| Basic Information | |
|---|---|
| Family ID | F079549 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAAR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.91 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.17 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.696 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.304 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.261 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.13% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF03934 | T2SSK | 80.87 |
| PF11612 | T2SSJ | 9.57 |
| PF12019 | GspH | 1.74 |
| PF01694 | Rhomboid | 0.87 |
| PF12833 | HTH_18 | 0.87 |
| PF08334 | T2SSG | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 80.87 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.17 % |
| Unclassified | root | N/A | 7.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17056177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1073 | Open in IMG/M |
| 2228664022|INPgaii200_c1014126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1074 | Open in IMG/M |
| 3300005336|Ga0070680_101200064 | Not Available | 656 | Open in IMG/M |
| 3300005365|Ga0070688_100649268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 812 | Open in IMG/M |
| 3300005535|Ga0070684_100621389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1005 | Open in IMG/M |
| 3300005542|Ga0070732_10657957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 637 | Open in IMG/M |
| 3300005614|Ga0068856_100770888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 982 | Open in IMG/M |
| 3300006028|Ga0070717_11664640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 578 | Open in IMG/M |
| 3300009012|Ga0066710_100518728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1799 | Open in IMG/M |
| 3300010043|Ga0126380_11636875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 576 | Open in IMG/M |
| 3300010159|Ga0099796_10221861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 775 | Open in IMG/M |
| 3300010359|Ga0126376_11489392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 705 | Open in IMG/M |
| 3300010366|Ga0126379_11930492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 693 | Open in IMG/M |
| 3300010376|Ga0126381_103209353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 646 | Open in IMG/M |
| 3300010376|Ga0126381_103865861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300010396|Ga0134126_12364270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 579 | Open in IMG/M |
| 3300010401|Ga0134121_13017638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
| 3300012189|Ga0137388_10972409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 784 | Open in IMG/M |
| 3300012198|Ga0137364_11181499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 574 | Open in IMG/M |
| 3300012285|Ga0137370_11008735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300012361|Ga0137360_10669894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 890 | Open in IMG/M |
| 3300012917|Ga0137395_10210801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1355 | Open in IMG/M |
| 3300012930|Ga0137407_10731963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 932 | Open in IMG/M |
| 3300014168|Ga0181534_10308859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 854 | Open in IMG/M |
| 3300014169|Ga0181531_10981872 | Not Available | 530 | Open in IMG/M |
| 3300015241|Ga0137418_10213122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1661 | Open in IMG/M |
| 3300015357|Ga0134072_10077886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 979 | Open in IMG/M |
| 3300016371|Ga0182034_10490271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1023 | Open in IMG/M |
| 3300017927|Ga0187824_10265908 | Not Available | 599 | Open in IMG/M |
| 3300017936|Ga0187821_10294259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 644 | Open in IMG/M |
| 3300017947|Ga0187785_10654004 | Not Available | 547 | Open in IMG/M |
| 3300017970|Ga0187783_10785501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 687 | Open in IMG/M |
| 3300017974|Ga0187777_10642625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 750 | Open in IMG/M |
| 3300017974|Ga0187777_11176176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300017993|Ga0187823_10022174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1606 | Open in IMG/M |
| 3300018007|Ga0187805_10463074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 592 | Open in IMG/M |
| 3300018058|Ga0187766_10150434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1445 | Open in IMG/M |
| 3300018058|Ga0187766_11390110 | Not Available | 515 | Open in IMG/M |
| 3300019888|Ga0193751_1245734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 556 | Open in IMG/M |
| 3300021168|Ga0210406_10124063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2181 | Open in IMG/M |
| 3300021372|Ga0213877_10130865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 782 | Open in IMG/M |
| 3300021372|Ga0213877_10202346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300021405|Ga0210387_10243774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1571 | Open in IMG/M |
| 3300021432|Ga0210384_10346492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1338 | Open in IMG/M |
| 3300021432|Ga0210384_10965685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 753 | Open in IMG/M |
| 3300021477|Ga0210398_10061346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3072 | Open in IMG/M |
| 3300021559|Ga0210409_10142996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2193 | Open in IMG/M |
| 3300021560|Ga0126371_11560451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 787 | Open in IMG/M |
| 3300021560|Ga0126371_13187292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
| 3300021560|Ga0126371_13516454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
| 3300022894|Ga0247778_1102244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 762 | Open in IMG/M |
| 3300024288|Ga0179589_10535716 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 545 | Open in IMG/M |
| 3300025571|Ga0207874_1083039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 668 | Open in IMG/M |
| 3300025903|Ga0207680_10680180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 737 | Open in IMG/M |
| 3300025904|Ga0207647_10680707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 562 | Open in IMG/M |
| 3300025914|Ga0207671_10492203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300025915|Ga0207693_11243530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300025916|Ga0207663_10228661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1358 | Open in IMG/M |
| 3300025916|Ga0207663_10987048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 675 | Open in IMG/M |
| 3300025939|Ga0207665_10030229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 3580 | Open in IMG/M |
| 3300026116|Ga0207674_11637321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300026325|Ga0209152_10009839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3339 | Open in IMG/M |
| 3300027590|Ga0209116_1075978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
| 3300027671|Ga0209588_1186205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 650 | Open in IMG/M |
| 3300028047|Ga0209526_10425603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 877 | Open in IMG/M |
| 3300028380|Ga0268265_12068831 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 576 | Open in IMG/M |
| 3300028906|Ga0308309_11113162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
| 3300029636|Ga0222749_10174948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1060 | Open in IMG/M |
| 3300030739|Ga0302311_10912134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 562 | Open in IMG/M |
| 3300031545|Ga0318541_10658772 | Not Available | 585 | Open in IMG/M |
| 3300031564|Ga0318573_10054409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1963 | Open in IMG/M |
| 3300031640|Ga0318555_10441988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 705 | Open in IMG/M |
| 3300031679|Ga0318561_10208637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1060 | Open in IMG/M |
| 3300031679|Ga0318561_10594031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
| 3300031715|Ga0307476_10105516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1994 | Open in IMG/M |
| 3300031719|Ga0306917_10520633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 934 | Open in IMG/M |
| 3300031753|Ga0307477_10135875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1716 | Open in IMG/M |
| 3300031753|Ga0307477_10962974 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 561 | Open in IMG/M |
| 3300031770|Ga0318521_10159927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1283 | Open in IMG/M |
| 3300031779|Ga0318566_10133041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1230 | Open in IMG/M |
| 3300031780|Ga0318508_1031616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1344 | Open in IMG/M |
| 3300031781|Ga0318547_10044194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2369 | Open in IMG/M |
| 3300031781|Ga0318547_10927202 | Not Available | 544 | Open in IMG/M |
| 3300031782|Ga0318552_10380375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 719 | Open in IMG/M |
| 3300031782|Ga0318552_10629516 | Not Available | 547 | Open in IMG/M |
| 3300031794|Ga0318503_10177955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 688 | Open in IMG/M |
| 3300031794|Ga0318503_10203920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 641 | Open in IMG/M |
| 3300031795|Ga0318557_10190386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 935 | Open in IMG/M |
| 3300031795|Ga0318557_10576338 | Not Available | 516 | Open in IMG/M |
| 3300031819|Ga0318568_10014247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4190 | Open in IMG/M |
| 3300031821|Ga0318567_10110333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1496 | Open in IMG/M |
| 3300031823|Ga0307478_10067247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2701 | Open in IMG/M |
| 3300031831|Ga0318564_10338407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 662 | Open in IMG/M |
| 3300031860|Ga0318495_10070553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1557 | Open in IMG/M |
| 3300031879|Ga0306919_10748653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 752 | Open in IMG/M |
| 3300031893|Ga0318536_10119690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1329 | Open in IMG/M |
| 3300031897|Ga0318520_10275448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1009 | Open in IMG/M |
| 3300031954|Ga0306926_11902813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 672 | Open in IMG/M |
| 3300031959|Ga0318530_10044251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1653 | Open in IMG/M |
| 3300031962|Ga0307479_12071849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300032008|Ga0318562_10070358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1950 | Open in IMG/M |
| 3300032025|Ga0318507_10094380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1241 | Open in IMG/M |
| 3300032025|Ga0318507_10118005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1118 | Open in IMG/M |
| 3300032066|Ga0318514_10282915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 875 | Open in IMG/M |
| 3300032066|Ga0318514_10471900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 667 | Open in IMG/M |
| 3300032067|Ga0318524_10349471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 768 | Open in IMG/M |
| 3300032089|Ga0318525_10379213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 725 | Open in IMG/M |
| 3300032091|Ga0318577_10249302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 850 | Open in IMG/M |
| 3300032180|Ga0307471_101333500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 879 | Open in IMG/M |
| 3300032783|Ga0335079_11041365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 832 | Open in IMG/M |
| 3300032829|Ga0335070_10267538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1669 | Open in IMG/M |
| 3300032896|Ga0335075_10368262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1551 | Open in IMG/M |
| 3300032898|Ga0335072_11535592 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 566 | Open in IMG/M |
| 3300033158|Ga0335077_10200323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2246 | Open in IMG/M |
| 3300033289|Ga0310914_11333002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.87% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025571 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01892690 | 2088090014 | Soil | MADXXXLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLA |
| INPgaii200_10141261 | 2228664022 | Soil | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAAR |
| Ga0070680_1012000641 | 3300005336 | Corn Rhizosphere | MADWLLLRLPRAPEQSATWLIVDLRGAPTGPPQGGPLALAAARAAG |
| Ga0070688_1006492681 | 3300005365 | Switchgrass Rhizosphere | MADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRAVG |
| Ga0070684_1006213891 | 3300005535 | Corn Rhizosphere | MADWLLLRLPRDPEQPATWLVVDARGVAQGPPQSGPLSLAAPRSAGR |
| Ga0070732_106579571 | 3300005542 | Surface Soil | MADWLLLRLPHAGSELATWLVVDARGAPLSPPQSGPLALAAAR |
| Ga0068856_1007708881 | 3300005614 | Corn Rhizosphere | MADWLLLRLPRTPAQSATWLVVDPRGTPAGPPQSGPLSLAAPRTAGR |
| Ga0070717_116646401 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MADWLLLRLPRTPDQAATWLVVDARGVAQGPPQSGP |
| Ga0066710_1005187281 | 3300009012 | Grasslands Soil | MADWLLLRLPRASGEPASWLVADARGAPAGPPQDGPLTLAAPRA |
| Ga0126380_116368752 | 3300010043 | Tropical Forest Soil | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAA |
| Ga0099796_102218611 | 3300010159 | Vadose Zone Soil | MADWLLIRLPRTPEQAVTWLTVDPRGNPSGPPQSGPL |
| Ga0126376_114893922 | 3300010359 | Tropical Forest Soil | MADWLLLRLPHAGADLATWLVVDARGAPLSPPQSGPLALAAARV |
| Ga0126379_119304921 | 3300010366 | Tropical Forest Soil | MAESLLLRLPRSPEHAATWLVVDARGVPTGPPQSGPLALA |
| Ga0126381_1032093531 | 3300010376 | Tropical Forest Soil | MADWLLLRLPRADAELATWLVVDSRGAPISPPQSGPLGLAAAR |
| Ga0126381_1038658612 | 3300010376 | Tropical Forest Soil | MADWLLLRLPRTPEQPVSWVVVDPRGNPSGPVLSGPVSLAAPRAAG |
| Ga0134126_123642701 | 3300010396 | Terrestrial Soil | MADWLLLRLPRIPDQPATWLVVDPRGVAQGPPQSGPLSLAAPRTAGRRI |
| Ga0134121_130176381 | 3300010401 | Terrestrial Soil | MADWLLLRLPRIPDQPATWLVVDPRGVAQGPPQSGP |
| Ga0137388_109724092 | 3300012189 | Vadose Zone Soil | MADWLLLRLPRAPEQLASWLVADARGASAGLAQAGPL |
| Ga0137364_111814991 | 3300012198 | Vadose Zone Soil | MADWLLLRLPRTPDQAATWLVVDPRGVAQGPPQSGPLTLAAPRAT |
| Ga0137370_110087351 | 3300012285 | Vadose Zone Soil | MADWLLLRLPRAAGEPASWLIADARGAPAGPPQSGPLTLAAARAPGRRVC |
| Ga0137360_106698941 | 3300012361 | Vadose Zone Soil | MADWLLLRLPRAPEEPASWLVADVRGAPAGPPQGGPLSLAAARAA |
| Ga0137395_102108011 | 3300012917 | Vadose Zone Soil | MADWLLLRLPRAPEGPASWLVADARGAPVGPPQSGPLSLAAARAAG |
| Ga0137407_107319631 | 3300012930 | Vadose Zone Soil | MADWLLLRLPHAPEEPASWLVADARGAPVGPPQSGPLSLAAARAAG |
| Ga0181534_103088591 | 3300014168 | Bog | VAESLLLRLPHDPQRAASWLIVDARGTPVGPPMSGPLNLAAARIGGRQ |
| Ga0181531_109818722 | 3300014169 | Bog | MAETLLLRLPHGADQAPTWLIVDARGAAVGPPQSGPLNL |
| Ga0137418_102131221 | 3300015241 | Vadose Zone Soil | MADWLLIRLPRTPEQPATWLTVDPRGSPSGPPQSGPLSLAA |
| Ga0134072_100778862 | 3300015357 | Grasslands Soil | MADWLLLRLPRAAGEPASWLIADARGAPAGPQQSGPLTLAAARA |
| Ga0182034_104902711 | 3300016371 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPL |
| Ga0187824_102659081 | 3300017927 | Freshwater Sediment | MADWLLLRLPRTPDQAATWLVVDPRGVPTGPPQGGPLSLAAAR |
| Ga0187821_102942592 | 3300017936 | Freshwater Sediment | MADWLLLRLPRTPEGPAAWLIASPAGAPLTATQSG |
| Ga0187785_106540041 | 3300017947 | Tropical Peatland | VAETLLLRLPRAPEQLATWLVVDSGGAPTGPPQSGP |
| Ga0187783_107855012 | 3300017970 | Tropical Peatland | MSDWLLLRLPRQPDQLPSWLVTDVRGAPLGPPQGGPLELAA |
| Ga0187777_106426251 | 3300017974 | Tropical Peatland | MADWLLLRLPHADAELATWLVVDAHGAPLSPPQSGPL |
| Ga0187777_111761762 | 3300017974 | Tropical Peatland | MADWLLLRLPREETELATWLVVDSRGAPSSPPQSG |
| Ga0187823_100221743 | 3300017993 | Freshwater Sediment | MADWLLLRLPRAPEQSATWLIVDPRGAPTGPPQGGPLTLAAARAAGRRVAVLV |
| Ga0187805_104630741 | 3300018007 | Freshwater Sediment | MSDWLLLRLPPSGAELATWLVVDARGAPLSPPQSGPLA |
| Ga0187766_101504343 | 3300018058 | Tropical Peatland | MPDWLLLRLPRQPDQLSSWLVTDARGAPLGPPQSGPLPLAA |
| Ga0187766_113901102 | 3300018058 | Tropical Peatland | MPDWLLLRLARQPDQLSSWLVTDARGAPLGPPQSGPLPLAA |
| Ga0193751_12457342 | 3300019888 | Soil | MADWLLLRLPRAPELPATWLVVDSRGAPTGPPQAGPLSLATPRA |
| Ga0210406_101240634 | 3300021168 | Soil | MSDWLLLRLPHADAELATWLVVDARGAPISPPQSG |
| Ga0213877_101308652 | 3300021372 | Bulk Soil | MSDWLLLRLPHAGTELATWLVVDARGAPLGPAQSGPLALAAPRVPGRRV |
| Ga0213877_102023462 | 3300021372 | Bulk Soil | MAEWLLIRLPRTPEEPATWVVADARGAVSGPPQSGPLTL |
| Ga0210387_102437741 | 3300021405 | Soil | MADWLLLRLPRVPDQPATWLVVDPKGVATGPPQSG |
| Ga0210384_103464921 | 3300021432 | Soil | MADWLLLRLPRAPEQAATWLVVDARGTPTGAPQSGPLSLAA |
| Ga0210384_109656851 | 3300021432 | Soil | MADWLLLRLPRAPEEPASWLVADARGAPAGPPQSGPLSLAA |
| Ga0210398_100613461 | 3300021477 | Soil | MAETLLLRLPHAADEAASWLIVDGRGAPVGPPQSGPLNLAAPRVAGRR |
| Ga0210409_101429964 | 3300021559 | Soil | MAEWLLLRLPRAPEEPASWLVADARGAPVGPPQSGPLSLAAARAVG |
| Ga0126371_115604511 | 3300021560 | Tropical Forest Soil | MAETLLLRMPRAPGQNAGWLIVDARGAPVGPPQAGP |
| Ga0126371_131872921 | 3300021560 | Tropical Forest Soil | MADWLLLRLPRTDTELAVWLLVDARGAPASPPQSGPLSLAASRAPGRRVGL |
| Ga0126371_135164541 | 3300021560 | Tropical Forest Soil | MSDWLLLRLPHAPDQPASWLVADARGAPMGPPQAGPLELAAPRVSGRRVC |
| Ga0247778_11022441 | 3300022894 | Plant Litter | MADWLLIRLPRTAEQPATWLTIDPRGNPSGPPQSGPLSLAAPRAVGGAFV |
| Ga0179589_105357162 | 3300024288 | Vadose Zone Soil | MADWLLIRLPRTPERPATWLTVDPRGNPSGPPQSGPLSLATP |
| Ga0207874_10830392 | 3300025571 | Ionic Liquid And High Solid Enriched | MADWLLLRLPRAPEQPASWISVDARGAVQDGPHSGPLTLAATQAA |
| Ga0207680_106801801 | 3300025903 | Switchgrass Rhizosphere | MADWLLIRLPRTPEHPATWLTVDPRGNPSGPPQSG |
| Ga0207647_106807071 | 3300025904 | Corn Rhizosphere | MADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRAAG |
| Ga0207671_104922032 | 3300025914 | Corn Rhizosphere | MADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPR |
| Ga0207693_112435301 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MADWLLLRLPRSADQPATWLIVDPRGNAVGPPQSGPLSLAAP |
| Ga0207663_102286613 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAESLLLRLPRDPEQAASWLIVDARGAPVGPPQSGPLNLA |
| Ga0207663_109870481 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MADWLLLRLPREETELATWLVVDSRGTPSSPPQSGPLALAAA |
| Ga0207665_100302296 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLA |
| Ga0207674_116373212 | 3300026116 | Corn Rhizosphere | MADWLLLRLPRSPEQPASWLIVDPRGAASGPPQSGPLSLAAARAPGRRICVL |
| Ga0209152_100098396 | 3300026325 | Soil | MADWLLLRLPRAAGEPASWLIADARGAPAGPAQSGPLTLAAARAPGRRV |
| Ga0209116_10759782 | 3300027590 | Forest Soil | MADWLLLRLPHAAEQPATWLTADARGAPTGLAQSGPLSL |
| Ga0209588_11862051 | 3300027671 | Vadose Zone Soil | MADWLLLRLPRAPEGPASWLVADARGAPVGPPQSGPLSLAAAR |
| Ga0209526_104256032 | 3300028047 | Forest Soil | MADWLLLRLPRAPEEPASWLVADARGAPAGPPQSGPLSLAAARA |
| Ga0268265_120688311 | 3300028380 | Switchgrass Rhizosphere | MADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRA |
| Ga0308309_111131622 | 3300028906 | Soil | MSDWLLLRLPRTPDQPASWLVTDARGTPSGPPQSGPLN |
| Ga0222749_101749482 | 3300029636 | Soil | MAEWLLLRLPRAPEEPASWLVADARGAPVGPPQSGPLSLAA |
| Ga0302311_109121342 | 3300030739 | Palsa | MSDWLLLRLPRTPDQPASWLVTDARGAPSGPPQSGPLSLAVPRA |
| Ga0318541_106587722 | 3300031545 | Soil | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAARAPGRRVCLLV |
| Ga0318573_100544091 | 3300031564 | Soil | MADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPGRRVC |
| Ga0318555_104419881 | 3300031640 | Soil | MSDWLLLRLPRAPEQPATWLVVDPRGVALGPPQAGPLSLAAPRIAGRR |
| Ga0318561_102086371 | 3300031679 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPMSPPQSGPLALAAPRVPGRRV |
| Ga0318561_105940311 | 3300031679 | Soil | MSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRV |
| Ga0307476_101055161 | 3300031715 | Hardwood Forest Soil | MAETLLLRLPHAADEAASWLIVDGRGAPVGPPQSGPLNLAAPRVAG |
| Ga0306917_105206331 | 3300031719 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPMSPPQSGPLALA |
| Ga0307477_101358751 | 3300031753 | Hardwood Forest Soil | MADWLLLRLPRAPEQPATWLVADARGTATGPPQSGPLSLAAPRTAG |
| Ga0307477_109629742 | 3300031753 | Hardwood Forest Soil | MADWLLIRLPRTPEQPATWLTVDPRGNPSGPPQSGPLSLAAPRSVGR |
| Ga0318521_101599271 | 3300031770 | Soil | MSDWLLLRLPQAGAELATWLVVDARGAPLSPPQSGPLA |
| Ga0318566_101330412 | 3300031779 | Soil | MSDWLLLRLPHAGVELASWLVVDARGAPLSPPQSGPLALAAPRT |
| Ga0318508_10316161 | 3300031780 | Soil | MSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALA |
| Ga0318547_100441944 | 3300031781 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARAPGRRVC |
| Ga0318547_109272022 | 3300031781 | Soil | MSDWLLLRLPRAPEQPATWLVVDPRGVALGPPQAGPLSLAAPRIA |
| Ga0318552_103803752 | 3300031782 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTGRRVCV |
| Ga0318552_106295161 | 3300031782 | Soil | MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAARAPGRRVC |
| Ga0318503_101779551 | 3300031794 | Soil | MSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLA |
| Ga0318503_102039202 | 3300031794 | Soil | MADWLLLRLPRADAELATWLVVDARGAPISPPQSG |
| Ga0318557_101903862 | 3300031795 | Soil | MSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALAAARVPGR |
| Ga0318557_105763382 | 3300031795 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTGRRVC |
| Ga0318568_100142471 | 3300031819 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTG |
| Ga0318567_101103331 | 3300031821 | Soil | MSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRAS |
| Ga0307478_100672475 | 3300031823 | Hardwood Forest Soil | MADWLLLRLPRVPDEPATWLVVDARGTSVGPPQGGPLTLAAARTAGRRV |
| Ga0318564_103384072 | 3300031831 | Soil | MPDWLLLRLPREDAELATWLVVDARGAPLSPPQSGPLALAAARIPG |
| Ga0318495_100705531 | 3300031860 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSG |
| Ga0306919_107486531 | 3300031879 | Soil | MSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALAAARVP |
| Ga0318536_101196901 | 3300031893 | Soil | MSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRVPG |
| Ga0318520_102754481 | 3300031897 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAPRAPGRRVAV |
| Ga0306926_119028131 | 3300031954 | Soil | MADWLLLRLPRTDTELAVWLLVDARGAPASPPQSGP |
| Ga0318530_100442513 | 3300031959 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLA |
| Ga0307479_120718492 | 3300031962 | Hardwood Forest Soil | MADWLLLRLPRSPEQLATWLVVDARGVAVGPPQSGPLSLAAARTAGRRVCV |
| Ga0318562_100703583 | 3300032008 | Soil | MADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPG |
| Ga0318507_100943802 | 3300032025 | Soil | MADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPGRR |
| Ga0318507_101180051 | 3300032025 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALA |
| Ga0318514_102829152 | 3300032066 | Soil | MSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARAPGR |
| Ga0318514_104719001 | 3300032066 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAA |
| Ga0318524_103494712 | 3300032067 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAP |
| Ga0318525_103792131 | 3300032089 | Soil | MSDWLLLRLPQAGAELATWLVVDARGAPLSPPQSGPLALAA |
| Ga0318577_102493022 | 3300032091 | Soil | MSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAPRTPGRRVAVL |
| Ga0307471_1013335001 | 3300032180 | Hardwood Forest Soil | MADWLLLRLARTQEEPATWLVVDARGVPLGPAQSGPLALAAPRT |
| Ga0335079_110413652 | 3300032783 | Soil | MADWLLLRLPREETELATWLVVDSRGTPSSPPQSGPLA |
| Ga0335070_102675383 | 3300032829 | Soil | MAESLLLRLPRTPEEQASWLIVDTRGTPVGPPQSGPLNLAAPRVTGRRVLVV |
| Ga0335075_103682623 | 3300032896 | Soil | MADWLLLRLPRTPQQQATWLIVDGRGAAIGPPQGGPLSLAAPRA |
| Ga0335072_115355921 | 3300032898 | Soil | MADWLLLRLPRTPDQPATWLVVDPRGAAAGPPQSGPLSLAAARSAGRRIC |
| Ga0335077_102003234 | 3300033158 | Soil | MAETLLLRLPRDPGHAPSWLIVDARGAAVGPPQSGPLNLAAPRVAG |
| Ga0310914_113330022 | 3300033289 | Soil | MPDWLLLRLPREDAELATWLVVDARGAPLRPPQSGPL |
| ⦗Top⦘ |