NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080377

Metagenome Family F080377

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080377
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 38 residues
Representative Sequence MRTKQSILGLVYTGGEVRRPPLVGMQFLHEGAVRPADV
Number of Associated Samples 104
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.10 %
% of genes near scaffold ends (potentially truncated) 96.52 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.522 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.783 % of family members)
Environment Ontology (ENVO) Unclassified
(27.826 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.06%    β-sheet: 0.00%    Coil/Unstructured: 93.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF05036SPOR 79.13
PF06035Peptidase_C93 0.87
PF13701DDE_Tnp_1_4 0.87
PF09424YqeY 0.87
PF09361Phasin_2 0.87
PF01230HIT 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.52 %
UnclassifiedrootN/A3.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101339604All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300000931|JGI12531J12852_10108233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales546Open in IMG/M
3300001664|P5cmW16_1025890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1101Open in IMG/M
3300005289|Ga0065704_10048623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales738Open in IMG/M
3300005513|Ga0077120_1259944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales514Open in IMG/M
3300005543|Ga0070672_101208764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales673Open in IMG/M
3300005602|Ga0070762_10693802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense683Open in IMG/M
3300005614|Ga0068856_100121329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2615Open in IMG/M
3300005616|Ga0068852_100138578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2249Open in IMG/M
3300005718|Ga0068866_11299105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales529Open in IMG/M
3300005842|Ga0068858_101336633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales705Open in IMG/M
3300005983|Ga0081540_1001846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium17751Open in IMG/M
3300005983|Ga0081540_1011887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii5779Open in IMG/M
3300005983|Ga0081540_1050970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2051Open in IMG/M
3300006048|Ga0075363_100488941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae730Open in IMG/M
3300006162|Ga0075030_100330786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1216Open in IMG/M
3300006173|Ga0070716_101243165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales600Open in IMG/M
3300006796|Ga0066665_11643468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales507Open in IMG/M
3300006893|Ga0073928_10143777All Organisms → cellular organisms → Bacteria → Proteobacteria1932Open in IMG/M
3300009098|Ga0105245_12615706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales558Open in IMG/M
3300009137|Ga0066709_102940028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales627Open in IMG/M
3300012202|Ga0137363_11557377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales553Open in IMG/M
3300012202|Ga0137363_11601394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales543Open in IMG/M
3300012212|Ga0150985_103367149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales549Open in IMG/M
3300013297|Ga0157378_12773773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales542Open in IMG/M
3300016357|Ga0182032_10343519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1192Open in IMG/M
3300017553|Ga0182744_1154481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium889Open in IMG/M
3300018071|Ga0184618_10386625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales594Open in IMG/M
3300018072|Ga0184635_10336496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae583Open in IMG/M
3300020144|Ga0206106_117092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae553Open in IMG/M
3300021168|Ga0210406_10470123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense998Open in IMG/M
3300021178|Ga0210408_10446571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1029Open in IMG/M
3300021178|Ga0210408_10479008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense990Open in IMG/M
3300021180|Ga0210396_10260229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1541Open in IMG/M
3300021374|Ga0213881_10402746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium616Open in IMG/M
3300021384|Ga0213876_10301883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales851Open in IMG/M
3300021401|Ga0210393_10712121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales818Open in IMG/M
3300021403|Ga0210397_10293123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1193Open in IMG/M
3300021403|Ga0210397_10349535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1096Open in IMG/M
3300021404|Ga0210389_10098830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2246Open in IMG/M
3300021404|Ga0210389_10592262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae871Open in IMG/M
3300021420|Ga0210394_11135521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense673Open in IMG/M
3300021474|Ga0210390_10250851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1499Open in IMG/M
3300021475|Ga0210392_11058325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales608Open in IMG/M
3300021560|Ga0126371_13945090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales500Open in IMG/M
3300022557|Ga0212123_10537392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales751Open in IMG/M
3300023083|Ga0247734_1158300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae599Open in IMG/M
3300024055|Ga0247794_10311397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales532Open in IMG/M
3300025006|Ga0209935_1076815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae959Open in IMG/M
3300025320|Ga0209171_10369093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales744Open in IMG/M
3300025900|Ga0207710_10323799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales782Open in IMG/M
3300025903|Ga0207680_10358842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1025Open in IMG/M
3300025905|Ga0207685_10493742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales643Open in IMG/M
3300025906|Ga0207699_10171582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1451Open in IMG/M
3300025909|Ga0207705_10888166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae691Open in IMG/M
3300025915|Ga0207693_10238034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1429Open in IMG/M
3300025917|Ga0207660_10147139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1806Open in IMG/M
3300025920|Ga0207649_10793225All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300025924|Ga0207694_10502337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1015Open in IMG/M
3300025928|Ga0207700_12007012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes505Open in IMG/M
3300025929|Ga0207664_10388074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1240Open in IMG/M
3300025930|Ga0207701_10438378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1122Open in IMG/M
3300025933|Ga0207706_10134958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2171Open in IMG/M
3300025939|Ga0207665_11172200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales613Open in IMG/M
3300025944|Ga0207661_11830527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium553Open in IMG/M
3300025972|Ga0207668_11024199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales738Open in IMG/M
3300025981|Ga0207640_10244603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1388Open in IMG/M
3300025981|Ga0207640_11044319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales721Open in IMG/M
3300025981|Ga0207640_11550128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium596Open in IMG/M
3300025986|Ga0207658_10391174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1220Open in IMG/M
3300026023|Ga0207677_10041331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3048Open in IMG/M
3300026041|Ga0207639_10524816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1085Open in IMG/M
3300026088|Ga0207641_10597306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1080Open in IMG/M
3300026088|Ga0207641_10648005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1037Open in IMG/M
3300026118|Ga0207675_100354593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1438Open in IMG/M
3300026118|Ga0207675_102246224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales560Open in IMG/M
3300026301|Ga0209238_1092890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1033Open in IMG/M
3300026310|Ga0209239_1174459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales819Open in IMG/M
3300026528|Ga0209378_1105327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1238Open in IMG/M
3300026529|Ga0209806_1254056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae592Open in IMG/M
3300027045|Ga0207726_1055922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales520Open in IMG/M
3300027603|Ga0209331_1040389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1190Open in IMG/M
3300027648|Ga0209420_1150400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales639Open in IMG/M
3300027678|Ga0209011_1137700All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300027775|Ga0209177_10412488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales544Open in IMG/M
3300027879|Ga0209169_10438726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae686Open in IMG/M
3300028379|Ga0268266_10185288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1898Open in IMG/M
3300028872|Ga0307314_10296197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales514Open in IMG/M
3300028906|Ga0308309_11752311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales526Open in IMG/M
3300029922|Ga0311363_10696453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales965Open in IMG/M
3300029945|Ga0311330_10849995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales687Open in IMG/M
3300029990|Ga0311336_10977491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae734Open in IMG/M
3300031231|Ga0170824_113394369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1904Open in IMG/M
3300031232|Ga0302323_101052923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium905Open in IMG/M
3300031261|Ga0302140_10585433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales842Open in IMG/M
3300031469|Ga0170819_15176590All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300031708|Ga0310686_108703390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae508Open in IMG/M
3300031718|Ga0307474_10032277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3842Open in IMG/M
3300031731|Ga0307405_11889872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales532Open in IMG/M
3300031753|Ga0307477_10402557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense937Open in IMG/M
3300031770|Ga0318521_10973041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales520Open in IMG/M
3300031860|Ga0318495_10367281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales636Open in IMG/M
3300031939|Ga0308174_11713687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales540Open in IMG/M
3300031949|Ga0214473_10282789All Organisms → cellular organisms → Bacteria → Proteobacteria1899Open in IMG/M
3300032005|Ga0307411_10728227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales867Open in IMG/M
3300032059|Ga0318533_10263974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1245Open in IMG/M
3300032089|Ga0318525_10172307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense1112Open in IMG/M
3300032180|Ga0307471_101899587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales745Open in IMG/M
3300032205|Ga0307472_101617988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales637Open in IMG/M
3300032261|Ga0306920_101331238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1032Open in IMG/M
3300033513|Ga0316628_102610901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.48%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.61%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.87%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.87%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.87%
Ant DumpHost-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.87%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Aerobic Enrichment MediaEngineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media0.87%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000931Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P1 (2)EngineeredOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005513Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017553Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft MG (version 2)EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300020144Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B110AHost-AssociatedOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023083Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L103-311B-2EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025006Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_plan (SPAdes)EngineeredOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_022036702170459003Grass SoilMIAKQSILGLVYTGGKVRRPPLVGMQFLHESPVRAPDLVSPRSRL
INPhiseqgaiiFebDRAFT_10133960423300000364SoilMRSKQSILGLVYSGGEIRRAPLVGLQFLHKGAMRSGDVVA
JGI12531J12852_1010823323300000931Aerobic Enrichment MediaMRAKQSILGLVDSRGEIRRAPLIGMEFLHQGAMGTADLVRPRARL
P5cmW16_102589013300001664PermafrostMRAKQSILGLVYTGSEVRRPPLIGMQFLHEPTVRAADLVTPRP
Ga0065704_1004862323300005289Switchgrass RhizosphereMRAKKNILGLIYAGSEVRRAPLVGMQFLHQGAVRPADVVTPRP
Ga0077120_125994413300005513Arabidopsis RhizosphereMRAKQSILGLVYPGGEVRRPPLVGMQFLHERTVGASNLV
Ga0070672_10120876423300005543Miscanthus RhizosphereMRAKKSILGLVYAGSEVRRAPLIGMQFLHQGAVRPADVV
Ga0070762_1069380213300005602SoilMRAKQNLFGLVYSGGEVRRPPLVGMQFLHEPTMGTADF
Ga0068856_10012132933300005614Corn RhizosphereMRTKQSILGLVYPGSEIRRAPLVGMQFLHEGFVRPADVVAPR
Ga0068852_10013857813300005616Corn RhizosphereMRAKQSILGLVYTGSEIRRAPLVGMQFLHQGLVSPAD
Ga0068866_1129910523300005718Miscanthus RhizosphereMRAKKGILGLVYTGSEVRRAPLVGMQFLHQGAVRPADVVTP
Ga0068858_10133663323300005842Switchgrass RhizosphereMRAKKGILGLVYAGSEVRRAPLIGMQFLHQGAVRPA
Ga0081540_100184613300005983Tabebuia Heterophylla RhizosphereVKRSKQGILGLVYSGGEIRRPPLVGMQFLHKGAMRAGDVVAA
Ga0081540_101188753300005983Tabebuia Heterophylla RhizosphereMRSKQGILGLVYSGGEIRRPPLVGMQFLHKGAMRAGDVVAA
Ga0081540_105097013300005983Tabebuia Heterophylla RhizosphereMRAKQGILGLVYTGGEIRRPPLVGMQFLHESAMRTGDVVAARP
Ga0075363_10048894113300006048Populus EndosphereMRAKQSVLGLVDPGRQVRRAPLVGMQFLHEGSVRA
Ga0075030_10033078633300006162WatershedsMRTKQNLLGLVYTGGEVRRPPLIGMQFLHERTVRPADLVAPR
Ga0070716_10124316513300006173Corn, Switchgrass And Miscanthus RhizosphereMRSKQSILGLVYPGGEVRRPPLVGMQFLHERAVGA
Ga0066665_1164346813300006796SoilMRAKQSILGLVYTGGEIRRPPLVGMQFLHERTVGPAD
Ga0073928_1014377713300006893Iron-Sulfur Acid SpringMRAKQSILGLVYTGGEVRRPPLIGMQFLHEGAVRPTDFVTP
Ga0105245_1261570623300009098Miscanthus RhizosphereMRAKQSILGLVYTGSEVRRPPLVGMQFLHEGAVGP
Ga0066709_10294002823300009137Grasslands SoilMRAKQSILGLVYTGGEVRRAPLIGMQFLHEGAVRP
Ga0137363_1155737723300012202Vadose Zone SoilMALPELAVMRAKQSILGLVYTGGEVRRPPLVGMQFL
Ga0137363_1160139413300012202Vadose Zone SoilMRAKQSILGLVYTGGEVRRPPLVGMQFLHERTVGPA
Ga0150985_10336714923300012212Avena Fatua RhizosphereMRAKQSILSLVYTGGEVRRPPLIGMQFLHESAVSP
Ga0157378_1277377323300013297Miscanthus RhizosphereMRTKQSILGLVYTGSEVRRPPWVGMEVLHEGAVQTADLVAA
Ga0182032_1034351913300016357SoilMRTKQNLLGLVYPSREVRRPPLVGMQFLHERTMRP
Ga0182744_115448123300017553CompostMRAKKSVLGLVDSGREVRRPPLVGMQFLHQPSMSAADFIA
Ga0184618_1038662523300018071Groundwater SedimentMRAKQSILGLVYTGGEVRRAPLIGMQFLHQGAVRPADVV
Ga0184635_1033649623300018072Groundwater SedimentMRAKKGILGLVYTGSEVRRAPLVGMQFLHQGAVRPADVVT
Ga0206106_11709223300020144Ant DumpMRAKQSVLGLIDPSRQVRRPPLVGMQFLHQGAVGT
Ga0210406_1047012323300021168SoilMRTKQSILGLVYPGGEVRRPPLVGMQFLHERAVGSND
Ga0210408_1044657113300021178SoilMRAKQSILGLVYTGSEVRRPPLVGMQFLHERTVRPSDFVPSR
Ga0210408_1047900813300021178SoilMRAKQNFLGLVYTGSEVRRPPLVGMQFLHEPTMGT
Ga0210396_1026022923300021180SoilMRAKQNLFGLVYTGGEVRRPPLIGMQFLHEPTMGT
Ga0213881_1040274613300021374Exposed RockMRAKQSILGLVYPGSEVRRPPLVGMQFLHEGSVRPADFVPARSR
Ga0213876_1030188333300021384Plant RootsMRAKQSILGLVYPGSEVRRPPLVGMQFLHECTVGS
Ga0210393_1071212123300021401SoilMRAKQNLLGLVYTGREVRRPPLVGMQFLHERAMGL
Ga0210397_1029312313300021403SoilMRTKQSILGLVYPGGEVRRPPLVGMQFLHERAVGPSDL
Ga0210397_1034953523300021403SoilMRAKQNLLGLVYTGREVRRPPLIGMQFLHERTMGPTDLVAP
Ga0210389_1009883023300021404SoilMRSKQNFLGLVYPGSEVRRPPLVGMQFLHERTVGPA
Ga0210389_1059226223300021404SoilMRAKQSILGLVYPGGEIRRAPLVGMQFLHQSAMRPA
Ga0210394_1113552113300021420SoilMRAKQNLLGLVYTGGEVRRPPLVGMQFLHEPTMGK
Ga0210390_1025085113300021474SoilMRAKQSILGLVYPGSEVRRPPLVGMQFLHEGSVRPADFVPVRS
Ga0210392_1105832523300021475SoilMSSKQSILGLVYPGGEVRRAPLIGMQFLHEPTVGASDLVA
Ga0126371_1394509023300021560Tropical Forest SoilMRAKQSILGLVYTGSEVRRPPLVGMQFLHEGSVRA
Ga0212123_1053739213300022557Iron-Sulfur Acid SpringMRAKQSILGLVYAGGEVRRPPLVGMQFLYERAVRPADLVPARPRL
Ga0247734_115830023300023083Plant LitterMRAKQSVLGLVYPGREVRRAPLVGMQFLHERPMRVADFVTPR
Ga0247794_1031139723300024055SoilMRAKQSILGLVYTGSEVRRPPLIGMQFLHEGAVRPTDFVPA
Ga0209935_107681523300025006Wastewater BioreactorMSAKQGILGLVYTGRQVRRPPLVGMQFLHEPSMRAPD
Ga0209171_1036909313300025320Iron-Sulfur Acid SpringMRAKQSILGLVYAGGEVRRPPLVGMQFLYERAVRPADLVPARP
Ga0207710_1032379933300025900Switchgrass RhizosphereMRAKQSILGLVYTGGEVRRAPLVGMQFLHQGTVSPA
Ga0207680_1035884223300025903Switchgrass RhizosphereMVAKQSVLGLVHTGSEIRRAPLVGLKFLHQPTMSPADFLAP
Ga0207685_1049374223300025905Corn, Switchgrass And Miscanthus RhizosphereMRSKQGILGLVYTGGEVRRPPLVGMQFLHERTVSTADFV
Ga0207699_1017158213300025906Corn, Switchgrass And Miscanthus RhizosphereMRAKQSILGLVYTGGEIRRPPLVGMQFLHERVVRPADFV
Ga0207705_1088816623300025909Corn RhizosphereMRTKQSILGLVYTGGEVRRPPLVGMQFLHEGAVRPADV
Ga0207693_1023803423300025915Corn, Switchgrass And Miscanthus RhizosphereMRAKQSILGLVYTGSEVRRPPLVGMQFLHEGTVGSAD
Ga0207660_1014713923300025917Corn RhizosphereMRAKQSILSLVYTGGEVRRPPLVGMQFLRERAVSPADVVT
Ga0207649_1079322523300025920Corn RhizosphereMRAKQSILGLVYPGSQVRRPPLVGMQFLHEHPVSPANF
Ga0207694_1050233723300025924Corn RhizosphereMSAKQSVLGLVYPGRQVRRPPLVGMQFLHEGTVRPTD
Ga0207700_1200701213300025928Corn, Switchgrass And Miscanthus RhizosphereMSAKKNLLGLIDAGSEVRRPPLVGMQFLHECAVGTS
Ga0207664_1038807423300025929Agricultural SoilMRAKQSILGLVYPGGEVRRPPLVGMQFLHEGSVRATDVV
Ga0207701_1043837813300025930Corn, Switchgrass And Miscanthus RhizosphereMRAKQSILGLVYTGGEIRRTPLVGMQFLHQGAVRP
Ga0207706_1013495813300025933Corn RhizosphereMRTKQSILGLVYTGGEVRRPPLVGMQFLHEGAVRPADVV
Ga0207665_1117220023300025939Corn, Switchgrass And Miscanthus RhizosphereMRAKQSILGLVYTGGEVRRPPLVGMQFLHEGAVRPTDLITRR
Ga0207661_1183052723300025944Corn RhizosphereMRTKQSILGLVYPGSEVRRAPLVGMQFLHEGFVRPADV
Ga0207668_1102419923300025972Switchgrass RhizosphereMRAKKNILGLIYAGSQVRRAPLVGMQFLHQGAVRPAD
Ga0207640_1024460323300025981Corn RhizosphereMRTKQSILGLVYPGSEVRRAPLVGMQFLHEGFVRPA
Ga0207640_1104431923300025981Corn RhizosphereMRAKKNILGLVYSGSEVRRAPLIGMQFLHEGAVRPADV
Ga0207640_1155012813300025981Corn RhizosphereMSAKKSVLGRVYTGRQVRRPPLIGMQFLHEPAMRTPDVVP
Ga0207658_1039117423300025986Switchgrass RhizosphereMRAKKSILGLVYAGSEVRRAPLIGMQFLHQGAVRPADVVAPRPRL
Ga0207677_1004133113300026023Miscanthus RhizosphereMRAKKSILGLVYAGGEVRRAPLIGMQFLHQGAVRPADVVT
Ga0207639_1052481613300026041Corn RhizosphereMRAKQSILGLVYPGSEVRRPPLVGMEFLHEGSVRPADVVPARA
Ga0207641_1059730623300026088Switchgrass RhizosphereMRAKKNILGLVYSGSEVRRAPLIGMQFLHQGAVRP
Ga0207641_1064800513300026088Switchgrass RhizosphereMRAKKNILGLVYSGSEVRRAPLIGMQFLHQGAVRPADV
Ga0207675_10035459313300026118Switchgrass RhizosphereMRAKKGILGLVYAGSEVRRAPLIGMQFLHQGAVRPADV
Ga0207675_10224622413300026118Switchgrass RhizosphereMRAKKSILGLVYAGSEVRRAPLIGMQFLHQGAVRPADV
Ga0209238_109289013300026301Grasslands SoilMRAKKGILGLVYTGSEVRRAPLVGMQFLHQGAVRPADVVAPRP
Ga0209239_117445913300026310Grasslands SoilMRAKQSILGLVYTGSEVRRPPLVGMQFLYEGAVRP
Ga0209378_110532723300026528SoilMRAKQSILGLVYSGGEVRRPPLVGMQFLHQGAMRPPDLVAARPR
Ga0209806_125405613300026529SoilMRAKQSILGLVYTGGEVRRPPLVGMQFLHERTVGPADFV
Ga0207726_105592223300027045Tropical Forest SoilMRAKQSILGLVYPGGEVRRPPLVGMQFLHERSVGSSD
Ga0209331_104038923300027603Forest SoilMIAKQNVLGLVYTGGQVRRPPLVGMQFLHQSPMRA
Ga0209420_115040023300027648Forest SoilMRAKQSILGLVYTGSKVRRPPLIGMQFLHQPAVRPTDF
Ga0209011_113770023300027678Forest SoilMRAKQSILGLVYTGSEVRRPPLVGMQFLHQGAVRPADIGTP
Ga0209177_1041248813300027775Agricultural SoilMRSKQGILGLVYTGGEIRRPPLVGMQFLHKGAMGAGD
Ga0209169_1043872613300027879SoilMRAKQSILGLVYPGSEIRRAPLVGMQFLHQGAMRLADG
Ga0268266_1018528823300028379Switchgrass RhizosphereMRSKQSILGLVYTGGEIRRPPLVGMQFLHERTMGASDF
Ga0307314_1029619713300028872SoilMRAKKNILGLVYSGSEVRRAPLVGMQFLHQGAVRPADVV
Ga0308309_1175231123300028906SoilMRTKQNLLSLVYPGSEVRRPPLVGMQFLHQGTVSPADVVAPRARL
Ga0311363_1069645313300029922FenMRAKQSILGLVYPGSEVRRPPLVGMQFLHERTVRPADL
Ga0311330_1084999513300029945BogMRTKQSILGLVYTGGEVRRPPLVGMQFLHQGAMRPADI
Ga0311336_1097749113300029990FenMRTKQSILGLVYPGGEIRRTPLVGMQFLHEGPVRPG
Ga0170824_11339436913300031231Forest SoilMRSKQSILGLVYPGGEIRRPPLVGMQFLHERTVSPSDLV
Ga0302323_10105292323300031232FenMRAKQGILGLVYSGGEIRRRRLPLVGMQFLHEGAVR
Ga0302140_1058543313300031261BogMRAKQSILGLVYPGSEIRRAPLVGMQFLHQGAMRLADGVAPRPR
Ga0170819_1517659013300031469Forest SoilMRAKQGILGLVYKGSEVRRPPLVGMLFLHQGAVRPFDVVAARPRL
Ga0310686_10870339013300031708SoilMRTKQSILGLVYTGGEVRRPPLVGMQFLHQGAMRPADL
Ga0307474_1003227743300031718Hardwood Forest SoilMRTKQNLLGLVYPGREVRRPPLVGMQFLHERTMRPAD
Ga0307405_1188987223300031731RhizosphereMRAKKNILGLVYSGSEVRRAPLVGMQFLHQSAVRPADVV
Ga0307477_1040255723300031753Hardwood Forest SoilMRTKQNLLGLVYPGREVRRPPLVGMQFLHERTMRPA
Ga0318521_1097304113300031770SoilMRAKQSILGLVYTGSEIRRPPLVGMQFLHQGSVGPTDLVA
Ga0318495_1036728113300031860SoilMRAKQSILGLVYSGGEVRRPPLVGMQFLHERSVGSSDFLA
Ga0308174_1171368713300031939SoilMRTKQSILGLVYTGSEVRRAPLVGMQFLHEGFVRPADVVAP
Ga0214473_1028278913300031949SoilMLAKQRFLGLVNPGRQVRRTPLVGMEFLHQGAVRA
Ga0307411_1072822723300032005RhizosphereMRAKQSILGLVYTGGEVRRAPLIGMQFLHQGAVRPADVVT
Ga0318532_1018180113300032051SoilMRSKQSILGLVYPGGEVRRPPLVGMQFLHERSVGSPDFLAPRAR
Ga0318533_1026397413300032059SoilMRTKQNLLGLVYPSREVRRPPLVGMQFLHERTMRPT
Ga0318525_1017230723300032089SoilMACPELIVMRTKQNLLGLVYPGREIRRPPLVGMQFLHERTMR
Ga0307471_10189958713300032180Hardwood Forest SoilMRSKQSILGLVYTGGEVRRPPLVGMQFLHERTVRPSDFV
Ga0307471_10347643313300032180Hardwood Forest SoilMATKQGILGFINAGGKIRRPPVVGMQFLHESPVGAPNL
Ga0307472_10161798813300032205Hardwood Forest SoilMRAKQSILGLVYTGGEIRRPPLVGMQFLHQGAVRPADVVPP
Ga0306920_10133123813300032261SoilMRAKQSILGLVYTGSEIRRPPLVGMQFLHQGSVGPTDL
Ga0335076_1042549823300032955SoilMRSKQSILGLVYTGGEVRRPPLVGMQFLHERTVGSADFVAPRAR
Ga0316628_10261090123300033513SoilMAFKQNLLGLVDLGREVRRPPLVGMEFLHEGAMGPADFLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.