| Basic Information | |
|---|---|
| Family ID | F080133 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TVTVTHWLGKHRSAMLPAGTELVMELSRPMTMTAASSGQ |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.09 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.696 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.957 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF03065 | Glyco_hydro_57 | 21.74 |
| PF07238 | PilZ | 6.96 |
| PF12787 | EcsC | 1.74 |
| PF01436 | NHL | 1.74 |
| PF04519 | Bactofilin | 0.87 |
| PF03781 | FGE-sulfatase | 0.87 |
| PF02922 | CBM_48 | 0.87 |
| PF01478 | Peptidase_A24 | 0.87 |
| PF13353 | Fer4_12 | 0.87 |
| PF00326 | Peptidase_S9 | 0.87 |
| PF01513 | NAD_kinase | 0.87 |
| PF08281 | Sigma70_r4_2 | 0.87 |
| PF00583 | Acetyltransf_1 | 0.87 |
| PF13650 | Asp_protease_2 | 0.87 |
| PF13847 | Methyltransf_31 | 0.87 |
| PF13305 | TetR_C_33 | 0.87 |
| PF00551 | Formyl_trans_N | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.70 % |
| Unclassified | root | N/A | 11.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10275546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1763 | Open in IMG/M |
| 3300001661|JGI12053J15887_10630878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 509 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101490191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 571 | Open in IMG/M |
| 3300002560|JGI25383J37093_10016983 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300004092|Ga0062389_100761135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1146 | Open in IMG/M |
| 3300005332|Ga0066388_103049375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300005338|Ga0068868_101272604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300005354|Ga0070675_100121358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2221 | Open in IMG/M |
| 3300005531|Ga0070738_10004133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17886 | Open in IMG/M |
| 3300005542|Ga0070732_10620568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300005559|Ga0066700_11105314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300005561|Ga0066699_10846116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300005591|Ga0070761_10214235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300005895|Ga0075277_1052596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 633 | Open in IMG/M |
| 3300006162|Ga0075030_100078802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2705 | Open in IMG/M |
| 3300006354|Ga0075021_10252279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1086 | Open in IMG/M |
| 3300006800|Ga0066660_10275891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
| 3300006914|Ga0075436_100430135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300009089|Ga0099828_10140846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
| 3300009098|Ga0105245_11046113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300009518|Ga0116128_1073315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300009522|Ga0116218_1434900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009525|Ga0116220_10513970 | Not Available | 544 | Open in IMG/M |
| 3300009630|Ga0116114_1027824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1670 | Open in IMG/M |
| 3300009643|Ga0116110_1043858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1626 | Open in IMG/M |
| 3300009645|Ga0116106_1052113 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300009839|Ga0116223_10646611 | Not Available | 609 | Open in IMG/M |
| 3300010048|Ga0126373_10681567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300010303|Ga0134082_10308307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300010337|Ga0134062_10131805 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300010358|Ga0126370_11388702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300010360|Ga0126372_10193551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1684 | Open in IMG/M |
| 3300010379|Ga0136449_103184280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300010391|Ga0136847_11437673 | Not Available | 503 | Open in IMG/M |
| 3300010400|Ga0134122_10195151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
| 3300011271|Ga0137393_10177866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1788 | Open in IMG/M |
| 3300012189|Ga0137388_10166373 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300012189|Ga0137388_10399204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300012349|Ga0137387_10873008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300012361|Ga0137360_11292076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300012582|Ga0137358_11082813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012683|Ga0137398_10741822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300012685|Ga0137397_10931363 | Not Available | 643 | Open in IMG/M |
| 3300012685|Ga0137397_11336346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 507 | Open in IMG/M |
| 3300012930|Ga0137407_10581038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300012931|Ga0153915_11024817 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012988|Ga0164306_11962129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300014159|Ga0181530_10652451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300014325|Ga0163163_10114935 | All Organisms → cellular organisms → Bacteria | 2723 | Open in IMG/M |
| 3300015373|Ga0132257_102335233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300016422|Ga0182039_10145988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1825 | Open in IMG/M |
| 3300017938|Ga0187854_10100361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300017938|Ga0187854_10139198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300017940|Ga0187853_10172467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300017943|Ga0187819_10135494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
| 3300017966|Ga0187776_10985873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300017966|Ga0187776_11373378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300017970|Ga0187783_10018056 | All Organisms → cellular organisms → Bacteria | 5213 | Open in IMG/M |
| 3300017975|Ga0187782_10112746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2006 | Open in IMG/M |
| 3300017975|Ga0187782_10339124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300018009|Ga0187884_10042078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2184 | Open in IMG/M |
| 3300018019|Ga0187874_10395308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300018034|Ga0187863_10096496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300018038|Ga0187855_10134009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1483 | Open in IMG/M |
| 3300018042|Ga0187871_10087191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300018042|Ga0187871_10639090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
| 3300018044|Ga0187890_10317596 | Not Available | 874 | Open in IMG/M |
| 3300018060|Ga0187765_10812556 | Not Available | 625 | Open in IMG/M |
| 3300018085|Ga0187772_10189056 | Not Available | 1379 | Open in IMG/M |
| 3300018090|Ga0187770_11577672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300018412|Ga0194136_1244725 | Not Available | 655 | Open in IMG/M |
| 3300018482|Ga0066669_11547499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300019787|Ga0182031_1068414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300020580|Ga0210403_11381261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300020581|Ga0210399_10045857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3506 | Open in IMG/M |
| 3300020581|Ga0210399_10240941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300021180|Ga0210396_10891769 | Not Available | 759 | Open in IMG/M |
| 3300021420|Ga0210394_11112710 | Not Available | 681 | Open in IMG/M |
| 3300021477|Ga0210398_11018573 | Not Available | 660 | Open in IMG/M |
| 3300021478|Ga0210402_11918217 | Not Available | 518 | Open in IMG/M |
| 3300021478|Ga0210402_11963202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 511 | Open in IMG/M |
| 3300021479|Ga0210410_10621898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300021560|Ga0126371_10031685 | All Organisms → cellular organisms → Bacteria | 4955 | Open in IMG/M |
| 3300022521|Ga0224541_1015575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300025507|Ga0208188_1132838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300025553|Ga0208080_1092121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300025922|Ga0207646_10919869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300025988|Ga0208141_1020342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026078|Ga0207702_10209095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
| 3300026078|Ga0207702_12432675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300027545|Ga0209008_1115484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027692|Ga0209530_1025525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1774 | Open in IMG/M |
| 3300027853|Ga0209274_10112436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300027853|Ga0209274_10500721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027875|Ga0209283_10083112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2077 | Open in IMG/M |
| 3300027911|Ga0209698_10083322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2708 | Open in IMG/M |
| 3300028047|Ga0209526_10336724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300028562|Ga0302151_10044053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
| 3300028572|Ga0302152_10125314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300028650|Ga0302170_10114432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300028748|Ga0302156_10136529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300029636|Ga0222749_10487643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300030524|Ga0311357_10371362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300030524|Ga0311357_10481767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300031708|Ga0310686_119253950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031718|Ga0307474_10192308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1551 | Open in IMG/M |
| 3300031912|Ga0306921_11185248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300031947|Ga0310909_11266374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300032261|Ga0306920_102266905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300032892|Ga0335081_10174835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3020 | Open in IMG/M |
| 3300033134|Ga0335073_10121982 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
| 3300033158|Ga0335077_10705927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300033433|Ga0326726_11472010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300033808|Ga0314867_047731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Watersheds | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.87% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.87% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018412 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T3A_14 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028650 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_1 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_102755462 | 3300000953 | Soil | GGTIGVTATVAHWLGKRRSAALPSGTELLLELNRPLELGAATTGQ* |
| JGI12053J15887_106308782 | 3300001661 | Forest Soil | VGGLVGATATVSHWLGKHRSATLPAGTELTLELDRPLMMSSPGVGQ* |
| JGIcombinedJ26739_1014901911 | 3300002245 | Forest Soil | ATATVSHWLGKHRSATLPAGTELTLELDRPLMMSSPSVGQ* |
| JGI25383J37093_100169833 | 3300002560 | Grasslands Soil | IGATATVAHWLGKRRSAMLPAGTELTMELSRPLAMTAASGGQ* |
| Ga0062389_1007611353 | 3300004092 | Bog Forest Soil | GGAVGATITVTHWLSKHRSAMLPAGTELVMELSRPLTMTATSAAGGQ* |
| Ga0066388_1030493752 | 3300005332 | Tropical Forest Soil | ASTHWLVQRRSAVLRSGTQLMMELSRPMTMSTTAAGAGQ* |
| Ga0068868_1012726043 | 3300005338 | Miscanthus Rhizosphere | TIGVTATVAHWLGKRRSAALPSGTELLLELNRPLELGAATTGQ* |
| Ga0070675_1001213582 | 3300005354 | Miscanthus Rhizosphere | VGATLTVAHWLGKKRSAVLPSGTELMMELSRPLAMTAETGGQ* |
| Ga0070738_100041331 | 3300005531 | Surface Soil | VGATVTTAHWLMKHNSAYLPAGTELVMELDRPLEMAPASGGQ* |
| Ga0070732_106205681 | 3300005542 | Surface Soil | AHWLGKKNSAMLPAGTELVMELSRPLAMTAANGGQ* |
| Ga0066700_111053141 | 3300005559 | Soil | VAHWLGKRRSAVLPAGTELVMELSRPMAMTAAGGGGQ* |
| Ga0066699_108461161 | 3300005561 | Soil | HWLSKHRSAMLPAGTELVMELSRPMALTAASAGQ* |
| Ga0070761_102142352 | 3300005591 | Soil | GLVGATVTVTHWLSKHRSAMLPAGTELVMELNRPMTMTTAIASSGQ* |
| Ga0075277_10525962 | 3300005895 | Rice Paddy Soil | VLIGGAIGATATITHWLARHRSAMIPAGTELVMELNRPVTLNAAASGGK* |
| Ga0075030_1000788021 | 3300006162 | Watersheds | VAHWLGKHRSAMLPAGTELVMELSRPMTMTWANSGQ* |
| Ga0075021_102522792 | 3300006354 | Watersheds | GGIGATLTVAHWLGKKRSAVLPSGTELMMELSRPLAMTAETAGQ* |
| Ga0066660_102758911 | 3300006800 | Soil | TVAHWLGKHRSAMLPAGTELVMELNRPMTMTVASGGQ* |
| Ga0075436_1004301352 | 3300006914 | Populus Rhizosphere | TVAHWLGKKRSAVLPSGTELMMELSRPLAMTAETGGQ* |
| Ga0099828_101408461 | 3300009089 | Vadose Zone Soil | TVAHWLSKHRSAMLPAGTELVMELSRPMALTAASSGQ* |
| Ga0105245_110461131 | 3300009098 | Miscanthus Rhizosphere | GAGATTTRWLVKHRSAVIPAGTELMMELSRPMEMGTTPSGQ* |
| Ga0116128_10733152 | 3300009518 | Peatland | TVTVTHWLGKHRSAMLPAGTELVMELSRPMTMTAASSGQ* |
| Ga0116218_14349002 | 3300009522 | Peatlands Soil | VTVTHWLAKHRSAMLPAGTELVMELNRPMTMTSASSGQ* |
| Ga0116220_105139701 | 3300009525 | Peatlands Soil | SIAATGTFVHWLTKRKSAVLPKGTELVMELNRPMAMTAASGGE* |
| Ga0116114_10278241 | 3300009630 | Peatland | TVTHWLGKHRSAMLPAGTELVMELSRPMTMTVAVASSGQ* |
| Ga0116110_10438581 | 3300009643 | Peatland | ATVTVTHWLGKHRSAMLPAGTELVMELSRPMTMTVAVASSGQ* |
| Ga0116106_10521133 | 3300009645 | Peatland | VTHWLGKHRSAMLPAGTELVMELSRPMTMTVAVASSGQ* |
| Ga0116223_106466112 | 3300009839 | Peatlands Soil | TFVHWLTKRKSAVLPKGTELVMELNRPMAMTAASGGE* |
| Ga0126373_106815672 | 3300010048 | Tropical Forest Soil | VIGATATVTHWLSKHRSAMLPAGTELVMELSRLMVMTTAD* |
| Ga0134082_103083071 | 3300010303 | Grasslands Soil | GATLTVAHWLGKRRSAMLPAGTELTMEFSRPLAMTATSGGQ* |
| Ga0134062_101318052 | 3300010337 | Grasslands Soil | HWLGKKRSAMLPAGTELLMELSRPLSMDVVKGGQ* |
| Ga0126370_113887022 | 3300010358 | Tropical Forest Soil | GATATVTHWLSKHRSAMLPAGTELVMELSRPMVMTAPAGQ* |
| Ga0126372_101935512 | 3300010360 | Tropical Forest Soil | TATLAHWLGKHRSAVLPAGTELVMEISHPMTLSAATTGR* |
| Ga0136449_1031842802 | 3300010379 | Peatlands Soil | FLIGGAVGATVTVTHWLAKHRSAMLPAGTELVMELNRPMTMTSASSGQ* |
| Ga0136847_114376732 | 3300010391 | Freshwater Sediment | TVAHWLSKHKSAELPAGSEIVMELNRPMSLSASSSGK* |
| Ga0134122_101951512 | 3300010400 | Terrestrial Soil | GAVGATLTVAHWLGKKRSAVLPSGTELMMELSRPLAMTAETGGQ* |
| Ga0137393_101778661 | 3300011271 | Vadose Zone Soil | AIGATATVAHWLGKHRSAMLPAGTELVMELNRPMTMTGASGGQ* |
| Ga0137388_101663731 | 3300012189 | Vadose Zone Soil | ATVTVAHWLGKHRSAMLPAGTELVMELNRPMTMTGASSGQ* |
| Ga0137388_103992041 | 3300012189 | Vadose Zone Soil | TVAHWLAKHRSAMLPAGTVLEMELSRPMALTAASAGQ* |
| Ga0137387_108730081 | 3300012349 | Vadose Zone Soil | TVAHWLGKRRSAVLPAGTELVMELSRPMAMTAAGGGGR* |
| Ga0137360_112920761 | 3300012361 | Vadose Zone Soil | IGGAIGATATVAHWLGKHRSAMLPAGTELVMELNRPMTMTMTVASGGQ* |
| Ga0137358_100453504 | 3300012582 | Vadose Zone Soil | LIGGAIGATATVAHWLGKHRSAMLPAGTELVMELNRPMTMTGTSGGQ* |
| Ga0137358_110828132 | 3300012582 | Vadose Zone Soil | LIGGAIGATATVAHWLGKHRSAMLPAGTELVMELNRPMTMTMTVASGGQ* |
| Ga0137398_107418221 | 3300012683 | Vadose Zone Soil | HWLGKKRSAVLPSGTELMMELSRPLAMTAESGGQ* |
| Ga0137397_109313631 | 3300012685 | Vadose Zone Soil | TIHWLTKHHSAILPAGTELVMELSRPMEMSAAVSNGE* |
| Ga0137397_113363461 | 3300012685 | Vadose Zone Soil | GATATIAHWLSKHKSAMIPAGTELVMELSRPMTLSAAGAGK* |
| Ga0137407_105810381 | 3300012930 | Vadose Zone Soil | TLTVAHWLGKRRSAVLPSGTELMMELSRPLEMTPEAGGQ* |
| Ga0153915_110248171 | 3300012931 | Freshwater Wetlands | TVAHWLTKRHEAELPAGSEITMELSRPMAMTGAGK* |
| Ga0164306_119621291 | 3300012988 | Soil | GGVGATLTVAHWLGKKRGAVLPSGTELTMELSRPLAMTADTGGQ* |
| Ga0181530_106524512 | 3300014159 | Bog | HWLGKHRSAMLPAGTELVMELSRPMTMTVAVASSGQ* |
| Ga0163163_101149353 | 3300014325 | Switchgrass Rhizosphere | HWLTKRRTAMLPPGTELVMELNRPMTLSSASSGQ* |
| Ga0132257_1023352331 | 3300015373 | Arabidopsis Rhizosphere | LTVAHWLGKKRSAVLPSGTELTMELSRPLAMTAESGGQ* |
| Ga0182039_101459882 | 3300016422 | Soil | IGGAIGASATVVHWMSKKKYASLPAGTELTMELSRPLEMKQASAGK |
| Ga0187854_101003612 | 3300017938 | Peatland | TVTVTHWLGKHRSAMLPAGTELVMELSRPMTMTSAVASSGQ |
| Ga0187854_101391982 | 3300017938 | Peatland | WLGKHRSAMLPAGTELVMELSRPMTMNVVVASSGQ |
| Ga0187853_101724672 | 3300017940 | Peatland | ATVTVTHWLGKHRSAMLPAGTEIVMELSRPMTMTVAVASSGQ |
| Ga0187819_101354941 | 3300017943 | Freshwater Sediment | THWLGKHRSAMLPAGTELVMELSRPMTMTVVVASSGQ |
| Ga0187776_109858732 | 3300017966 | Tropical Peatland | AHWLGKHRSAEIPAGTELMLELSRPLAMTAAAAGQ |
| Ga0187776_113733782 | 3300017966 | Tropical Peatland | AHWLGKHRSATLPAGTELVMELSRPMTMSAAGGGK |
| Ga0187783_100180561 | 3300017970 | Tropical Peatland | TITVAHWLGKHRSATLPAGTELVMELNRPLTMTSPAAGQ |
| Ga0187782_101127462 | 3300017975 | Tropical Peatland | TATVAHWLSKHNSAMLPAGTELDMELSRPLVMTAPAAGQ |
| Ga0187782_103391242 | 3300017975 | Tropical Peatland | TATVTHWLSKHNSAMLPAGTELDMELSRPLVMTAAAAGQ |
| Ga0187884_100420781 | 3300018009 | Peatland | THWLGKHRSAMLPAGTELVMELSRPMTMTSASTGQ |
| Ga0187874_103953081 | 3300018019 | Peatland | VTVGHWMGKKNSATLPAGTELVMELSRPLEMTAATGGQ |
| Ga0187863_100964961 | 3300018034 | Peatland | IGATVTVAHWLSKHNSAFLPAGTELVMELDRPLEMSPATGGQ |
| Ga0187855_101340093 | 3300018038 | Peatland | ATVTVTHWLGKHRSAMLPAGTELVMELNRPMTMTMTVASGGQ |
| Ga0187871_100871912 | 3300018042 | Peatland | TVTHWLGKHRSAMLPAGTELVMELSRPMTMTVAVASSGQ |
| Ga0187871_106390901 | 3300018042 | Peatland | GAVGATVTVAHWLGKHRSAMLPAGTELVMELNRPMTMSVAVASSGQ |
| Ga0187890_103175961 | 3300018044 | Peatland | GAVGAAVTVAHWLGKHRSAMLPAGTELVMELNRPMTMTTTAAGGQ |
| Ga0187765_108125562 | 3300018060 | Tropical Peatland | VAHWLGKKNSAMLPAGTELVMELSRPLEMAPATTGGQ |
| Ga0187772_101890561 | 3300018085 | Tropical Peatland | ATITVSHWLGKHRSAMLPAGTELVMELSRPMTMTTAVAGSGQ |
| Ga0187770_115776722 | 3300018090 | Tropical Peatland | TVAVAHWLGKKNSATLPAGTELVMELSRPMDMSAATGGQ |
| Ga0194136_12447251 | 3300018412 | Watersheds | ITHWLAKHRSAMLPAGTELVMELNRPMVMSPNSGQ |
| Ga0066669_115474991 | 3300018482 | Grasslands Soil | GAGATVTHWLSKHRSTTLPAGTQLVMELNRPMVMSPNSGQ |
| Ga0182031_10684141 | 3300019787 | Bog | MIGATVTVTHWLGKHRSATLPAGTELVMELNRPMTMSTASSGQ |
| Ga0210403_113812612 | 3300020580 | Soil | ATVTHWLSKKNSAVLPAGTELVMELSRPLEMTAAATGGQ |
| Ga0210399_100458573 | 3300020581 | Soil | ATVTVAHWLGKHRSAMLPAGTELVMELNRPMTMTVASGGQ |
| Ga0210399_102409411 | 3300020581 | Soil | GVGATLTVAHWLGKRRSAALPSGTELMIELSRPLAMTPETAGQ |
| Ga0210396_108917693 | 3300021180 | Soil | IGATIGATATVARWLGKRNSAELPAGTQLVMELSRPLEMTAATGGQ |
| Ga0210394_111127102 | 3300021420 | Soil | THWLVKKNSATLPAGTLLTMELSRPLAMTPAPSAPGN |
| Ga0210398_110185732 | 3300021477 | Soil | IGATVTITHWLGKHRSAMLPAGTELVMELSRPMTMTTVVASTGQ |
| Ga0210402_119182171 | 3300021478 | Soil | GASATVTHWLIKKNSATLPAGTLLTMELSRPLAMTPAPSAPGN |
| Ga0210402_119632021 | 3300021478 | Soil | VIGGAIGATATVVHWLGKKKSATLLAGTELVMELNRPLEMAPAAAGQ |
| Ga0210410_106218983 | 3300021479 | Soil | TATVAHWLGKKNSTALPAGTTLVMALSRPLEMTADTGGQ |
| Ga0126371_100316854 | 3300021560 | Tropical Forest Soil | TTAHWLSKRNSAALPSGTELVMELSRSMTIGAAAPESGQ |
| Ga0224541_10155751 | 3300022521 | Soil | GGAIGATVTVTHWLGKHRSAMLPAGTELVMELNRPMTMTTTVASAGQ |
| Ga0208188_11328381 | 3300025507 | Peatland | GAVGATVTVTHWLGKHRSAMLPAGTELVMELSRPMTMTAASSGQ |
| Ga0208080_10921212 | 3300025553 | Arctic Peat Soil | VGATATVTHWLAKHRSAMLPAGTELVMELNRPMTMTSASTGQ |
| Ga0207646_109198691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ATATVAHWLGKHRSAVLPAGTELVMELNRPVTMTMTSASGGQ |
| Ga0208141_10203421 | 3300025988 | Rice Paddy Soil | VLIGGAIGATATITHWLARHRSAMIPAGTELVMELNRPVTLNAAASGGK |
| Ga0207702_102090952 | 3300026078 | Corn Rhizosphere | GATATITHWLTKRRTAMLPPGTELVMELNRPMTLSSASSGQ |
| Ga0207702_124326751 | 3300026078 | Corn Rhizosphere | TVAHWLGKKRSAVLPSGTELMMELSRPLAMTAETGGQ |
| Ga0209008_11154842 | 3300027545 | Forest Soil | VTVSHWLGKHRSASLPAGTELVMELNRPMVMTSAVAGQ |
| Ga0209530_10255251 | 3300027692 | Forest Soil | GAVGATVTVAHWLGKHRSAMLPAGTEMVMELNRPMMMSVAAPSNGQ |
| Ga0209274_101124362 | 3300027853 | Soil | ITVSHWLGKHRSAALPAGTELVMELSRPMTMTAASSGQ |
| Ga0209274_105007211 | 3300027853 | Soil | GLVGATVTVTHWLSKHRSAMLPAGTELVMELNRPMTMTTAIASSGQ |
| Ga0209283_100831121 | 3300027875 | Vadose Zone Soil | TVAHWLSKHRSAMLPAGTELVMELSRPMALTAASSGQ |
| Ga0209698_100833223 | 3300027911 | Watersheds | VAHWLGKHRSAMLPAGTELVMELSRPMTMTWANSGQ |
| Ga0209526_103367241 | 3300028047 | Forest Soil | SHWLGKHRSATLPAGTELTLELDRPLMMSSPSVGQ |
| Ga0302151_100440531 | 3300028562 | Bog | THWLGKHRSATLPAGTELVMELNRPMTMSTASSGQ |
| Ga0302152_101253142 | 3300028572 | Bog | VTVAHWLGKHRSGMLPAGTELVMELNRPMTMTMTTASAVGGQ |
| Ga0302170_101144322 | 3300028650 | Fen | VTVTHWLAKHRSATLPAGTELVMELSRPMVMNQVAGQ |
| Ga0302156_101365293 | 3300028748 | Bog | GAVGATVTVAHWLGKHRSAMLPAGTELVMELNRPMTMTTTAAGGQ |
| Ga0222749_104876431 | 3300029636 | Soil | IGATVTVAHWLGKKRGAMLPSGTELMMELSRPLAMTAEASGQ |
| Ga0311357_103713622 | 3300030524 | Palsa | IGGLVGATVTVTHWLSKHRSAMLPAGTELVMELNRPMTMTTAIASSGQ |
| Ga0311357_104817672 | 3300030524 | Palsa | GATITVTHWLGKHRSAMLPAGTELTMELNRPMTMTTTVASTGQ |
| Ga0310686_1192539501 | 3300031708 | Soil | ATVTVAHWLGKHRSAMLPAGTELVMELNRPMTMTTVVASSGQ |
| Ga0307474_101923081 | 3300031718 | Hardwood Forest Soil | GGAVGATATVAHWMGKKNSAALPAGTELVMELSRPLAMTAATGGQ |
| Ga0306921_111852482 | 3300031912 | Soil | TVAHWMSKKKYASLPAGTELTMELSRPLEMKQASAGQ |
| Ga0310909_112663742 | 3300031947 | Soil | GGAIGASATVAHWMSKKKYASLPAGTELVMELSRPMEMKEAPAGQ |
| Ga0306920_1022669052 | 3300032261 | Soil | THWLAKHRSATLPAGTELTMELSRPMTLTAASGGQ |
| Ga0335081_101748354 | 3300032892 | Soil | TAAIAYWLSKRNSAVLPAGTELVMEVERPLAMTPPTTGQ |
| Ga0335073_101219821 | 3300033134 | Soil | GATATVSHWLGKHRSATLPAGTELVMELNRPMTMTSVAAGQ |
| Ga0335077_107059271 | 3300033158 | Soil | AHWLGKKRSTELPAGTELDMELTRPLTMTAASAGQ |
| Ga0326726_114720102 | 3300033433 | Peat Soil | IGGAVGATATVVHWLGRHKSAMLPAGTELVVELNRPMTLSAAGE |
| Ga0314867_047731_892_1002 | 3300033808 | Peatland | AHWLGKKNSATLPAGTELVMELSHAMDLSAVTVGGQ |
| ⦗Top⦘ |