_106661392 | 3300028920 | Marine Sediment | MPKKKRSNEEFLTYLRAMLDQDYPKTKYNSPDAWRRRVTKDSQK |
| Ga0272441_107166802 | 3300028920 | Marine Sediment | MPEKKRSREEFEAYLKAMLEQDYPKVKYRNPDAWRLRASKEKQTP |
| Ga0272441_107448382 | 3300028920 | Marine Sediment | MPEKKRSREEFEAYLKAMLNQDYPKVKYRSPDAWRLRASKETPDH |
| Ga0272441_108138172 | 3300028920 | Marine Sediment | MPEKKRSRVEFEAYLKAMLEQNYPKVKYSNPDAWRLRATKNKQAH |
| Ga0272441_112068241 | 3300028920 | Marine Sediment | MKEKKRSREEFEAYLKVMLEQDYPKIKYQSPDAWRRRASNTSNTH |
| Ga0272441_112360241 | 3300028920 | Marine Sediment | MPEKKRSREEFEAYLRAMLKQNYPKVKFNSPDAWRRRISKYTQKK |
| Ga0272442_100967004 | 3300030616 | Marine Sediment | MPEKKRSREEFEAYLKALLEQDYPKVKYRNPDAWRLRASKEKQTP |
| Ga0272442_101052503 | 3300030616 | Marine Sediment | MPKKKRSREEFEAYLRAMLNQDYPKVKYNSPDAWRKRVENNRS |
| Ga0272442_103088191 | 3300030616 | Marine Sediment | MPQKKRSREEFEAYLKAVLDQDYPKVKYQSPDAWRLRASKGSRAT |
| Ga0272442_103242133 | 3300030616 | Marine Sediment | KEFEAYLKAMLNQDYPRVKYQSPDSWRRRASKEKLGH |
| Ga0272442_103976721 | 3300030616 | Marine Sediment | MPEKKRSRVEFEAYLKAVLEQNYPKVKYSNPDAWRLRATKNKQAH |
| Ga0272442_104413081 | 3300030616 | Marine Sediment | MPEKKRSREEFEAYLRAMLNQDYPEVKYQSPDAWRMRAFKKTVRTTDG |
| Ga0272442_108618341 | 3300030616 | Marine Sediment | MPKKKRSNEEFLTYLRAMLDQDYPKTKYNSPDAWRGRVAKNSQK |
| Ga0315555_10059224 | 3300031257 | Salt Marsh Sediment | VPEKKRSSKEFEAYLKAMLNQEYPKVKYQSPDAWRLRAFKKSKSR |
| Ga0307442_10623501 | 3300031274 | Salt Marsh | MPDKKRSREEFEAFLKAMLDQDYPKVKYSNPDAWRLRTSKEKHAH |
| Ga0307441_11993231 | 3300031276 | Salt Marsh | MPDKKRSREEFEAFLKAMLEQDYPKVKYSNPDAWRLRT |
| Ga0307425_10161022 | 3300031277 | Salt Marsh | MPEKKRSREEFETYLKALLDQDYPKAKYQSPDSWRLQASKESRAT |
| Ga0307431_10264744 | 3300031278 | Salt Marsh | MPEKKRSRKEFETFLKAQLEQDYPKVKYQSPDAWRLRAIKKSKTR |
| Ga0307420_12330191 | 3300031281 | Salt Marsh | VMLEKKRSNKEFEAYLKATLDQDYPKVKYQSPDAWRIRASKKKRV |
| Ga0307438_10806911 | 3300031358 | Salt Marsh | MPEKKRSIEEFEAYLKAMLDQDYPKVKYQSPDAWRLRATKRKAR |
| Ga0307445_103020481 | 3300031364 | Salt Marsh | VYVQLIENFMKEKKRSREEFEAYLKAMLEQDYPKVKYQSPDAWRLRAFRKTKTH |
| Ga0307443_11826842 | 3300031365 | Salt Marsh | VPEKKRSKEEFEAYLKAMLNQEYPKVKYHSPDAWRLRAFKKSKSR |
| Ga0307423_10217632 | 3300031371 | Salt Marsh | MPDKKRSREEFEAYLKAMLEQDYPKVKYSNPDVWRLRASNDKQAHYFLN |
| Ga0307419_101552331 | 3300031537 | Salt Marsh | MPEKKRSREEFETYLKALLDQDYPKVKYQSPDSWR |
| Ga0307380_100732675 | 3300031539 | Soil | VGMPEKKRSREDFEAYLKAMLDQDYPKVKYQSPDAWRLRAFKNNKGH |
| Ga0307380_101025133 | 3300031539 | Soil | MPEKKRLREEFEAYLKAVLDQDFPKVKYQSPDAWRLRASKESRAT |
| Ga0307380_104904841 | 3300031539 | Soil | PEKKRSREEFEVYLKAMLEQDYPKVKYQSPDAWRFRAIKKSEGR |
| Ga0307380_111723562 | 3300031539 | Soil | MPEKKRSREEFEAYLKAMLEQDYPKVKYRNPDAWRLRASKEKQAH |
| Ga0315542_11123452 | 3300031552 | Salt Marsh Sediment | MPDKKRSREEFEAYLKAMLEQDYPKVKYSNPDAWRLRALRKNEER |
| Ga0315542_11575022 | 3300031552 | Salt Marsh Sediment | MPKEKRSREEFEAYLRAMLNQDYPKVKYQSPDAWRRRALRKNTRTTNG |
| Ga0315544_10702552 | 3300031554 | Salt Marsh Sediment | VPEKKRSKEEFEAYLKAMLNQEYPKVKYQSPDAWRLRAFKKSKSR |
| Ga0307379_105163952 | 3300031565 | Soil | MPEKKRSREEFEAYLKAMLEQDYPKVKYSNPDAWRLRASKEKQAH |
| Ga0307379_105292871 | 3300031565 | Soil | MPDKKRSREEFEAYLEAMLNQDYPKVKYSNPDAWRIRASKEKQTH |
| Ga0307379_108490982 | 3300031565 | Soil | EVYRVDMPEKKRLREEFEAYLKAVLDQDYPKVKYQSPDAWRLRASKESRAT |
| Ga0307379_111151231 | 3300031565 | Soil | MPEKKRSREEFEAYLKAMLDQDYPKVKYQSPDAWHGRVFKKSEIR |
| Ga0307378_110165421 | 3300031566 | Soil | VYRVDMPEKKRSREEFEAYLKAVLDQDFPKVKYQSPDAWRLRASKESRAT |
| Ga0307376_104433802 | 3300031578 | Soil | EFEVYLKAMLEQDYPKVKYQSPDAWRFRAIKKSEGR |
| Ga0307376_109247121 | 3300031578 | Soil | MPDKKRSREEFEAYLKAMLKQDYPKVKYCNPDAWRLRASKEKQTH |
| Ga0315539_11999111 | 3300031650 | Salt Marsh Sediment | MPEKKRSREEFEAYLKAMLDQDYPKIKYQSPDAWRLRATKRKAR |
| Ga0315543_10222373 | 3300031651 | Salt Marsh Sediment | MPEKKRSREKFEAYLKAMLDQDYPKVKYQSPDAWRLRATKRKAR |
| Ga0316575_103050201 | 3300031665 | Rhizosphere | MPQKRRSQEEFEAYLKALLNQDYPKIKYQTPDAWQVKVKKSRSD |
| Ga0315535_13170901 | 3300031699 | Salt Marsh Sediment | MPEKKRSRGEFEAYLKAILDQDYPKVKYQSPDAWRLRASKESRAP |
| Ga0316576_106914081 | 3300031727 | Rhizosphere | MSEKKRSREEFEAYLRAVLNQDYPKVKYSNPDSWRQRASKKQ |
| Ga0316578_100112438 | 3300031728 | Rhizosphere | MPEKKRSRAEFEEYLKEILNQNYPKVKYSNPDAWRQRALRKN |
| Ga0316578_102022093 | 3300031728 | Rhizosphere | MSEKKRSREEFEAYLRAVLNQDYPKVKYSNPDSWRQRASKEK |
| Ga0316585_102224742 | 3300032137 | Rhizosphere | IYHRFVMPEKKRSRAEFEEYLKEILNQNYPKVKYSNPDAWRQRALRKN |
| Ga0316190_100441932 | 3300032259 | Worm Burrow | MYIVTWVTMPEKRRTSEEFEAYLKAMLDQDYPKVKYQSPDAWQARAYKKSRIS |
| Ga0316194_108466332 | 3300032262 | Sediment | LQYSNVTRVTMPEKKRSREEFEAYLKAMLEQDFPKVKYQTPDAWRLRAFKKK |
| Ga0316195_102398572 | 3300032263 | Sediment | MPKKKLSREDFEAYLKAMLDQDYPKVKYQSPDSWRLRASKESMAT |
| Ga0307417_102471172 | 3300033291 | Salt Marsh | MPEKKRSREEFETYLKALLDQGYPKAKYQSPDSWRLQASKESRAT |
| ⦗Top⦘ |