| Basic Information | |
|---|---|
| Family ID | F079773 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTETNVNLNVHEIGVILSALQLLNNSDENRIAREYGSAPALYNK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.29 % |
| % of genes near scaffold ends (potentially truncated) | 95.65 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.304 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (21.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.652 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (54.783 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF03330 | DPBB_1 | 6.09 |
| PF01555 | N6_N4_Mtase | 3.48 |
| PF02086 | MethyltransfD12 | 1.74 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.48 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.48 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.48 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.74 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.30 % |
| All Organisms | root | All Organisms | 48.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001255|B570J13889_101479 | Not Available | 578 | Open in IMG/M |
| 3300001818|ACM19_105020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S05-C22 | 802 | Open in IMG/M |
| 3300001827|ACM21_1035320 | Not Available | 692 | Open in IMG/M |
| 3300005528|Ga0068872_10082592 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300005805|Ga0079957_1290912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 740 | Open in IMG/M |
| 3300006810|Ga0070754_10256465 | All Organisms → Viruses | 797 | Open in IMG/M |
| 3300006867|Ga0075476_10027036 | All Organisms → Viruses → Predicted Viral | 2431 | Open in IMG/M |
| 3300006868|Ga0075481_10066457 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300006870|Ga0075479_10237750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 725 | Open in IMG/M |
| 3300006874|Ga0075475_10103577 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300006916|Ga0070750_10183534 | Not Available | 934 | Open in IMG/M |
| 3300006919|Ga0070746_10498967 | Not Available | 535 | Open in IMG/M |
| 3300007345|Ga0070752_1319856 | Not Available | 588 | Open in IMG/M |
| 3300007346|Ga0070753_1284614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 593 | Open in IMG/M |
| 3300007539|Ga0099849_1342263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 533 | Open in IMG/M |
| 3300008262|Ga0114337_1005858 | Not Available | 9007 | Open in IMG/M |
| 3300009124|Ga0118687_10124291 | Not Available | 908 | Open in IMG/M |
| 3300010296|Ga0129348_1319684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 517 | Open in IMG/M |
| 3300010297|Ga0129345_1132445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 907 | Open in IMG/M |
| 3300010297|Ga0129345_1320076 | Not Available | 535 | Open in IMG/M |
| 3300010299|Ga0129342_1158380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 822 | Open in IMG/M |
| 3300010299|Ga0129342_1180694 | Not Available | 756 | Open in IMG/M |
| 3300010299|Ga0129342_1282792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
| 3300010300|Ga0129351_1207377 | Not Available | 759 | Open in IMG/M |
| 3300010300|Ga0129351_1311971 | Not Available | 594 | Open in IMG/M |
| 3300010300|Ga0129351_1397026 | Not Available | 515 | Open in IMG/M |
| 3300010318|Ga0136656_1187639 | Not Available | 696 | Open in IMG/M |
| 3300010354|Ga0129333_10321453 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
| 3300010354|Ga0129333_10336149 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300010354|Ga0129333_10500595 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300010354|Ga0129333_10547271 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300010354|Ga0129333_11231137 | Not Available | 621 | Open in IMG/M |
| 3300010370|Ga0129336_10497511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 657 | Open in IMG/M |
| 3300010370|Ga0129336_10511696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 646 | Open in IMG/M |
| 3300010412|Ga0136852_10813625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 893 | Open in IMG/M |
| 3300012966|Ga0129341_1220902 | Not Available | 601 | Open in IMG/M |
| 3300012970|Ga0129338_1000337 | Not Available | 555 | Open in IMG/M |
| 3300013087|Ga0163212_1216015 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10072663 | All Organisms → Viruses → Predicted Viral | 2585 | Open in IMG/M |
| 3300016771|Ga0182082_1258299 | All Organisms → Viruses | 561 | Open in IMG/M |
| 3300016771|Ga0182082_1593312 | All Organisms → Viruses | 811 | Open in IMG/M |
| 3300017958|Ga0181582_10813894 | Not Available | 555 | Open in IMG/M |
| 3300017968|Ga0181587_10971353 | Not Available | 522 | Open in IMG/M |
| 3300018039|Ga0181579_10693683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
| 3300018424|Ga0181591_10632221 | Not Available | 762 | Open in IMG/M |
| 3300018424|Ga0181591_10642159 | Not Available | 754 | Open in IMG/M |
| 3300018424|Ga0181591_10890647 | All Organisms → Viruses | 611 | Open in IMG/M |
| 3300018424|Ga0181591_11102514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 534 | Open in IMG/M |
| 3300019784|Ga0181359_1053825 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300020074|Ga0194113_10430189 | Not Available | 962 | Open in IMG/M |
| 3300020083|Ga0194111_10158652 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
| 3300020083|Ga0194111_10618268 | Not Available | 677 | Open in IMG/M |
| 3300020109|Ga0194112_10557352 | Not Available | 790 | Open in IMG/M |
| 3300020109|Ga0194112_10782498 | Not Available | 626 | Open in IMG/M |
| 3300020109|Ga0194112_11049342 | Not Available | 512 | Open in IMG/M |
| 3300020183|Ga0194115_10269835 | Not Available | 793 | Open in IMG/M |
| 3300020183|Ga0194115_10452223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 537 | Open in IMG/M |
| 3300020196|Ga0194124_10366364 | Not Available | 671 | Open in IMG/M |
| 3300020196|Ga0194124_10375330 | Not Available | 659 | Open in IMG/M |
| 3300020197|Ga0194128_10411327 | Not Available | 641 | Open in IMG/M |
| 3300020222|Ga0194125_10079183 | All Organisms → Viruses → Predicted Viral | 2879 | Open in IMG/M |
| 3300020222|Ga0194125_10383376 | Not Available | 895 | Open in IMG/M |
| 3300020498|Ga0208050_1013748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 880 | Open in IMG/M |
| 3300020554|Ga0208599_1024803 | Not Available | 947 | Open in IMG/M |
| 3300020578|Ga0194129_10455590 | Not Available | 648 | Open in IMG/M |
| 3300020603|Ga0194126_10594932 | Not Available | 662 | Open in IMG/M |
| 3300021091|Ga0194133_10153639 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300021091|Ga0194133_10264015 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300021092|Ga0194122_10316405 | Not Available | 799 | Open in IMG/M |
| 3300021092|Ga0194122_10344548 | Not Available | 759 | Open in IMG/M |
| 3300021092|Ga0194122_10533986 | Not Available | 582 | Open in IMG/M |
| 3300021376|Ga0194130_10261155 | Not Available | 983 | Open in IMG/M |
| 3300021376|Ga0194130_10442014 | Not Available | 679 | Open in IMG/M |
| 3300021424|Ga0194117_10464431 | Not Available | 570 | Open in IMG/M |
| 3300021425|Ga0213866_10174281 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300021961|Ga0222714_10102778 | All Organisms → Viruses → Predicted Viral | 1804 | Open in IMG/M |
| 3300021961|Ga0222714_10167595 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300021961|Ga0222714_10200483 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300021962|Ga0222713_10392447 | Not Available | 856 | Open in IMG/M |
| 3300021963|Ga0222712_10300026 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300022071|Ga0212028_1113412 | All Organisms → Viruses | 502 | Open in IMG/M |
| 3300022176|Ga0212031_1019261 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300022200|Ga0196901_1058688 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
| 3300022937|Ga0255770_10241959 | All Organisms → Viruses | 872 | Open in IMG/M |
| 3300023081|Ga0255764_10217976 | All Organisms → Viruses | 929 | Open in IMG/M |
| 3300023115|Ga0255760_10398956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 638 | Open in IMG/M |
| 3300024356|Ga0255169_1083159 | Not Available | 526 | Open in IMG/M |
| 3300024480|Ga0255223_1070739 | Not Available | 599 | Open in IMG/M |
| 3300024483|Ga0255224_1059651 | Not Available | 789 | Open in IMG/M |
| 3300024848|Ga0255229_1043233 | Not Available | 773 | Open in IMG/M |
| 3300025646|Ga0208161_1032247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1833 | Open in IMG/M |
| 3300025646|Ga0208161_1135312 | Not Available | 634 | Open in IMG/M |
| 3300025647|Ga0208160_1133901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 615 | Open in IMG/M |
| 3300025655|Ga0208795_1109134 | Not Available | 732 | Open in IMG/M |
| 3300025674|Ga0208162_1195943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
| 3300025687|Ga0208019_1204152 | Not Available | 515 | Open in IMG/M |
| 3300025771|Ga0208427_1067703 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300025889|Ga0208644_1227190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300025889|Ga0208644_1237506 | Not Available | 763 | Open in IMG/M |
| 3300027156|Ga0255078_1093062 | Not Available | 575 | Open in IMG/M |
| 3300027793|Ga0209972_10241030 | Not Available | 820 | Open in IMG/M |
| 3300027917|Ga0209536_100219704 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
| 3300027917|Ga0209536_102151478 | Not Available | 666 | Open in IMG/M |
| 3300027917|Ga0209536_103247725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S05-C22 | 516 | Open in IMG/M |
| 3300029930|Ga0119944_1019928 | Not Available | 918 | Open in IMG/M |
| 3300029933|Ga0119945_1012312 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300029933|Ga0119945_1026647 | Not Available | 669 | Open in IMG/M |
| 3300031669|Ga0307375_10329820 | Not Available | 969 | Open in IMG/M |
| 3300032050|Ga0315906_10225758 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300034071|Ga0335028_0063774 | All Organisms → Viruses → Predicted Viral | 2468 | Open in IMG/M |
| 3300034118|Ga0335053_0272760 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 15.65% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.43% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.35% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.61% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.61% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.87% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.87% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.87% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001818 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM19, ROCA_DNA029_2.0um_3a | Environmental | Open in IMG/M |
| 3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13889_1014792 | 3300001255 | Freshwater | MTEATVQLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKLYS |
| ACM19_1050202 | 3300001818 | Marine Plankton | MTDANVNLNVHEIGIILSALQLLQHRDENLIAREYG* |
| ACM21_10353204 | 3300001827 | Marine Plankton | MSGLMVKNVKINLNVHEIGVILSALQLLQHRDENLIAKEYGSTTALYERLHSVWE |
| B570J29032_1097851451 | 3300002408 | Freshwater | MNMTETQVNLNVHEIGIILSALQNLENIDEIHIARDYGSV |
| Ga0068872_100825921 | 3300005528 | Freshwater Lake | MTETQVNLNVHELGVILSALQELNLREENRIAREYGSVPALYNKL |
| Ga0079957_12909123 | 3300005805 | Lake | MTETNVQLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKLY |
| Ga0070754_102564654 | 3300006810 | Aqueous | MTETEVKLNVHEIGVILSALQLLENRDENQIAREYGSSQALY |
| Ga0075476_100270365 | 3300006867 | Aqueous | MTEVEIKLNVHEIGVILSALQLLNNSDEIHIAREYG |
| Ga0075481_100664573 | 3300006868 | Aqueous | MTEVEIKLNVHEIGVILSALQLLNNSDEIHIAREYGSSQALYHKLSTIMEGM |
| Ga0075479_102377501 | 3300006870 | Aqueous | MTETNVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEALY |
| Ga0075475_101035771 | 3300006874 | Aqueous | MTETEVKLNVHEIGVILSALQLLENRDENQIAREYGSAQA |
| Ga0070750_101835344 | 3300006916 | Aqueous | MKTNVDINLNVHEIGVILSALQLLQHRDENLIAKEYGSTTALYERLHSVWETLD |
| Ga0070746_104989672 | 3300006919 | Aqueous | MTDANINLNVHEIGIILSALQLLQHRDENLIAREY |
| Ga0070752_13198563 | 3300007345 | Aqueous | MTETNVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEAL |
| Ga0070753_12846143 | 3300007346 | Aqueous | MTETEVKLNVHEIGVILSALQLLENRDENQIAREYGSAQALYHKLSTI |
| Ga0099849_13422632 | 3300007539 | Aqueous | MTETQVNLNVHEIGVILSALQLLNNSDEIHIAREYGSSQALYH |
| Ga0114337_100585827 | 3300008262 | Freshwater, Plankton | MTETNVNLNVHEIGVMLSALQLLTNSDENRIAREYGSAQALY |
| Ga0114876_10568678 | 3300008448 | Freshwater Lake | MKDVNVNLNVQEIGILLSALQDLDNVDEIRLSREYGSA |
| Ga0118687_101242912 | 3300009124 | Sediment | MKEVNFKLNVQEVGVILSALQLLELTEENYIAKEYGSVAALYDR |
| Ga0129348_13196841 | 3300010296 | Freshwater To Marine Saline Gradient | MTETQVNLNVHEIGVILSALQLLENRDEHQIAREYGSVQALY |
| Ga0129345_11324451 | 3300010297 | Freshwater To Marine Saline Gradient | MTETEVRLNVHEIGVILSALQLLENRDEHQIAREYGSVQALYHKLHS |
| Ga0129345_13200761 | 3300010297 | Freshwater To Marine Saline Gradient | MKDVDVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAALYERL |
| Ga0129342_11004523 | 3300010299 | Freshwater To Marine Saline Gradient | MTETNVNLNVHEIGILLSALQLLNNSDEIHIAREYGSSQALYN |
| Ga0129342_11583804 | 3300010299 | Freshwater To Marine Saline Gradient | MTETNVNLNVHEIGVILSALQLLNNSDENRIAREYGSAPALYNK |
| Ga0129342_11806944 | 3300010299 | Freshwater To Marine Saline Gradient | MTDANINLNVHEIGIILSALQLLQHRDENLIAREYGSTEALYDKLNNIWQTLD |
| Ga0129342_12827921 | 3300010299 | Freshwater To Marine Saline Gradient | MTETQVNLNVHEIGVILSALQLLENRDENQIAREYGSV |
| Ga0129351_12073771 | 3300010300 | Freshwater To Marine Saline Gradient | MTDTNVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEA |
| Ga0129351_13119711 | 3300010300 | Freshwater To Marine Saline Gradient | MTDANINLNVHEIGIILSALQLLQHRDENLIAREYGSTEA |
| Ga0129351_13970261 | 3300010300 | Freshwater To Marine Saline Gradient | MKDVDVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAALYER |
| Ga0136656_11876391 | 3300010318 | Freshwater To Marine Saline Gradient | MMTDANVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEALYNKLNNI |
| Ga0129333_103214531 | 3300010354 | Freshwater To Marine Saline Gradient | MNEATVQLNVHEIGVILSALQELNLREENRIAREYGS |
| Ga0129333_103361496 | 3300010354 | Freshwater To Marine Saline Gradient | MTETTVQLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKLYS |
| Ga0129333_105005954 | 3300010354 | Freshwater To Marine Saline Gradient | MTETTVNLNVHEVGVILSALQLLENVDENRIAKEYGSARALYDKLYEVW |
| Ga0129333_105472715 | 3300010354 | Freshwater To Marine Saline Gradient | MTETTVQLNVHEIGVILSALQELNLREENRIAREYGSAAAL |
| Ga0129333_112311371 | 3300010354 | Freshwater To Marine Saline Gradient | MTETEVKLNVHEVGVILSALQLLENVDENRIAREY |
| Ga0129336_104975113 | 3300010370 | Freshwater To Marine Saline Gradient | MTEISVNLNVHEVGVILSALQLLENVDENRIAREYGSA |
| Ga0129336_105116963 | 3300010370 | Freshwater To Marine Saline Gradient | MTEISVNLNVHEVGVILSALQLLENVDENRIAREYGSAQALYD |
| Ga0136852_108136251 | 3300010412 | Mangrove Sediment | ETTIELNVHEIGVILSALQLLTNGDEYRIAREYGSAQALYDKMNAIW* |
| Ga0129341_12209021 | 3300012966 | Aqueous | MTDANVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAAL |
| Ga0129338_10003372 | 3300012970 | Aqueous | MTESNVQLNVHEIGVILSALQLLGVREEHQIAREYGSVPALYN |
| Ga0163212_12160152 | 3300013087 | Freshwater | MTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYN |
| (restricted) Ga0172376_100726637 | 3300014720 | Freshwater | MNLNVHELGVILSALQMLTNRDENQIAREYGSVPALYNKLYTVWER |
| Ga0182082_12582991 | 3300016771 | Salt Marsh | MTDANINLNVHEIGIILSALQLLQHRDENLIAKEY |
| Ga0182082_15933121 | 3300016771 | Salt Marsh | MTETQVNLNVHELGVILSALQLLNNSDEIHIAREYGSSQA |
| Ga0181582_108138943 | 3300017958 | Salt Marsh | MDNVDVNLNVHEIGVILSALQLLQHRDENLIAKEYGSTTALYDKLNSIWE |
| Ga0181587_109713531 | 3300017968 | Salt Marsh | MTDANVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAALYERLHSVWQTL |
| Ga0181579_106936831 | 3300018039 | Salt Marsh | MTEVEIKLNVHEIGVILSALQLLENRDENHIAREYGSV |
| Ga0181591_106322211 | 3300018424 | Salt Marsh | MDNVDVNLNVHEIGVILSALQLLQHRDENLIAKEY |
| Ga0181591_106421594 | 3300018424 | Salt Marsh | MTDANINLNVHEIGIILSALQLLQHRDENLIAREYGSTEALYDKLNNIW |
| Ga0181591_108906471 | 3300018424 | Salt Marsh | MTEVEIKLNVHEIGVILSALQLLENRDENHIAREYGSVPALYGKLSLLMDQM |
| Ga0181591_111025141 | 3300018424 | Salt Marsh | MTNTDVNLNVHEIGIILSALQLLHNSDENRIAREYGSAQALYDKLSEIMDI |
| Ga0181359_10538251 | 3300019784 | Freshwater Lake | MTEATVQLNVHEIGVILSALQELNLREENRIAREF |
| Ga0194113_104301891 | 3300020074 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQW |
| Ga0194111_101586521 | 3300020083 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKFYSQWERMDT |
| Ga0194111_106182683 | 3300020083 | Freshwater Lake | MAMTEVTMNLNVHEIGVILSALQELNLREENRIAREYG |
| Ga0194112_105573523 | 3300020109 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWERMD |
| Ga0194112_107824983 | 3300020109 | Freshwater Lake | MTEVTINLNVHEIGVILSALQELNLRDEHRIARDY |
| Ga0194112_110493421 | 3300020109 | Freshwater Lake | MNTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWERMD |
| Ga0194115_102698351 | 3300020183 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKFYSQWE |
| Ga0194115_104522232 | 3300020183 | Freshwater Lake | MKLSSEITTNLNVHELGVILSALQLLTNRDENRIAREYGSAPALYNKLYSVWEQ |
| Ga0194124_103663641 | 3300020196 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWERMDT |
| Ga0194124_103753301 | 3300020196 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWE |
| Ga0194128_104113271 | 3300020197 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVP |
| Ga0194125_100791838 | 3300020222 | Freshwater Lake | MTEVTINLNVHEIGVILSALQELNLRDEHRIAREYGSVPALYN |
| Ga0194125_103833761 | 3300020222 | Freshwater Lake | MTEVAMNLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKFY |
| Ga0208050_10137481 | 3300020498 | Freshwater | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREYGSVPALYNKLYTLYE |
| Ga0208599_10248035 | 3300020554 | Freshwater | MNMTETQVNLNVHEIGIILSALQNLENIDEIHIARDYGSVSALYNKLYSVMER |
| Ga0194129_104555901 | 3300020578 | Freshwater Lake | MAMTEVTINLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKLYSQWE |
| Ga0194126_105949321 | 3300020603 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLREENRIARE |
| Ga0194133_101536396 | 3300021091 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNK |
| Ga0194133_102640155 | 3300021091 | Freshwater Lake | MTEVTINLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKFYSQWEQMD |
| Ga0194122_103164051 | 3300021092 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLREEHRIAREYGSVPALYNKFY |
| Ga0194122_103445483 | 3300021092 | Freshwater Lake | MNTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWE |
| Ga0194122_105339861 | 3300021092 | Freshwater Lake | MTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQ |
| Ga0194130_102611555 | 3300021376 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLRDENRIAREYGSVPALYNKL |
| Ga0194130_104420141 | 3300021376 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKFYSQWE |
| Ga0194117_104644312 | 3300021424 | Freshwater Lake | MTMTEVTMNLNVHEIGVILSALQELNLCEEHRIAREYGSVPALYNKLY |
| Ga0213866_101742816 | 3300021425 | Seawater | MTDVNVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEALYNKLNTIWQT |
| Ga0222714_101027786 | 3300021961 | Estuarine Water | MTETNVNLNVHEIGVILSALQNLSNSDENLIAREYGSAPALYNKLY |
| Ga0222714_101675955 | 3300021961 | Estuarine Water | MKTDINVNLNVHEIGVILSALQLLEHTDENRIAKEYGSTNALY |
| Ga0222714_102004831 | 3300021961 | Estuarine Water | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREY |
| Ga0222713_103924474 | 3300021962 | Estuarine Water | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREYGSVPALYNKLYTLYERMD |
| Ga0222712_103000265 | 3300021963 | Estuarine Water | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREYGSVP |
| Ga0212028_11134121 | 3300022071 | Aqueous | MTETQVNLNVHEIGVILSALQLLNNSDEIHIAREYGSSQALYHKLSTIM |
| Ga0212031_10192611 | 3300022176 | Aqueous | MMTETTVNLNVHEIGIILSALQNLENIDEIHIARDYGSVPALYNK |
| Ga0196899_11403011 | 3300022187 | Aqueous | MTETSMNLNVHEIGILLTALQQLDGRDEYLIAREYGSVSALYHKLHTI |
| Ga0196901_10586881 | 3300022200 | Aqueous | MTDANINLNVHEIGVILSALQLLQHRDENLIAKEYGSTAALYERL |
| Ga0255770_102419591 | 3300022937 | Salt Marsh | MTDANVNLNVHEIGIILSALQLLQHRDENLIAREY |
| Ga0255764_102179761 | 3300023081 | Salt Marsh | MTDANVNLNVHEIGIILSALQLLQHRDENLIAKEYGSTEALYSKLNTI |
| Ga0255760_103989563 | 3300023115 | Salt Marsh | MTETQVNLNVHEIGVILSALQLLTSRDENQIAKEYGSASTLHNRLR |
| Ga0255169_10831592 | 3300024356 | Freshwater | MTETQVNLNVHEIGIILSALQNLENIDEIHIARDYGSAPALY |
| Ga0255223_10707392 | 3300024480 | Freshwater | MTETTLQLNVHEIGVILSALQTLDLRDEYQIAREYGSVPALYNKLYTVFE |
| Ga0255224_10596511 | 3300024483 | Freshwater | MTETTLQLNVHEIGVILSALQTLDLRDEYQIAREYGSVPALYNKLY |
| Ga0255229_10432331 | 3300024848 | Freshwater | MTETTLQLNVHEIGVILSALQTLDLRDEYQIAREYGSVPALYNKL |
| Ga0208161_10322475 | 3300025646 | Aqueous | MMTETTVNLNVHEIGIILSALQNLENIDEIHIARDYGSVPALYNKLYT |
| Ga0208161_11353121 | 3300025646 | Aqueous | MTEISVNLNVHEVGVILSALQLLENVDENRIAREYGSAQ |
| Ga0208160_11339013 | 3300025647 | Aqueous | VTETEIKLNVHEVGVILSALQLLSNRDENLIAKDY |
| Ga0208795_11091341 | 3300025655 | Aqueous | MKDVDVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAALYE |
| Ga0208162_11959431 | 3300025674 | Aqueous | MTETEVRLNVHEIGVILSALQLLENRDEHQIAREYGSAQAL |
| Ga0208019_12041521 | 3300025687 | Aqueous | MKDVDVNLNVHEIGVILSALQLLQHRDENLIAREYGST |
| Ga0208427_10677037 | 3300025771 | Aqueous | MTETEISLNVHEIGVLLSALQLVDGRDEHLIAREYGSVPTLYSKLYTIWEQ |
| Ga0208644_12271904 | 3300025889 | Aqueous | MSETQVNLNVHEIGIILSALQNVELADEMHIAKDYGSVPALYNKLYSLW |
| Ga0208644_12375061 | 3300025889 | Aqueous | MTETEVKLNVHELGVILSALQLLENTDENRIVREY |
| Ga0255078_10930621 | 3300027156 | Freshwater | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREYGSVPAL |
| Ga0209972_102410304 | 3300027793 | Freshwater Lake | MTETQVNLNVHELGVILSALQELNLREENRIAREYGSVPALYNKLYS |
| Ga0209536_1002197041 | 3300027917 | Marine Sediment | MKDVDVNLNVHEIGVILSALQLLQHRDENLIAKEY |
| Ga0209536_1021514781 | 3300027917 | Marine Sediment | MTDVNVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEAL |
| Ga0209536_1032477251 | 3300027917 | Marine Sediment | MTDANVNLNVHEIGIILSALQLLQHRDENLIAREYGSTEALYNKLNNIW |
| Ga0119944_10199285 | 3300029930 | Aquatic | MTEATVQLNVHEIGVILSALQELNLREENRIAREYGSVPA |
| Ga0119945_10123125 | 3300029933 | Aquatic | MTETTVQLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKL |
| Ga0119945_10266473 | 3300029933 | Aquatic | MKDINVNLNVHEIGVILSALQELNLREENRIAREYGSVPA |
| Ga0307375_103298201 | 3300031669 | Soil | MTDANVNLNVHEIGVILSALQLLQHRDENLIAREYGSTAALYERLHS |
| Ga0315906_102257581 | 3300032050 | Freshwater | MTEANVNLNVHEVGVILSALQLLNLRDENQIAREYGS |
| Ga0335028_0063774_3_167 | 3300034071 | Freshwater | MTMTEATVQLNVHEIGVILSALQELNLREENRIAREYGSVPALYNKLYSYWEQMD |
| Ga0335053_0272760_2_106 | 3300034118 | Freshwater | MTETQVNLNVHEIGIILSALQEVNTQEENRIAREY |
| ⦗Top⦘ |