NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079565

Metagenome / Metatranscriptome Family F079565

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079565
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 163 residues
Representative Sequence CDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVVSGSVVQGPEPAECSSSVSV
Number of Associated Samples 93
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.65 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(40.870 % of family members)
Environment Ontology (ENVO) Unclassified
(72.174 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.391 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.10%    β-sheet: 34.97%    Coil/Unstructured: 57.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002154|JGI24538J26636_10127929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus605Open in IMG/M
3300002692|Ga0005226J37279_1016058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus600Open in IMG/M
3300004642|Ga0066612_1289908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus604Open in IMG/M
3300008832|Ga0103951_10426290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus709Open in IMG/M
3300008931|Ga0103734_1077648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus509Open in IMG/M
3300008933|Ga0103736_1037162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus637Open in IMG/M
3300008934|Ga0103737_1031504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus677Open in IMG/M
3300008936|Ga0103739_1014399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus982Open in IMG/M
3300009028|Ga0103708_100198958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus581Open in IMG/M
3300009214|Ga0103830_1017499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus638Open in IMG/M
3300009269|Ga0103876_1028043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus717Open in IMG/M
3300009269|Ga0103876_1073620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus518Open in IMG/M
3300009390|Ga0103831_1020515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus541Open in IMG/M
3300009599|Ga0115103_1649720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus727Open in IMG/M
3300009677|Ga0115104_10130101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus579Open in IMG/M
3300009747|Ga0123363_1012662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus539Open in IMG/M
3300009750|Ga0123368_1131747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus528Open in IMG/M
3300010981|Ga0138316_10295100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus528Open in IMG/M
3300010981|Ga0138316_10579291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus532Open in IMG/M
3300010987|Ga0138324_10541095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus579Open in IMG/M
3300012523|Ga0129350_1328236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus527Open in IMG/M
3300018655|Ga0192846_1031441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300018684|Ga0192983_1053651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus553Open in IMG/M
3300018730|Ga0192967_1080799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus527Open in IMG/M
3300018758|Ga0193058_1066381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus571Open in IMG/M
3300018832|Ga0194240_1019627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus627Open in IMG/M
3300018871|Ga0192978_1093335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus545Open in IMG/M
3300018874|Ga0192977_1121046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus509Open in IMG/M
3300018880|Ga0193337_1049047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus550Open in IMG/M
3300018880|Ga0193337_1051015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus542Open in IMG/M
3300018927|Ga0193083_10061262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus566Open in IMG/M
3300018949|Ga0193010_10080207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus567Open in IMG/M
3300018964|Ga0193087_10294733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300018966|Ga0193293_10072093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus632Open in IMG/M
3300018981|Ga0192968_10125321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus675Open in IMG/M
3300018981|Ga0192968_10171347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus554Open in IMG/M
3300018982|Ga0192947_10240870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus584Open in IMG/M
3300018989|Ga0193030_10199333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus659Open in IMG/M
3300018989|Ga0193030_10225265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus617Open in IMG/M
3300019021|Ga0192982_10340184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus537Open in IMG/M
3300019022|Ga0192951_10237662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus678Open in IMG/M
3300019032|Ga0192869_10247584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus770Open in IMG/M
3300019033|Ga0193037_10179345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus710Open in IMG/M
3300019036|Ga0192945_10205251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus632Open in IMG/M
3300019036|Ga0192945_10283155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300019039|Ga0193123_10236727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus717Open in IMG/M
3300019039|Ga0193123_10370678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus561Open in IMG/M
3300019045|Ga0193336_10325522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus687Open in IMG/M
3300019045|Ga0193336_10479886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus594Open in IMG/M
3300019045|Ga0193336_10570516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus553Open in IMG/M
3300019045|Ga0193336_10581163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus549Open in IMG/M
3300019045|Ga0193336_10593136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus544Open in IMG/M
3300019045|Ga0193336_10670201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus515Open in IMG/M
3300019049|Ga0193082_10646719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus596Open in IMG/M
3300019050|Ga0192966_10142816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus847Open in IMG/M
3300019050|Ga0192966_10208699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus698Open in IMG/M
3300019116|Ga0193243_1042321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus631Open in IMG/M
3300019116|Ga0193243_1060110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus525Open in IMG/M
3300019133|Ga0193089_1114917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus622Open in IMG/M
3300019133|Ga0193089_1115471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus620Open in IMG/M
3300019133|Ga0193089_1123792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus591Open in IMG/M
3300019133|Ga0193089_1135221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus555Open in IMG/M
3300019150|Ga0194244_10086506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus574Open in IMG/M
3300019150|Ga0194244_10093054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300019150|Ga0194244_10116953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus517Open in IMG/M
3300021342|Ga0206691_1211944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus705Open in IMG/M
3300021348|Ga0206695_1111079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus723Open in IMG/M
3300021350|Ga0206692_1230105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus558Open in IMG/M
3300021355|Ga0206690_10992617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus635Open in IMG/M
3300021879|Ga0063113_138390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus544Open in IMG/M
3300021894|Ga0063099_1045911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus525Open in IMG/M
3300021894|Ga0063099_1072573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus552Open in IMG/M
3300021902|Ga0063086_1052885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300021913|Ga0063104_1050899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus574Open in IMG/M
3300023704|Ga0228684_1043301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus697Open in IMG/M
3300026418|Ga0247564_1082156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus528Open in IMG/M
3300026420|Ga0247581_1078674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus528Open in IMG/M
3300026421|Ga0247569_1093018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus525Open in IMG/M
3300026423|Ga0247580_1088126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus593Open in IMG/M
3300026495|Ga0247571_1170276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus517Open in IMG/M
3300026500|Ga0247592_1131252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus599Open in IMG/M
3300028095|Ga0247563_1040664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus955Open in IMG/M
3300028106|Ga0247596_1088778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus698Open in IMG/M
3300028110|Ga0247584_1154512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus564Open in IMG/M
3300028134|Ga0256411_1195343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus643Open in IMG/M
3300028330|Ga0247601_1061915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus507Open in IMG/M
3300028334|Ga0247597_1040451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus626Open in IMG/M
3300028338|Ga0247567_1131114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus530Open in IMG/M
3300028575|Ga0304731_10116406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus528Open in IMG/M
3300030653|Ga0307402_10799117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus551Open in IMG/M
3300030653|Ga0307402_10862020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus529Open in IMG/M
3300030671|Ga0307403_10726640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus540Open in IMG/M
3300030699|Ga0307398_10727474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus550Open in IMG/M
3300030702|Ga0307399_10214448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus892Open in IMG/M
3300030724|Ga0308138_1050519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus584Open in IMG/M
3300030856|Ga0073990_11827749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus542Open in IMG/M
3300030951|Ga0073937_11536090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus674Open in IMG/M
3300031056|Ga0138346_10353312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300031445|Ga0073952_12060732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus519Open in IMG/M
3300031522|Ga0307388_11265191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300031550|Ga0307392_1050699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus544Open in IMG/M
3300031579|Ga0308134_1105276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus645Open in IMG/M
3300031710|Ga0307386_10822748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus502Open in IMG/M
3300031717|Ga0307396_10656002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300031729|Ga0307391_10584884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus631Open in IMG/M
3300031734|Ga0307397_10482067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus578Open in IMG/M
3300031738|Ga0307384_10446592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus607Open in IMG/M
3300031739|Ga0307383_10368623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus703Open in IMG/M
3300031739|Ga0307383_10493276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus610Open in IMG/M
3300032127|Ga0315305_1200631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus530Open in IMG/M
3300032463|Ga0314684_10876316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus505Open in IMG/M
3300032492|Ga0314679_10443404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus587Open in IMG/M
3300032517|Ga0314688_10795216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus504Open in IMG/M
3300032728|Ga0314696_10618088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus551Open in IMG/M
3300032746|Ga0314701_10512723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus539Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine40.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.43%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.17%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.35%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.48%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica3.48%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.74%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.74%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.87%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300002692Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004642Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009214Microbial communities of water from the North Atlantic ocean - ACM51EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009390Microbial communities of water from the North Atlantic ocean - ACM34EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009750Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026418Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 12R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026421Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028095Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028338Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032127Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24538J26636_1012792913300002154MarineWSNAYREGAQTGADWCMELDWIESNGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGDWNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVSV*
Ga0005226J37279_101605813300002692MarinePIFSGSYFSKEADYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYNNAKFHMRIEYDQSGSWTITRDGQVLGGWNPAPDNRAWSYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLIVSGSVVQGPEPTKCSSEVMV*
Ga0066612_128990813300004642MarinePASFSGSYFNKTLDYCDGAATGSDWCMELDWMESNGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDFSGAWTITRDGQVLGGWNPSPDSRAWNFIKQMHEERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVVSGSVVQGPEPTECSSSVLV*
Ga0103951_1042629013300008832MarineSNVDTGVNANIYTIAPASFSGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGATTIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDASGAWTVTRDGNVLSGYQPDPSGAWDYIKQMHETRGQVLYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVISGSVVQGPEPAECSSSFLV*
Ga0103734_107764813300008931Ice Edge, Mcmurdo Sound, AntarcticaIEANGHCGGAATIHTIEGPGSDGCTAWGCRVESHYGQSKFHMRIEYDQDGICTITRDGEKLTEYNPAPDNRAWDYIKSVHEERGAVIYSSEWIGWVPVADCGTDDGDLYGSSFSISNLVVSGSVVKGPEPTKCQNSVQV*
Ga0103736_103716213300008933Ice Edge, Mcmurdo Sound, AntarcticaFSKPKDYCDGAQTGSDWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVLV*
Ga0103737_103150413300008934Ice Edge, Mcmurdo Sound, AntarcticaSPASFSGSYFNKTFDYCDGAAGGSDWCMELDWIEANGHCGGAATIHTIEGPGEDGCTAWGCRVNEHYGNSKFHMKVEHDASGAWKITRDGQVLGGWDPAPDNRAWDYIKQMHQERGVVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLKVYGSVVQGPEPTECSGSMLV*
Ga0103739_101439933300008936Ice Edge, Mcmurdo Sound, AntarcticaLFDGGVNANIYTISPVFSGSEFSKPKDYCDGAQTGSDWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVLV*
Ga0103708_10019895813300009028Ocean WaterIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNAKFHMKIEHDPSGAWTITRDGQVLSGWNPAPDNRAWDYIKQMHQERGSVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSGSVVQGPEPTECASSVLV*
Ga0103830_101749913300009214River WaterNANIYTISPASFAGPFFNKTLDYCDGAATGSAWCMELDWIEANGHCGGAATIHTIEGPGSDGCTAWGCRVSEHYSNSKFHMKIEHDTNGQWTITRDGNVLSGFSPDPSGAWDYIKQMHQERGTVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGAVVQGPEPTECTSTVSV*
Ga0103876_102804313300009269Surface Ocean WaterDIDLSNVDHGVNANIYTVSPASFAGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQERGSVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECSSSVSV*
Ga0103876_107362013300009269Surface Ocean WaterGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEYDQSGSWTITRDGQQLGGWNPAPDNRAWDYIKQMHQERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPAECSSSVLV*
Ga0103831_102051513300009390River WaterGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITSDGQVLCGWNPAPDNRAWDYIKQMHQQRGSVIYSSEWTGWVPVDDCGTDEGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV*
Ga0115103_164972013300009599MarineLSNVDSGVNANIYTVSPIFSGSYFSKEADYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYNNAKFHMRIEYDQSGSWTITRDGQVLGGWNPAPDNRAWSYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLIVSGSVVQGPEPTKCSSEVMV*
Ga0115104_1013010113300009677MarineDIDLSNVDNGVNANIYTISPASFSGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIQQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECASSVLV*
Ga0123363_101266213300009747MarineGVNANIYTISPASFTGPFFNKTLDYCDGAATGTDWCMELDWIEANGHCGGAATIHTIEGPGSDGCTAWGCRVSEHYSNSKFHMKIEHDTDGQWTITRDGNVLSGFSPDPSGAWDYIKQMHQERGTVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECASTVSV
Ga0123368_113174713300009750MarineFNKTLDYCDGAATGSDWCMELDWIEANGHCGGATTIHTIEGPGSDGCTAWGCRVSEHYSNSKFHMKIEHDGNGAWTITRDGNVLSGFNPDPSGAWDYIKQMHQERGTVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECASTVSV*
Ga0138316_1029510013300010981MarineEDWCMELDYIEANGHCGGATTIHTVEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPTGAWDYIKQMHQERGQVLYSSEWVGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTECSSSVSV*
Ga0138316_1057929113300010981MarineWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQERGSVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSGSVVQGPEPTECSSSVLV*
Ga0138324_1054109513300010987MarineMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQERGSVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSGSVVQGPEPTECSSSVLV*
Ga0129350_132823613300012523AqueousISPTFSGSEFNKEADYCDGAATGADWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEYDASGAWTITRDGQVLGGWNPAPDNRAWDYMKQMFTERGTVIYSSEWTGWVPVDDCGTTPGDLYGSSFSVSNLVVSASVVQGPEPTKCQSEALV*
Ga0192846_103144113300018655MarineASFSGSFFNKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGSDGCTAWGCRVSEHYGNAKFHMRIEHDESGAWTITRDGQRLSGWNPDPSGAWSYIKQMHQERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVVSGSVVQGPEPAECSSSVLV
Ga0192983_105365113300018684MarineGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHAANGAWTITRDGNVLSGFSPDPSGAWDYIKQMHEERGSVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVITGSVVQGPVPTKCSSVVSV
Ga0192967_108079913300018730MarineGCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDESGAWTITRDGQVLGGWSPAPDNSAWDIIKQMHEERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVISGSVVQGPEPTECSNSVLV
Ga0193058_106638113300018758MarineTWGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYNNAKFHMRIEYDQSGSWTITRDGQVLGGWNPAPDNRAWSYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLIVSGSVVQGPEPTKCSSEVMV
Ga0194240_101962713300018832MarineHGCDGAATGDEWCMELDWIEVNGHCGGAATIHTIEGPGNDGCTAWGCRITEHYGNSRFHMKVEHDANGAWTITRDGQVMSGWNPDPSGAWAYIKQMMQERGNVIYSSEWTGWVPADDCGTDAGDLYGSSFSISNLKIYGSVVQGPEPTECSGSMLV
Ga0192978_109333513300018871MarineDWCMELDWIESNGHCGGATTIHTIEGPGNDGCTAWGCRVSEHYGTSKFHMKIEHAASGAWTVTRDGNVLSGYNPDPSGSWDYIKQMHEERGQVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECSSVVSV
Ga0192977_112104613300018874MarineIDLSNVDGGVNANIYTISPVFSGSEFSKPKDYCDGAQTGSDWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVS
Ga0193337_104904713300018880MarineTISPVFSGSEFNKENDYCDGAATGADWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIQYDQSGAWTITRDGQVLGGWNPAPDNRAWDYMKRMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTVSNLVVSGSVVQGPEPTKCQSEVVV
Ga0193337_105101513300018880MarineTISPVFSGSEFNKENDYCDGAATGADWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIQYDQSGAWTITRDGQVLGGWNPAPDNRAWDYMKRMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTVSNLVVSGSVVQGPEPTKCQNEVVV
Ga0193083_1006126213300018927MarineNIYTISPTFSGSEFSKEADYCDGAATGDDWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGQVLDGWNPAPDNRAWDYMKQMMEERGTVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSASVVQGPEPSKCQSEALV
Ga0193010_1008020713300018949MarineDLSNVDHGVNANIYTISPASFSGSFFNKTLDYCDGAATGSDWCMELDWIEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECSSSVSV
Ga0193087_1029473313300018964MarineTWGATTIHTKEGPGNEGCTAWGCRVSEHYSNSKFHMKIEHDTNGVWTVTRDGQVLSDYQPDPSGAWDYIKQMHEERGQVLYSSEWVGWVPVDDCGTDEGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0193293_1007209313300018966MarineANIYTIAPPSFSGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVEEHYGNSKFHMRIEHDTSGAWTITRDGNVLSGYSPTPDSRAWDYIKQMHSERGQVIYSSEWTGWVPVDSCGTTAGDLYGSSFSISNLVVSGSVVQGPEPAECSSSVLV
Ga0192968_1012532113300018981MarineSPASFSGSFFNKTLDYCDGAATGSDWCMELDWIESNGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHAANGAWTITRDGNVLSGFSPDPSGAWDYIKQMHEERGSVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVITGSVVQGPVPTKCSSVVSV
Ga0192968_1017134713300018981MarineDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVLV
Ga0192947_1024087013300018982MarineANIYTVSPASFSGSFFNKTLDYCDGAATGSDWCMELDWIESNGHCGGASTIHTIEGPGSDGCTAWGCRVSEHYSNSKFHMKIEHDANGAWTITRDGNVLSGFSPDPSGAWDYVKQMHQERGTVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTKCSSVVSV
Ga0193030_1019933313300018989MarineDIDLSNVDTGVNANIYSIAPASFSGSFFNRTLDYCDGAATGDDWCMELDYIEANGNCGGATTIHTKEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPSGAWDYIKQMHEERGQVLYSSEWTGWVPVDDCGTDEGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0193030_1022526513300018989MarineYCDGAATGEDWCMELDYIEANGHCGGATTIHTVEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPTGAWDYIKQMHQERGQVLYSSEWVGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTECSGSVSV
Ga0192982_1034018413300019021MarineELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVLV
Ga0192951_1023766213300019022MarineHGVNANIYTVSPASFSGSFFNKTLDYCDGAATGSDWCMELDWIESNGHCGGASTIHTIEGPGSDGCTAWGCRVSEHYSNAKFHMKIEHDANGAWTITRDGNVLSGFSPDPSGAWDYVKQMHQERGTVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTKCSSVVSV
Ga0192869_1024758423300019032MarineMPSAHRSWLDDSWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGGWNPAPDNRAWDYMKRMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTVSNLVVSGSVVQGPEPTKCQSEVVV
Ga0193037_1017934513300019033MarineWCMELDWIEANGHCGGATTIHTIEGPGNDGCTAWGCRVEEHYANSKFHMRIEHDETGKWTVTRDGNVLSGYNPDPSGAWDYIKQMHQERGQVIYSSEWVGWVPVDDCGGGGDLYSSSFSISNMVISGSVVQGPEPHECQEVAV
Ga0192945_1020525123300019036MarineMGGDDWCMEMDWIEANGHCGGAATIHTVEGPGNDGCTAWGCRAESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYNPVPDNRAWDYVKSVHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSSVSISNLVVSGSVVKGPEPTKCQNSVQI
Ga0192945_1028315513300019036MarineEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVVSGSVVQGPEPAECSSSVLV
Ga0193123_1023672713300019039MarineDLSNVDTGVNANIYSIAPATFAGSFFNRTLDYCDGAATGEDWCMELDYIEANGHCGGATTIHTKEGPGNEGCTAWGCRVSEHYSNSKFHMKIEHDTNGVWTVTRDGQVLSDYQPDPSGAWDYIKQMHEERGQVLYSSEWVGWVPVDDCGTDEGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0193123_1037067813300019039MarineGDDWCMELDWIEANGHCGGATTIHTIEGPGSDGCTAWGCRVSEHYSNSKFHMRIEHDSNGVWTVTRDGNVLSGFSPDPSGAWDYIKQMHQERGSVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTKCSTAVSV
Ga0193336_1032552213300019045MarineNANIYTIAPASFAGPYFNKTQDYCDGAATGADWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSRFHMRIEHDENGAWTITRDGNVLSGYQPDPSGAWAYIKQMHQERGQVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLRIAGSVVQGPEPTECSASVSV
Ga0193336_1047988613300019045MarineSGSEFSKEDDYCDGAASGSDWCMELDWIEANGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEYDQSGAWTITRDGNTLGGWSPAPDSRAWNYMQKMHQERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLVVSGSVVQGPEPTKCQSDAVAV
Ga0193336_1057051613300019045MarineCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVVSGSVVQGPEPAECSSSVSV
Ga0193336_1058116323300019045MarineHGGAATGSDWCMELDWIEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIQQMHQQRGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPTECASSVLV
Ga0193336_1059313613300019045MarineILSGSEFSQEADYCDGASTGDHWCMELDLIEANGQCGGDAAIHTIEGPGDGCTAWGCRVEEHYNNTKFHMKVEYDASGAWTITRDGQVLDNWSPAPDGSTWDYIKQMHEERGTVIFSSQWVGWVPVYDCGTSGGDLSGSSLSISNLVLSASVVQGPEPAKCQNEASV
Ga0193336_1067020113300019045MarineFNKTNDYCDGAATGAEWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRISEHYGNSKFHMKVEHDESGAWTITRDGNVMSGWNPDPSGAWNYIKQMHQERGQVIYSSEWTGWVPVDDCGTDAGDLYGSSFSITNLKIVGSVVQGPEPAECSSSMLV
Ga0193082_1064671913300019049MarineTFSGSEFSKEADYCDGAATGADWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGQVLGGWNPAPDNRAWDYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSASVVQGPEPTKCQSEALV
Ga0192966_1014281613300019050MarineAPNSCNGEGEYCSASANNCGSCGGEWCGGDSPTPSPPPADIDLSNVDNGVNANIYTISPASFSKSYFDKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGSDGCTGWGCRVNEHYSNSKFHMKIEYDQSGSWTITRDGQVLGDWNPAPDNRAWDYIKKMHEERGSVIYSSEWTGWVPVEDCGTDAGDLYGSSFSISNLKISGSVVQGPEPAECSGSMLV
Ga0192966_1020869913300019050MarineSNVDTGVNANIYTVSPAKFQLPYFNRTLDYCDGAATGADWCMELDWIEANGHCGGAATIHTIEGPGEDGCTAWGCRVNEHYGNSKFHMKVEHDASGAWKITRDGQVLGGWDPAPDNRAWDYIKQMHQERGVVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLKVYGSVVQGPEPTECSGSMLV
Ga0193243_104232113300019116MarineSFSGSFFNKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNAKFHMRIEHDESGAWTITRDGQRLSGWNPDPSGAWSYIKQMHQERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVVSGSVVQGPEPAECSSSVLV
Ga0193243_106011013300019116MarineYTISPTFSGSEFSKEADYCDGAATGDDWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGQVLDGWNPAPDNRAWDYMKQMMEERGTVIYSSEWTGWVPVDDCGTDEGDLYGSSFSISNLVVSASVVQGPEPAKCQSEALV
Ga0193089_111491713300019133MarineYFNRSLDYCDGAASGSNWCIEQDFLESNGHCGGATTMHTIEGPGSDGCTAWGCQNSYHYDSTKFHMRVEYDQNGQWTVTRDGQVLSDFSPVPDSRAWDLVKQNHEERGAVLYSSEWVGWVPVSDCGTSSGDLYGSSFTVSNLVVSGVVVQGPEPTMCGSSLNV
Ga0193089_111547113300019133MarineHGIDLSNVDSGVNANIYTISPTFSGSEFSKASDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSTFHMKIEYDQNGAWTITRDGQTLDGWSPAPDNRAWDYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFSVSNLVVSGSVVQGPEPTKCQSEVVV
Ga0193089_112379213300019133MarineMELDWIESNGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRVDHDATGAWKITRDGQVLGGWNPAPDNRAWDYIKQMHQERGVVLYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLKVYGSVVQGPEPTECSGSMLV
Ga0193089_113522113300019133MarineCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNAKFHMRIEHDQSGSWTITRDGQVLGGWNPAPDSRAWSTIKQMFEERGAVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLIVSGSVVQGPEPTKCSSDVMV
Ga0194244_1008650613300019150MarineGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNAKFHMRIEHDESGAWTITRDGQRLSGWNPDPSGAWSYIKQMHQERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFTISNLVVSGSVVQGPEPAECSSSVLV
Ga0194244_1009305413300019150MarineTWGAATGEDWCMELDYIEANGHCGGATTIHTKEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPSGAWDYIKQMHQERGQVLYSSEWVGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTECSSSVSV
Ga0194244_1011695323300019150MarineANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDESGAWKITRDGQVLGGWNPAPDNRAWDYVKQMHQERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPAECSSSVLV
Ga0206691_121194413300021342SeawaterIAPASFSGSYFNRTLDYCDGAATGSDWCMELDYIEANGHCGGATTIHTIEGPGSDGCTAWGCAVSGHYTNSKFHMRIEHDASGAWTVTRDGQVLSGYQPDPSGAWDYIKQMHQERGQVLYSSEWVGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPAECSSSVWV
Ga0206695_111107913300021348SeawaterKVDNGVNANIYTISPASFSGSYFNKTLDYCDGAATGADWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDASGAWTITRDGQVLGGWNPAPDNRAWDYIKQMHQERGSVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSGSVVQGPEPAECSSSVLV
Ga0206692_123010513300021350SeawaterNKENDYCDGAQTGADWCMELDWIESNGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQNGAWTITRDGQVLGDWNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVSISNLVVSGSVVQGPEPTKCQSEVSV
Ga0206690_1099261713300021355SeawaterGVVLQQDFGLLRWRCEWLRLCMELDWIEANGHCGGATTIHTVEGPGNDGCTAWGCRVSEHYANSKFHMRIEHDETGKWTVTRDGNVLSGYAPDPSGAWDYIKQMHQERGQVIYSSEWVGWVPVDDCGGGGDLYSSSFSISNLVISGSVVQGPEPHECQEVAV
Ga0063113_13839013300021879MarineSNVDNGVNANIYTISPTFSGSEFSKEADYCDGAATGADWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGQVLGGWNPAPDNRAWDYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFSISNLVVSASVVQGPEPTKCQS
Ga0063099_104591113300021894MarineNANVYTISPESFSLDHFNKTLDYCDGAATGSDWCMEMDWIEANGHCAAATTVHTKEGPGNDGCTAWGCRTTYHFNGKSKFHMKIEYDQTGQWTVSKDGEVFTDYSPVPDGSAWDYVKSTHESRGAVIYGSEWIGWVPVDDCGTTPGNLYSSSYSISNLVISGSVVQGPVPTKCFH
Ga0063099_107257313300021894MarineSFSMPYFNKTLDYCDGAASGDDFCMEMDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVESHYSNSKFHMRIEYDENGAWTITRDGEVLSDYNPVPDNRAWDYVKSMHEERGAVIYSSEWIGWVPVADCGTDAGDLYGSGFSISNLVVSGSVVKGPEPTKCSSSVQV
Ga0063086_105288513300021902MarineNKENDYCDGAQTGADWCMELDWIESNGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGDWNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVSV
Ga0063104_105089913300021913MarineIYTISPASFSGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDLSGAWTITRDGQVLGGWNPAPDSRAWNFIKQMHEERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVVSGSVVQGPEPTECSSSVLV
Ga0228684_104330113300023704SeawaterVDTSNVGGGVNANLYSISPQSFSGDYFNRTLDYCDAQGSGDGWCIEQDWLESNGHCGGATTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDVVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGAALNV
Ga0247564_108215613300026418SeawaterHHLSPVLRPILQQDLGLLRWRCYWSDWCMELDWIEVNGHCGGAATIHTIEGPGNDGCTAWGCRITEHYGNSKFHMKVEHDGNGAWTITRDGQVMSGWNPDPSGAWGYIKQMMQERGTVIYSSEWTGWVPADDCGTDAGDLYGSSFSISNLVVSGSVSQGPEPAECSSSMLV
Ga0247581_107867413300026420SeawaterCMELDYIEANGHCGGATTIHTVEGPGNTGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSEYQPDPSGAWDYIKQMHEERGQVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0247569_109301813300026421SeawaterLESNGHCGGATTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDVVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGAALNV
Ga0247580_108812613300026423SeawaterVDYCDGAATGDDWCMEADWTEVNGHCAGASTLHTVEGPGSDGCTAWGCRTSYHFNGKSSFHMKVEYDETGQWSITKDGEALDSLSPAPDSTAWDYIKTMHETRGAVIYSSEWTGWVPVDDCGTSPGDLYGSSFSVSNLVISGSVVQGPVPMKCGAATLV
Ga0247571_117027613300026495SeawaterTTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDVVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGAALNV
Ga0247592_113125213300026500SeawaterPIFSGSEFVKDNDYCDGAQTGSDFCMELDWIEANGHCGGAATIHTIEGPGTDGCTAWGCRVSEHYGNAKFHMRIEHDQSGSWTITRDGQVLGGWNPAPDDRAWNTIKQMFEERGAVIYSSEWTGWVPVDDCGTNPGDLYGSSFTISNLIVSGSVVQGPEPTKCSTEVMV
Ga0247563_104066413300028095SeawaterMELDYIEANGHCGGATTIHTVEGPGNTGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSEYQPDPSGAWDYIKQMHEERGQVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0247596_108877813300028106SeawaterDTSNVGGGVNANLYSISPQSFSGAYFNRTLDYCDAQGSGDGWCIEQDWLESNGHCGGATTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDMVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGAALNV
Ga0247584_115451213300028110SeawaterLYSISPQSFSGDYFNRTLDYCDAQGSGDGWCIEQDWLESNGHCGGATTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDVVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGAALNV
Ga0256411_119534313300028134SeawaterHSFACQLCQDHFNASVDYCDGAATGDDWCMEADWTEVNGHCAGASTLHTVEGPGSDGCTAWGCRTQYHFNGKSSFHMKIDYDQSGQWTISRDGEVLDNLSPAPDDATWEYVKTIHETRGAVIYSSEWVGWVPVDDCGTDAGDLYGSSFEVSNLVISGSVVKGSVPSKCGSAVAV
Ga0247601_106191513300028330SeawaterANIYTVSPASFAQDHFNASVDYCDGAATGDDWCMEADWTEVNGHCAGASTLHTIEGPGSDGCTAWGCRTQYHFNGKSSFHMQIDYDHSGQWTISRDGEVLDNLSPAPDDATWEYVKTIHETRGAVIYSSEWVGWVPVDDCGTDAGDLYGSSFEVSNLVISGSVVKGPV
Ga0247597_104045113300028334SeawaterYFNRTLDYCDAQGSGDGWCIEQDWLESNGHCGGATTLHTIPGPGSDGCTAWGCQDEFHYDNAKFHMRIEYDQAGAWTVTRDGQVLSDFSPVPDSRAFDVVKKNHEERGAVLYSSEWVGWVPVSDCPSTEEDLYGSSFTVSNLVISGSVVQGPEPTVCGVALNV
Ga0247567_113111413300028338SeawaterSNVQTGVNANIYSISPASFSGPHFNKTLDYCDGAASGSDWCMELDYVEANGNCGGATTIHTIEGGGNDGCTAWGCRVSEHYSNSKFHMRIEHNANGVWTVTRDGEVLSGFDPAPDSRAWDYIKQMQEERGSVIYSSEWVGWVPVDDCGGGGDLYSSSFSISNLVISGSVVQGPEPR
Ga0304731_1011640613300028575MarineEDWCMELDYIEANGHCGGATTIHTVEGPGNDGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPTGAWDYIKQMHQERGQVLYSSEWVGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTECSSSVSV
Ga0307402_1079911713300030653MarineGADWCMELDWIEANGKCGGAATIHTIEGPGTDGCTAWGCRQSEHYDRSKFHMKIEYDQSGAWTITRDGKVLSDFNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVEDCGTNPGDLYGSSVTISNLVVSGVVVQGPEPTKCQSEVLV
Ga0307402_1086202013300030653MarineYCDGAASGDDWCMEMDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRAESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYNPVPDNRAWDYIKSVHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSSVSISNLVVSGSVVKGPEPTKCQNSVQV
Ga0307403_1072664013300030671MarineDLSNVDGGVNANIYTISPVFSGSEFSKPKDYCDGAQTGSDWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTK
Ga0307398_1072747413300030699MarineGDDWCMEMDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYNPMPDNRAWDYIKSIHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSSVSISNLVVSGSVVKGPEPTKCQNSVQI
Ga0307399_1021444823300030702MarineMPYFNKTLDYCDGAASGDDWCMEMDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRAESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYNPVPDNRAWDYIKSIHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSSVSISNLVVSGSVVKGPEPTKCQNSVQI
Ga0308138_105051913300030724MarinePYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGASTIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDLSGAWTITRDGQVLGGWNPAPDSQAWNFIKQMHEERGSVIYSSEWIGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVQGPEPAECSSSVLV
Ga0073990_1182774913300030856MarineTGSFFNRTLDYCDGAATGEDWCMELDYIEANGHCGGATTIHTKEGPGNEGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGEVLSDFSPDPSGAWDYIKQMHEERGQVLYSSEWVGWVPVDDCGTDEGDLYGSSFSISNLKISGSVVQGPEPTECPSSVSV
Ga0073937_1153609013300030951MarineDLSNVDTGVNANIYSIAPSSFSGSFFNRTLDYCDGAATGEDWCMELDYIEANGHCGGATTIHTKEGPGNEGCTAWGCRVSEHYSNSKFHMKIEHDANGVWTVTRDGQVLSDYQPDPSGAWDYIKQMHEERGQVLYSSEWVGWVPVDDCGTDEGDLYGSSFSISNLKISASVVQGPEPTECPSSVSV
Ga0138346_1035331213300031056MarineGWCIEQDFLESNGHCGGATTLHTIPGPGSDGCTAWGCQETFHYNNAKFHMRIEYDQSGQWTVTRDGEVLSDFNPTPDSSAFDLVKKNHEERGAVLYSSEWVGWVPVDDCGGSEDLYGSSFTVSNLVVSGSVVQGPEPTVCGAAVNV
Ga0073952_1206073213300031445MarineDIDLSNVDNGVNANIYTISPTFSGAEFSKEADYCDGAATGADWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGQVLGGWNPAPDNRAWDYMKQMFEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSFSVSNLVVSASV
Ga0307388_1126519113300031522MarinePVFSGSEFNKENDYCDGAQIGADWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDDRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSDV
Ga0307392_105069913300031550MarineWIEANGHCGGAATIHTIEGPGSDGCTAWGCRVESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYNPAPDNRAWDYIKSVHEERGAVIYSSEWIGWVPVADCGTDDGDLYGSSFSISNLVVSGSVVQGPEPTKCPVDMQV
Ga0308134_110527613300031579MarineIDLSNVDNGVNANIYTISPASFSGSYFNKTLDYCDGAATGSDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYSNSKFHMRIEHDLSGAWTITRDGQVLGGWNPSPDSRAWNFIKQMHEERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVVSGSVVQGPEPTECSSSVLV
Ga0307386_1082274813300031710MarineENDYCDGAQTGADWCMELDWIEANGKCGGAATIHTIEGPGSDGCTAWGCRQSEHYDRSKFHMKIEYDQNGAWTITRDGNVLSDFNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVSGVVVQGPEPTKCQSEVLV
Ga0307396_1065600213300031717MarineIEGPGTDGCTAWGCRQSEHYDRSKFHMKIEYDQSGAWTITRDGKVLSDFNPAPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVEDCGTNPGDLYGSSVTISNLVVSGVVVQGPEPTKCQSEVLV
Ga0307391_1058488413300031729MarineSPVFSGSEFSKPKDYCDGAQTGSDWCMELDWIEANGKCGGAATIHTIEGPGEDGCTAWGCRVSEHYGNSKFHMKIEHDESGAWTITRDGQVLGDWNPAPDGRAWSYIKQMMEERGNVIYSSEWTGWVPVDDCGTTPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVLV
Ga0307397_1048206713300031734MarineSMPYFNKTLDYCDGAASGDDWCMEVDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVESHYGQSKFHMRIEYDQDGIWTITRDGEKLTEYSPVPDNRAWDFIKSVHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSSVSISNLVVSGSVVKGPEPTKCQNSVQI
Ga0307384_1044659223300031738MarineANIYTISPTFSGSEFSKEADYCDGAATGADWCMELDWLEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMKIEYDASGAWTITRDGEVLGGWNPAPDNRAWAYMKQMMEERGTVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSASVVQGPEPTKCQSEALV
Ga0307383_1036862313300031739MarineDNGVNANIYTVSPASFSGSYFNKTLDYCDGAATGPDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSRFHMRIEHDENGAWTITRDGNVLSGYQPDPSGAWDYIKQMHQQRGQVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVIAGSVVQGPEPTECSSSVS
Ga0307383_1049327613300031739MarineDYCDGAATGSDWCMELDWIESNGHCGGASTIHTIEGPGSDGCTAWGCRVSEHYSNAKFHMKIEHDANGAWTITRDGNVLSGFSPDPSGAWDYVKQMHQERGTVLYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVISGSVVQGPEPTKCSSVVSV
Ga0315305_120063113300032127MarineCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVSEHYGNSKFHMRIEHDLSGAWTITRDGQVLGGWNPSPDSRAWSFIKQMHEERGSVIYSSEWTGWVPVDDCGTDAGDLYGSSFSVSNLVISGSVVQGPEPTECSSSVLV
Ga0314684_1087631613300032463SeawaterSNGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGDWNPSPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVSV
Ga0314679_1044340413300032492SeawaterNVDGGVNANIYTVSPASFSMPYFNKTLDYCDGAASGDDWCMELDWIEANGHCGGAATIHTIEGPGNDGCTAWGCRVESHYSNSKFHMRIEYDENGAWTITRDGEELSEYNPVPDNRAWDYVKSMHEERGAVIYSSEWIGWVPVDDCGTDAGDLYGSGFSISNLVVSGSVVKGPEPTKCSSSVQV
Ga0314688_1079521613300032517SeawaterATGDDWCMELDWIEANGKCGGAATIHTIEGPGSDGCTAWGCRVESHYGQSKFHMRIEYDENGSWTITRDGEKLSAWNPAPDNRAWDYIKSMHEERGAVIYSSEWTGWVPVDDCGTDAGDLYGSSFSISNLVVSGSVVKGPEPTRCQSNLLV
Ga0314696_1061808813300032728SeawaterGVNANIYTISPVFSGSEFNKENDYCDGAQTGADWCMELDWIESNGKCGGAATIHTIEGLGNDGCTSWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGDWNPVPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVPGSVVQGPEPTKCQSEVSV
Ga0314701_1051272313300032746SeawaterADWCMELDWIESNGKCGGAATIHTIEGPGNDGCTAWGCRVSEHYGRSKFHMKIEYDQSGAWTITRDGQVLGDWNPSPDGRAWNYMKQMHEERGTVIYSSEWTGWVPVDDCGTNPGDLYGSSVTISNLVVSGSVVQGPEPTKCQSEVSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.