NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079525

Metagenome Family F079525

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079525
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 170 residues
Representative Sequence MKDVQFFKHFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTRLRGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREIKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNADDDTVSSASSSSPPKPEDFQDSQDPYEL
Number of Associated Samples 12
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 24.56 %
% of genes near scaffold ends (potentially truncated) 72.17 %
% of genes from short scaffolds (< 2000 bps) 93.91 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.130 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(99.130 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.69%    β-sheet: 0.00%    Coil/Unstructured: 60.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01107MP 3.48
PF00078RVT_1 0.87
PF00098zf-CCHC 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.13 %
UnclassifiedrootN/A0.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003848|Ga0058694_1031757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha759Open in IMG/M
3300003857|Ga0058693_1028156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1215Open in IMG/M
3300003857|Ga0058693_1030793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1137Open in IMG/M
3300003857|Ga0058693_1053073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha759Open in IMG/M
3300005661|Ga0058698_10420588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha814Open in IMG/M
3300006020|Ga0058704_10253292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha996Open in IMG/M
3300009144|Ga0058702_10030698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2016Open in IMG/M
3300009144|Ga0058702_10037384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1824Open in IMG/M
3300009144|Ga0058702_10070999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1314Open in IMG/M
3300009144|Ga0058702_10093874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1139Open in IMG/M
3300009144|Ga0058702_10122952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha995Open in IMG/M
3300009144|Ga0058702_10124431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha989Open in IMG/M
3300009144|Ga0058702_10128930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha972Open in IMG/M
3300009144|Ga0058702_10133315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha956Open in IMG/M
3300009144|Ga0058702_10158602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha877Open in IMG/M
3300009144|Ga0058702_10170130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha847Open in IMG/M
3300009144|Ga0058702_10177883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha829Open in IMG/M
3300009144|Ga0058702_10201289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha781Open in IMG/M
3300009144|Ga0058702_10218625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha750Open in IMG/M
3300009144|Ga0058702_10219919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha748Open in IMG/M
3300009144|Ga0058702_10311860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha633Open in IMG/M
3300009144|Ga0058702_10337299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha610Open in IMG/M
3300009144|Ga0058702_10421988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha549Open in IMG/M
3300009144|Ga0058702_10444415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha536Open in IMG/M
3300009144|Ga0058702_10499914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha508Open in IMG/M
3300010395|Ga0058701_10063727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha3066Open in IMG/M
3300010395|Ga0058701_10085261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2512Open in IMG/M
3300010395|Ga0058701_10093835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2347Open in IMG/M
3300010395|Ga0058701_10121733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1949Open in IMG/M
3300010395|Ga0058701_10134679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1810Open in IMG/M
3300010395|Ga0058701_10156040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1621Open in IMG/M
3300010395|Ga0058701_10190256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1398Open in IMG/M
3300010395|Ga0058701_10215310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1273Open in IMG/M
3300010395|Ga0058701_10249693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1139Open in IMG/M
3300010395|Ga0058701_10267008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1083Open in IMG/M
3300010395|Ga0058701_10299672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha993Open in IMG/M
3300010395|Ga0058701_10326838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha931Open in IMG/M
3300010395|Ga0058701_10328178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha929Open in IMG/M
3300010395|Ga0058701_10356223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha874Open in IMG/M
3300010395|Ga0058701_10378454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha837Open in IMG/M
3300010395|Ga0058701_10396184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha810Open in IMG/M
3300010395|Ga0058701_10398968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha805Open in IMG/M
3300010395|Ga0058701_10413537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha785Open in IMG/M
3300010395|Ga0058701_10492326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha695Open in IMG/M
3300010395|Ga0058701_10519507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha671Open in IMG/M
3300010395|Ga0058701_10549456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha647Open in IMG/M
3300010395|Ga0058701_10563422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha636Open in IMG/M
3300010395|Ga0058701_10589554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha618Open in IMG/M
3300010395|Ga0058701_10628347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha594Open in IMG/M
3300010395|Ga0058701_10639219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha588Open in IMG/M
3300010395|Ga0058701_10642572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha586Open in IMG/M
3300010395|Ga0058701_10646317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha584Open in IMG/M
3300010395|Ga0058701_10685602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha563Open in IMG/M
3300010395|Ga0058701_10699457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha557Open in IMG/M
3300010395|Ga0058701_10704083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha554Open in IMG/M
3300010395|Ga0058701_10727946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha544Open in IMG/M
3300010395|Ga0058701_10786462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha520Open in IMG/M
3300010395|Ga0058701_10800298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha515Open in IMG/M
3300027718|Ga0209795_10114065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha770Open in IMG/M
3300027766|Ga0209796_10254169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha561Open in IMG/M
3300027766|Ga0209796_10307351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha510Open in IMG/M
3300027766|Ga0209796_10310802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha507Open in IMG/M
3300027766|Ga0209796_10320200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha500Open in IMG/M
3300030495|Ga0268246_10022820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1843Open in IMG/M
3300030495|Ga0268246_10025598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1736Open in IMG/M
3300030495|Ga0268246_10032545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1531Open in IMG/M
3300030495|Ga0268246_10063265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1078Open in IMG/M
3300030495|Ga0268246_10096962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha862Open in IMG/M
3300030495|Ga0268246_10099921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha849Open in IMG/M
3300030495|Ga0268246_10102904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha836Open in IMG/M
3300030495|Ga0268246_10102953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha836Open in IMG/M
3300030495|Ga0268246_10108605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha812Open in IMG/M
3300030495|Ga0268246_10129848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha740Open in IMG/M
3300030495|Ga0268246_10133008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha731Open in IMG/M
3300030495|Ga0268246_10161809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha661Open in IMG/M
3300030495|Ga0268246_10170730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha643Open in IMG/M
3300030495|Ga0268246_10179520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha627Open in IMG/M
3300030495|Ga0268246_10194542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha602Open in IMG/M
3300030495|Ga0268246_10202509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha590Open in IMG/M
3300030495|Ga0268246_10219271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha567Open in IMG/M
3300030495|Ga0268246_10233522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha550Open in IMG/M
3300030495|Ga0268246_10245020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha537Open in IMG/M
3300030495|Ga0268246_10261473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha521Open in IMG/M
3300030498|Ga0268247_10010091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2990Open in IMG/M
3300030498|Ga0268247_10027781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2139Open in IMG/M
3300030498|Ga0268247_10048098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1756Open in IMG/M
3300030498|Ga0268247_10058495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1625Open in IMG/M
3300030498|Ga0268247_10101684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1287Open in IMG/M
3300030498|Ga0268247_10113659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1223Open in IMG/M
3300030498|Ga0268247_10123392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1177Open in IMG/M
3300030498|Ga0268247_10131523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1142Open in IMG/M
3300030498|Ga0268247_10139900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1109Open in IMG/M
3300030498|Ga0268247_10140812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1106Open in IMG/M
3300030498|Ga0268247_10168247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1011Open in IMG/M
3300030498|Ga0268247_10179571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha979Open in IMG/M
3300030498|Ga0268247_10194051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha940Open in IMG/M
3300030498|Ga0268247_10202746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha919Open in IMG/M
3300030498|Ga0268247_10236857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha844Open in IMG/M
3300030498|Ga0268247_10278689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha771Open in IMG/M
3300030498|Ga0268247_10282338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha766Open in IMG/M
3300030498|Ga0268247_10315972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha718Open in IMG/M
3300030498|Ga0268247_10318536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha715Open in IMG/M
3300030498|Ga0268247_10328262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha702Open in IMG/M
3300030498|Ga0268247_10346283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha681Open in IMG/M
3300030498|Ga0268247_10348943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha678Open in IMG/M
3300030498|Ga0268247_10379006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha646Open in IMG/M
3300030498|Ga0268247_10395273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha630Open in IMG/M
3300030498|Ga0268247_10427759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha601Open in IMG/M
3300030498|Ga0268247_10428982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha600Open in IMG/M
3300030498|Ga0268247_10444522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha588Open in IMG/M
3300030498|Ga0268247_10541970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha522Open in IMG/M
3300030516|Ga0268255_10108869All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha830Open in IMG/M
3300030516|Ga0268255_10212886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha558Open in IMG/M
3300030692|Ga0268250_10738027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha538Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave99.13%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003848Agave microbial communities from Guanajuato, Mexico - Or.Sf.rzHost-AssociatedOpen in IMG/M
3300003857Agave microbial communities from Guanajuato, Mexico - Or.Ma.rzHost-AssociatedOpen in IMG/M
3300005661Agave microbial communities from Guanajuato, Mexico - As.Sf.eHost-AssociatedOpen in IMG/M
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030692Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058694_103175713300003848AgaveYMKDVQFFKHFNVAWIFSWEYRLQHFLPNPYPLSFVRIYKVKWWSEFKTRLCGKENVEYFCQTNKKKFTLHNLHLFETKAIAPATPVKREKREPSSSSSTKFRAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDSQDPYEL*
Ga0058693_102815613300003857AgaveDYWSQASTHLEPYMKEVLFFKQFNVAWIFSWEYRLQPFLPNPYPLSFVRIYKVKWWIEFKTKLCGKENVEHFCRTNKKKFTLHNLHLFTPKAIAPATPSKKESKEQSSSSSTKLKPKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQVDSDDETMSSASSSSPPKPEDFQDSQDPYEL*
Ga0058693_103079323300003857AgaveQFFNHFKIAWIFSWEYRLQHFLPHPYPLSLVRIYKVKWWSEFKTRLCSKENVEHFCKTGKRKFTLHNLHLFEKAKAPATPSKKDVKQDKSSSSSTKTKAKGLSQKERDLLEYLKDDPTMKQIVLQKILDKQTNSDDETVSTAASSSPPKPEDFQDSQDPYEL*
Ga0058693_105307313300003857AgaveTFPVWFYHWWTMFGCLTMLLPAEAQEGWSYWVQISNFDLYMKDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKVKWWAEFKSRLCCKENVEHFCKTGKRKFTLHNYHLFDKTTAPLTPTKKEVKQDQSSSSSAKSKAKGLSQKERDLLEYLKDDPSMKQIVLQRILDKQGNAEEETASSASSSSPPKPEDFQDSQDPYEF*
Ga0058698_1042058813300005661AgaveLYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCRYGKRKFTLHNYHLFDKAQALITPIKRESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNVDDDTVSSASSSSPPKPEDFHDSQDPYEL*
Ga0058704_1025329223300006020AgaveMFGCLTMLLPAEAQEGWSYWVQISNFDLYMKDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKVKWWAEFKTRLCCKENVEHFCKTGKRKFTLHNYHLFDKTTAPLTPTKKEVKQDQSSSSSAKSKAKGLSQKERDLLEYLKDDPSMKQIVLQRILDKQGNAEEETASSASSSSPPKPEDFQDSQDPYEF*
Ga0058702_1003069833300009144AgaveMEPYMKEFQFFKQFNVAWIFCWEYRLHQYLPAPYPLSVLRVYKIKWWNEYKSKLCGKENVEHFCRTNTKKFALHNLQHFEKQSKIAPATPTKKESSSSSTKSKTKGLSQKERDLLEYLKDYPNMRQIVLQKILDKKGDSDDDETISSAALSSPKPGDHCLQGSQDPYEL*
Ga0058702_1003738423300009144AgaveMFGCLTMLLPAEAHEGWTYWSQVSTNLDLYMKDVQFFKHFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYYLFDEAQAPITPIKKESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNVDDDTVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058702_1007099913300009144AgavePYMKDVHFFRQFNVAWIFSWEYRLQHFLPHPYPLSLVRVYKIKWWPEFKARLCGKENVEYFCKHGKRKFTLYNLYLFEKPKVAPATPSKKEAKMEKSSSSPTKTKAKGLSQKERDLLDYLKDDPDMKQIVFQKVLSKQGDSDDETVSSAASSSPPKPEDFQDSQDPNEL*
Ga0058702_1009387423300009144AgaveMFSYLTMLLPAEAQEGWTFWSQVSTNMDLYMKDVQFFKNFNVAWIFSWKYRLQPFLPHPYPLSLVRVYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREVKQEKSSSSSTKSKAQGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTHSDDDTISSASSSSPPKPEDFQDSQDPYEL*
Ga0058702_1012295213300009144AgaveVRIYKVKWRTEFKTRLCGKENVEHFCKTNKKKFTIHNLHLFEKSRIAPATPSKREKKEQSSSSLTKSKAKGLSQNEKELLQFFKNDPDMRQAVLQKILDKKGDSDDDTVSSAASSSPPKPEDFQDSQDSYEL*
Ga0058702_1012443123300009144AgaveMFGCLTMLLPAEAQEGWTYWLQVSNLDLYMKDIQFFKNFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYEKRKFTLHNYHLFDKTQAPITPSKKESKQEQSSSSSTKSQEKGLSQKECDLLEYLKDDPAMKQIVLQKILDKQTNEDEDTVSSTSSSAPQKPDDFQDSQDPYEF*
Ga0058702_1012893013300009144AgaveMKYVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEYFCKHGKRKFTLHNLHMFDKAKAPTTPIKREVKQEKSSSSSAKFKARGLSQKEHDLLEYLKDDPSMKQIVLQKILDKQTNSDDDTISSASSSSPPKPEDFQDSQDPYEL*
Ga0058702_1013331533300009144AgaveMFGCLTMLLPAEAQEGWTYWSQVSTNMDLYMKDVQFFNQFNVAWMFSWEYRLQPFLPLPYPLSLVHIYKVKWWPEFKTRLCGKENVEHFCKHGKSKFTRHNLHLFDKAKASTTPIKREVKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQI
Ga0058702_1015860223300009144AgaveMFGCLTTLLPAEAQEGWAYWAQIANMDLYMKDVQFFNHFNVAWIFSWEYRLHPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKYGKRKFTLHNLHLFEKAKAPVTPSKKEGKQEKSSSSSTKSKVRGLSQKERDLLGYLKEDPSMKQIVLQKILDKQTNSDDDTVSSASSSAPPKPEDFQDSQDPYEL*
Ga0058702_1017013013300009144AgaveMSGCLAILLPIEAKEGWDDWSQASTNMDLYMKDVQFFKQFNVAWIFSWEYRLQPFLPNPYPLSLVCIYKVKWWSEFKTRLCGKENVEHFCRTNKKKFTLHNLHLFEKTKIVPATPSKKEVKQEKSSSSSIKPKAKGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNSSDETVSSAASSSPPKPEDFQDSQDPYELSQGRQELVSWQSAKSKNKLLPCKSQLALGKS*
Ga0058702_1017788313300009144AgaveAWIFSWEYRLQNFLPIPYPLSLVRVYKIKWWSEFKTRLCGKENVEYFCKTNKKKFTLHNLHLFEKPQIDPATPTKKEKSSSSSSKTRAKGKGLSQKEKDLHAYLKDDPDMKQIVLQKILDKQGDDLQDSQDPYEL*
Ga0058702_1020128913300009144AgaveMLLPAEAQEGWSYWVQISNFDLYMKDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKVKWWAEFKSRLCCKENVEHYCKTGKRKFTLHNYHLFDKTTAPLTPTKKEVKQDQSSSSSAKSKAKGLSQKERDLLEYLKDDPSMKQIVLQRILDKQGNAEEETASSASSSSPPKPEDFQDSQDPYEF*
Ga0058702_1021862513300009144AgaveSVAPPNPYPLSFVRIYKVKWWSEFKTRLCDKENVEHFCRTIKKKFTLHNLHLFEKSSKMAPLTPTKKEKSSSSSTKTKARRLSQREKDLLEYLKDDPNMKQIVLQKILDKQGDSDNDTVSSAASSSPPKPEDLQDSQDSYEL*
Ga0058702_1021991913300009144AgaveLSLVRIYKIKWWSEFKTRLCGKENIEYFCNTNQKKFTLHNLHLFEKSKLAPATLTKKEKSSSSSSRTKAKGLSQKEKDLLEYLKDDPGMKQIVLQKFSDKQADSDDDTVSLAASSSPPKPEDLQDSQDPYDS*
Ga0058702_1031186013300009144AgaveIGGQCSAEPVIFPMEASEGWDHWSKATLTMEPYMKDIHFFRQFCVAWIFSWEYRLQSFLPHPYPLSLVRVYKIKWWPEFKTQLCGKENVEYFCKNGKRKFTLHNLHLFVKAKVAPATPTKKDVKREKSLSSSTTTKTKGLSQKERDLLEYLKDNPSMKQIVLQKILDKQGNSDDDTVSPAASSSLHLTIYRILRTHMSCKQRRQEQGSWQ
Ga0058702_1033729913300009144AgaveLTMEPYMKDVHFFRQFCVAWIFSWEYRLQPYLPHPYPLSLVWIYQIKWWPELKTRLCDKENVEHFCKQGKRKFTLHNLHLFVKAKAPATPVKQDVKREKSSSSSTKTKAKGLSQKEKDLLAYLKDDPGMKQIVLQKILDKRGNSDEDTVSSAASSSPPKPDDRQDSQDPYDL*
Ga0058702_1042198813300009144AgaveLTILLPAEAKEGWDYWSQANTNLELYMKDVQFFKQFNVAWIFSWEYRLQHFLPNPYPLSLVRIYKVKWWTEFKTRLCGKENVEYFCRTNKKKFTLHNLHLFETSKAIAPATPIKKEKKEQSSSSSAKFEARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNSDDETVSSAASSSPPKPE
Ga0058702_1044441513300009144AgaveFKQFNVAWIFCWEYRLHQYLPAPYPLSLVRFYKIKWWNEYKSNLCGKENVEHFCRTNTKKFTLHNLQRFEKKSKIAPATPTKKESSSSSTKCKAKGLSQKERDLVEYLKDDPNMRQIVLQKILDKKGDSEDDKTVSSAASSSPPKPGDHCLQDS*
Ga0058702_1049991413300009144AgaveFGCLTMLLPIEAQEGWTYWSQISTNMDLYMKDVQFFKNINVAWIFSWEYRLQPFLPHPYPLPLVRIYKVKWWPEFKAKLCGKENVEHFCKHGKRKFTLHNLHFFDNAKAPTAPIKREVKQEKSSSSSSKTKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDD
Ga0058701_1006372733300010395AgaveMFGCTPVIFPMEAHEGWDHWLKATLTMEPYMKDVHFFRQFCVAWIFSWEYRLQSFLPHPYPLSLVRVYKIKWWPEFKAQLCGKENVEYFCKNGKRKFTLHNLHLFVKAKVAPVTPTKKDVKREKSSSSSTKTKTKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNLDDDTVSSAASSSPPKPEDLQDSQDPYEL*
Ga0058701_1008526123300010395AgaveMESYMKEVQFFKQFNVAWIFCWEYRLHQYLPAPYPLSLVRVYKIKWWPEYKSKLCGKENVEYFCKINAKKFTLHNLQHLEKESKIAPATPTMKESSSSSTKSKAKGLSQKERDLLEYLKDDPNMRQIVLQKILDKKGDSYDDEIVSSAASSSPPKPGNPCFKIPKTLMICEQMDGKNFFLGKIKSQK*
Ga0058701_1009383533300010395AgaveMFGCLTMLLPVEAQEGWTYWSQISTNMDLYMKDVQFFKNFNVAWIFSWEYWLQPFLPHPYPLSLVRIYKVKWWPEFKTKLCGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREVKQEKSSSSSTKSKARGLSQKERDLLEYFKDDPSMKQIVLQKILDKQTNTDDDTVSSASSSSPPKLEDFQDSQDPYEL*
Ga0058701_1012173313300010395AgaveMIFPSEAKEGWDYWSQATTIMEPYMKDVQFFNQFNVAWIFCWEYHLQNFLPTPYPLSLVRIYKVKWWTEFKSHLCGKENVEYFCKTNKKKFTLHNVHLFEKTKMAPAMPTKKESSSSSTKTKAKGFSQKEKELLEYLKDDPDMRQIVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDPYAL*
Ga0058701_1013467923300010395AgaveVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKPCCKENVEHFCRYGKRKFALYNYHLFDKAQAPITPIKRESKQEMSSSSSTKSKARRLSQKEHDLLDYLKDDPSMKQIVLQKILDKQTNVDDETVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058701_1015604023300010395AgaveMFGCLTILLPAEAQEGWTYWLQVSNLDLYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYHLFDKAPPPITPIKKESKQEKSSSSSTKSQAKGLSQKERDLLEFLKDDPSMKQIVLQKILDKQINVDDDTVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058701_1019025623300010395AgaveMKGVQFFKQFNVAWIFSWEYRLQPFLPNPYPLSLVRIYKVNWWSEFKTRLCGEENVEDFCRTNKKKFTLHNLYLFEKTKIAPATPSKKEVKQEKSSSSSTKPKAKGLSQKECDLLEYLKDDPAMKQIIFQKILDKQTNSDDETVSLVASSSPPKLEDFQDSQDPYEL*
Ga0058701_1021531023300010395AgaveLGILSATISPPPYPLSLVRVYKIKWWPEFKTQLCGKENVDYFCKNGKRKFTLHNLHLFVKSKVAPATLAKKEVEREKSYSSSTKTKAKGQSQKERDLLEYLKDDPSMKQIVLQKILDKQMESDDEIVSSAASSSPLKQEDLQDSQDPYDL*
Ga0058701_1024969323300010395AgaveMDIQLEYRLQHFLPHPYPLSLVRIYKVKWWSEFKTRLCSKENVAYFCKTGKRKFTLHNVHLFEKTKVAPATPAQKYTKKEHSSSSSTKPKNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTNSDEDTVSSAASSSPPKPEDFQDSQDPYEL*
Ga0058701_1026700823300010395AgaveLYMKDVQFFKNFNVAWIFSWEYRLQPYLPHPYPLSLVRIYKVKWWSEFKTQLCGKENVEYFCKYGKRKFTIHNLPMFDKAKAPFTPSKKEVKTEQSSSFSTKSKAKGLSQKEQDLLEYLKDDPNMKQIVLQKILDKQGHSDDETASSASSSSPQKFEDFQDSQDPYEF*
Ga0058701_1029967223300010395AgaveVRVYKIKWWPEFKTQLCGKENVDYFCKNGKRKFTLHNLHLFFKSKVAPATPAKKEVKREKSSSSSTKTKAKGLSQKELDLLEYLKDDPSMKQIVLQEILDKQMESDDETVSSAASSSLPKQEDLQDSQDPYDL*
Ga0058701_1032683813300010395AgaveVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKIKLCGKENVEHFCKYGKHKFTLHNYHLFDKAQAPITPSKKESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQLVLQKILDKQTTVDDDTVSSASSSAPPKPEDFQDSQDPYEL*
Ga0058701_1032817813300010395AgavePYMKDVHFFRQFNVAWIFSWEYRLQHFLPHPYPLSLVRFYKIKWWPEFKARLCGKENVEYFCKHGKRKFTLYNLYLFEKPKVAPATPSKKEAKMEKSSSSPTKTKAKGLSQKERDLLDYLKDDPDMKQIVFQKVLSKQGDSDDETVSSAASSSPPKPEDFQDSQDPNEL*
Ga0058701_1035622333300010395AgaveWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFEKAKAPVTPIKKDVKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKIFDKQTNSDDDTVSSASSSAPPKPEDLQDSQDPYEL*
Ga0058701_1037845413300010395AgaveFNVAWIFCWEYRLQNFLPTPYPLSLVRIYKVKWWTEFKCRLCGKENVEYFCKTNKKKFSLQNLHLFEKTKIAPAMPIKKESSSSSTKTKANGLSQKEKELLEYLKDDPDMRQVVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDLYEL*
Ga0058701_1039618413300010395AgaveVQFFKQFNVGWIFSWEYRLQHFLPNPYTLSLVRIYKIKWWTEFKTRLCDKENVEYFYRTNKKKFTLHNLHLFETSKAIAPITPVKREKKEQSSSSSAKLKARGLSQKERDLLEYLKHDPSMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDS*
Ga0058701_1039896813300010395AgaveMKDVQFFKHFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTRLRGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREIKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNADDDTVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058701_1041353713300010395AgaveFGCLTMLLPVEAQEGWTYWSQMSTNMDLYMKDVQFFKNCNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWPEFKIRLCGKENVEHFCKHGKRKFTLFNLHLFDKAKAPTTPIKREAKQEKSSSSSTKSKARGLLQKERDLLEYLKDDPSMKQIVLQKFLDKQTNADNDTVSSASSSSPPKPKDFQDSQDPYEL*
Ga0058701_1049232613300010395AgaveMGHLVQGDYYNGALYERSSIFKQFNVAWIFCWEYRLHQYLPAPYPLSLVRFYKIKWWNEYKSNLCGKENVEHFCRTNTKKFTLHNLQRFEKKSKIAPATPTKKESSSSSTKSKAKGLSQKERDLVEYLKDDPNMRQIVLQKILDKKGDSEDDKTVSSAASSSPPKPGDHCLQDS*
Ga0058701_1051950713300010395AgaveEGWDCWLKATLTMEPYMKDVHFFRQFCVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEFFCKQGKRKFTLHNLHLFEKAKAPATPSKQDVKKEKSSSSSAIIKAKGFSQKEKDLLEYLKDDPGMKQIVLQKILDKHCNSDEDTVSSAASSSPPKPDDLQDSQDPYEL*
Ga0058701_1054945613300010395AgaveSWEYRLQHFLPNPYPLSLVRIYKVKWWNEFKTRLCGKENVEYFCHTNKKKFTLHNLHLFETSKAVALATPIKREKNEQSSSSSTKFKAKGLSQKEQDLLEYLKDDPSMKQIVQQKILDKQGNADDETVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058701_1056342213300010395AgaveVAWIFSWEYRLQHFLPTPYPLSLVRIYKIKWWYEFKTRLSGKENVEYFCKTNKKKFTLYNLHLFEKSKLAPTTPTKKEKSSSASSRTKAKGLSQKEKDLLEYLKDDPGTKQIVPQKILDKQADSDDDTVSSAASSSPPKPEDLQDSQDPYDL*
Ga0058701_1058955413300010395AgaveLQHFLPNPYPLSLVRIYKVKWWTEFKTRLCGKENVEYFCHTNKKKFTLHNLHLFETSKAVAPATPIKREKNEQSSSSLTKFKAKGLSQKERDLLEYLQDDPSMKQIVLQKILDKQGNANDETVSSASSSSPPKPEDFQDSQDPYER*
Ga0058701_1062834713300010395AgaveWIFSWEDRLQHFLPNPYTLSLVRIYKVKWWTEFKIRLCGKENVEYFCRTDKKKFTLHNLHLFETSKAIAPATPIKREKKEQSSSSSNKFKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNSDDETMSSVASSSPPKPDDFQDSQDPYEL*
Ga0058701_1063921913300010395AgaveSQVSTNLDLYMKDVQFFKHFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYHLFDKAQAPLTPIKRDSKQEKSSSSSTKSKAKGLSQKERDLLEYLKDDPSMKQIVLQKIVDKQTNVDDETVSSASSSSPPKPEDFQDSQDPYEL*
Ga0058701_1064257213300010395AgaveMFGCTPVIFPMEAREGWDCWLKATLTMEPYMKDVHFFRQFCVALIFSWEYRLQPFLPHPYPLSLVWIYKIKRWPEFKARLCGKENVEFFCKQGKRKFTLHNLHLFEKAKAPATPSKQDIEKEKSSSSSAKIKAKGLSQKEKDLLEYLKDDPGMKQIVLQKILDKHGNSDEDTVSSAASSSPPKPDDLQDSQDPYD
Ga0058701_1064631713300010395AgaveAWIFSWEYRLQHFLPNPYPLSLVRIYKVKWWTEFKTRLCGTENVEYFCRTNKKKFTLHNLHLFETSKAIAPATAIKREKKEQSSSSSTKFKARGLSQKERDLLEYPKDDPSMKQIVLQKIQDKQGNSDDETVSSAASSSPLKPEDFQDSQDPYEL*
Ga0058701_1068560213300010395AgaveQEGWAYWSQASTNLELYMKDVQFFKQFNVAWIFSWEYRLHHFLPNPYPLSSVRIYKVKWWSEFKTRLCGKENVEHYCRTNKKKFTLHNLHLFEKSSKMAPVTPTKKEKSSSSSTKTKARGLSQKEKDLLEYLKDDPNMKQIVLQKILDKQGDSDDDTVSSAASSSPPKPEDLQDSQDPYEL*
Ga0058701_1069945713300010395AgaveLTMEPYMKDVHFFRQFCVAWIFSWEYRLQPYLPHPYPLSLVWIYQIKWWPELKTRLCDKENVEHLCKQGKRKFTLHNLHLFVKAKAPATPVKQDVKREKSSSSSTKTKAKGLSQKEKDLLAYLKDDPGMKQIVLQKILNKRGNSDEDTVSSAASSSPPKPDNRQDSQDPYDL*
Ga0058701_1070408313300010395AgaveDLYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKAKLCGKENVEHFCKHGKRKFTLHNLHFFDNAKAPTTPIKREVKQEKSSSSSSKTKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDDDTVSSASSSAPPKPEDFQDSQDPYEL*
Ga0058701_1072794613300010395AgaveQFNVAWIFSWEYRLQHFLPHPYPLSLVRIYKVKWWSEFKTRLCGKENVAYFCKTGKRKFTLHNLHLFEKTKVTLATPAQKDTKKEHSSSSSTKPKNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTNSDDDTVSSTASSFPPKPEDFQDSQDPYEL*
Ga0058701_1078646213300010395AgavePHPYPLSLVRIYKVKWWSEFKTRLCGKENVAYFCKTGKRKFTLHNVHLFEKTKIAPATPSQKDTKKEHSSSSSTKPKNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTNSDEDTVSSAASSAPPKPEDFQDAQDPYDL*
Ga0058701_1080029813300010395AgaveMDLYMKDVQFFKNFNVAWIFSWEYRLQPYLPHPYPLSLVRIYKVKWWSEFKTRLCGKENVEHFCKHGKRKFTIHNLPIFDKAKAPLTPSKKEVKTEQSSSSSTKSKAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQSNSDD
Ga0209795_1011406513300027718AgaveSKTLPVWFYHWWTMFGCLTMLLPAEAQEGWLHWSQVTTNMDLYMKDVQFFKNFNIAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTIHNLHLFDKAKEPTTLLKREVKQERSASLSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDDDIISSASSSSPPKPEDFQDSQDPYEL
Ga0209796_1025416923300027766AgaveDLYMKDVQFFKNFNIAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTIHNLHLFDKAKEPTTPIKREVKQERSSSSSTKSKARGLSQKECDLLEYLKDDPSMKQIVLQKILDEQTNSDDDTISSA
Ga0209796_1030735113300027766AgaveYMKDVQFFKHFNVAWIFSWEYRLQHFLPNPYPLSFVRIYKVKWWSEFKTRLCGKENVEYFCQTNKKKFTLHNLHLFETKAIAPATPVKREKREPSSSSSTKFRAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0209796_1031080213300027766AgaveLPAPYPLSLVRVYQVKWWKEYKAKLCGRENVEHFCKTNTKKFTLHNLQHFDKPKLAPAMPSKKESSSSSTKSKARGLSQKERDLLEYLKDDPNMRQIVLQKILDKKADSDDDEIVSSAASSSPKPGDPCLQDSQDPYEL
Ga0209796_1032020013300027766AgaveSFLPHPYPLSLVRVYKIKWWPEFKAQLCGKENVEYFCKNGKRKFTLHNLHLFVKAKVAPVTPTKKDVKREKSSSSSTKIKTKGLSQKEHDLLEYLKDDPSMIQIVLQKILDKQGNSDDDTISSAASSSPPKPDDLQDSQDPYDL
Ga0268246_1002282023300030495AgaveYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTKLCGKENVEHFCKHGKGKFTLHNLHLFDNAKAPTTPIKREVKQEKSSSSSSKTKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268246_1002559813300030495AgavePYPLSLVHIYKVKWWTEFKTRLCGKENVEHFCKTNKKKFTIHNLHLFEKSEIAPATPSMREKKEQSSSSPTKSKAKGLSQKEKELLEFFKNDHDMRQAVLQKILDKKEDADDDTVSSAASSSPPKPEDFQDSQDPYEL
Ga0268246_1003254513300030495AgaveMFGCTPVIFPVEAREGWDHWLKATLTMEPYMKDVHFFRQFCVARIFSWEYRLQSFLPHPYPLSLVRVYKIKWWPEFKTQLCSKENVEYFCKNSKSKFTLHNLHLFVKAKVAPSTPTKKDVKXEKSSSSSTKIKTKGLSQKEHDLLEYLKDDPSMIQIVLQKILDKQGNSDDDTISSAASSSPPKPDDLQDSQDPYDL
Ga0268246_1006326513300030495AgaveMLLPTEAKEGWDYWSQASTNLELYMKDVQFFKQFNVAWIFSWEYRLQHFLPNSYPLSLVRIYKVKWWSEFKTRLCGKENVEYLCRTNKKKFTLHNLHLFETSKAIAPATPIKKEKKEQSSSSSAKFTARGLSQKERDLLEYLKDDPSMKQIVLQKVLDKQGNSNDEIVNSAASSSPPK
Ga0268246_1009696213300030495AgaveNFHEQCSNTFPVWFYHWWTMFGCLTMLLPAEAQEGWSYWVQISNFDLYMKDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKVKWWAEFKSRLCCKENVEHYCKTGKRKFTLHNYHLFDKTTAPLTPTKKEVKQDQSSSSSAKSKAKGLSQKERDLLEYLKDDPSMKQIVLQRILDKQGNAEEETASSASSSSPPKPEDFQDSQDPYEF
Ga0268246_1009992113300030495AgaveMFGCTPVIFPMKAREGWDSWLKETLTMEPYMKDVHFFRQFCVAWIFSWEYRLQPYLPHPYPLSLVWIYQIKWWPELKTRLCDKENVEHFCKQGKRKFTLHNLHLFVKAKAPATPVKQDVKREKSSSSSTKTKAKGLSQKEKDLLAYLKDDPGMKQIVLQKILDKRGNSDEDTVSSAASSSPPKPDDRQDSQDPYDL
Ga0268246_1010290413300030495AgaveFNVAWIFSWEYRLQHFLPHPYPLSLVRVYKIKWWPEFKARLCGKENVEYFCKHGKRKFTLYNLYLFEKPKVAPATPSKKEAKMEKSSSSPTKTKAKGLSQKERDLLDYLKDDPDMKQIVFQKVLSKQGDSDDETVSSAASSSPPKPEDFQDSQDPNEL
Ga0268246_1010295323300030495AgaveSQYGFPIGGQCSAEPVIFPMEASEGWDHWSKATLTMEPYMKDIHFFRQFCVAWIFSWEYRLQSFLPHPYPLSLVRVYKIKWWPEFKTQLCGKENVEYFCKNGKRKFTLHNLHLFVKAKVAPATPTKKDVKREKSLSSSTTTKTKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNSDDDTVSSAASLSSPKPDDLQDSQDPYEL
Ga0268246_1010860513300030495AgaveVQFFKHFNVAWIFSWEYRLHPYLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKTGKRKFTLHNYHLFDKATAPTTPIKHEGKQDKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSNDDTVSSASSSAPPKAEDFQDSQDPYEL
Ga0268246_1012984823300030495AgaveILLPIEAKEGWDYWSQASTNMKDVQFFKQFNVAWIFSWEYRLQPFLPNPYPLSLVCIYKVKWWSEFKTRLXGKENVEHFCRTNKKKFTLHNLHLFEKTKIAPATPSKKEVKQEKSSSSSIKPKAKGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNFVDETVNSAASSSPPKPEDFQD
Ga0268246_1013300813300030495AgaveAQEGWTYWLQVSNLDLYMKDVQFFKNFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYEKRKFTLHNYHLFDKTQAPITPSKKESKQEQSSSSSTKSQEKGLSQKECDLLEYLKDDPAMKQIVLQKILDKQTNEDEDTVSSTSSSAPQKPDDFQDSQDPYEF
Ga0268246_1016180913300030495AgaveAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYYLFDEAQAPITPIKKESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNVDDDTVSSASSSSPPKPEDFQNSQDPYEL
Ga0268246_1017073023300030495AgaveMFGCLTMLLPAEAQAGWSYWVQMSNFDLYMNDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKIKWWAEFKTRLCCKENVEHFCKTGKRKFTLHNYHLFDKTKAPLTPTKKEVKQDQSSSSSAKSKARGLSQKERDLLEYLKDDPS
Ga0268246_1017952013300030495AgaveMFSYLTMLLPAEAQEGWTFWSQVSTNMDLYMKDVQFFKNFNVAWIFSWKYRLQPFLPHPYPLSLVRVYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREVKQEKSSSSSTKSKAQGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTHSDDDTISSASSSSPPKPEDFQDSQDPYE
Ga0268246_1019454213300030495AgaveMLLPAEAQEGWTFWVQTSNMDLYMKDVQFFKNFNVAWIFSWEFRLYPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFEKAKALVTPSKKEVKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQSHSDDETVSS
Ga0268246_1020250913300030495AgaveMFGCLTMLLPAEAHEGWTYWLQVSNLDLYMKDVQFFKTFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKAKLCGKENVEHFCKYGKRKFTLHNYHLFEKAQAPITPSKKESKQEKSSSSSTKSQARGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNEDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268246_1021927113300030495AgaveASTNLKLYMKDVQFFKHFNVAWIFSWEYRLQHFLPNPYPLSFVRIYKVKWWSEFKTRLCGKENVEYFCQTNKKKFTLHNLHLFETKAIAPATPVKREKREPSSSSSTKFRAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268246_1023352213300030495AgaveKEVQFFKQFNVAWIFCWEYRLHQYLPAPYPLSLVRFYKIKWWNEYKSNLCGKENVEHFCRTNTKKFTLHNLQRFEKKSKIAPATPTKKESSSSSTKSKAKGLSQKERDLVEYLKDDPNMRQIVLQKILDKKGDSEDDKTVSSAASSSPPKPGDHCLQDS
Ga0268246_1024502013300030495AgaveWEYRLQPFLPHPYPLSLVRIYKIKWLPEFKTRLCGKENVEYFCKQGKRKFTLHNLHLFEKAKAPATPVKQDIKREKSSSSSTKTKAKGLLQKEKELLEYLKDDSGMKQIVLQKILDKQGDSDEDTVSSAASSSPPKPEDLQDSQDPYDL
Ga0268246_1026147313300030495AgaveWEYRLQPFLPHPYPLSLVRIYKIKWWPDFKTRLCGKENVEFFCKQGKRKFTLHNLHLFEKAKAPTTPSKQDDKRDKSSSSSAKIKAKGLSQKERDLLEYLKDDPSMKQIVLQKILDKHGNSDEDTVSSAASSSPPKPDDLQDSQDPYDL
Ga0268247_1001009123300030498AgaveVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTKPCGKENVEHFCKYGKRKFTLHNYHLFDKAQAPITPIKRESKQEMSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNVDDDTVSSASSSSPPKPEDFQDSRDPYEL
Ga0268247_1002778143300030498AgaveMIFPSEAKEGWDYWSQATTIMEPYMKDVQFFNQFNVAWIFCWEYHLQNFLPTPYPLSLVRIYKVKWWTEFKSHLCGKENVEYFCKTNKKKFTLHNVHLFEKTKMAPAMPTKKESSSSSTKTKAKGFSQKEKELLEYLKDDPDMRQIVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDPYAL
Ga0268247_1004809813300030498AgaveFFKQFNVAWIFSWEYRLQPFLPNPYPLSLVRIYKVNWWSEFKTRLCGEENVEDFCRTNKKKFTLHNLYLFEKTKIAPATPSKKEVKQEKSSSSSTKPKAKGLSQKECDLLEYLKDDPAMKQIIFQKILDKQTNSDDETVSLVASSSPPKLEDFQDSQDPYEL
Ga0268247_1005849533300030498AgaveMKDVHFFTQFCVAWIFSWEYQLQSFLPRPYPLSLVRIYKIKWWPEFKTQLCGKENVEYFCKNGKRKFTLHILHLFVKSMVAPATPTKKDVKREKSSSSSTKTKTKGLSQKERDLLEYLKNDPSMKQTVLQKILDKQGNSDDDTVSSAALSSPPKPEDLQNSQDPYDL
Ga0268247_1010168413300030498AgaveMFGCLTMLLPAEAQEGWTYWLQVSNLDLYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKAKLCGKQNVEHFCKYGKRKFTLHNYHLFDKTQAPITPSKKESKQEKSSSSSTKSQARGLSQKERDLLEYLKDDPAIKQIVLQKILDKQTNDDEDTVSSTSSSAPPKPDDFQDSQDPYEF
Ga0268247_1011365923300030498AgaveMLLPVEAQEGWTYWSQISTNMDLYMKDVQFFKNFNVAWIFSWEYWLQPFLPHPYPLSLVRIYKVKWWPEFKTKLCGKENVEHFCKHGKRKFTLHNLHLFDKAKAPTTPIKREVKQEKSSSSSTKSKARGLSQKERDLLEYFKDDPSMKQIVLQKILDKQTNTDDDTVSSASSSSPPKLEDFQDSQDPYEL
Ga0268247_1012339213300030498AgavePFLRHPCPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYHLFDKAPPPITPIKKESKQEKSSSSSTKSQAKGLSQKERDLLEFLKDDPSMKQIVLQKILDKQINVDDDTVSSASSSSPPKPEDFQDSQDPYEL
Ga0268247_1013152323300030498AgavePYMKDVQFFNQFNVAWIFCWEYRLQNFLPTPYPLSLVQIYKAKWWTEFKSRLCGKENVEYFCKTNKKKFTLHNLHLFEKTKLAPATPTKKESSSSSTKTKAKGLSQKEKELLEYLKDDPDMRQVVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDPYEL
Ga0268247_1013990013300030498AgaveTMFGCLTILLPTEAKEGWDYWSQASTNLELYMKDVQSFKQFNVAWIFSWEYRLQHFLPNPYPLSLVCIYKVQWWSEFKTRLCGKENVEYFCRTNKKKFTLHNLHLFETSKAIAPATPIKREKKEQSSPSSTKLKAKGISQKERDLLEYLKDDPSMKQIVLQKILDKQGDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268247_1014081223300030498AgaveMFGCTPVIFPTEAKEGWDYWSQATLTMKPYMKDVHFFRQFNVAWIFSWEYRLQHFLPHPYPLSLVRFYKIKWWPEFKARLCGKENVEYFCKHGKRKFTLYNLYLFEKPKVAPATPSKKEAKMEKSSSSPTKTKAKGLSQKERDLLDYLKDDPDMKQIVFQKVLSKQGDSDDETVSSAASSSPPKPEDFQDSQDPNEL
Ga0268247_1014263613300030498AgaveFCWEYRLHQYLPAPYPLSLVRFYKIKWWNEYKSNLCGKENVEHFCRTNTKKFTLHNLQRFEKKSKIAPATPTKKESSSSSTKSKAKGLSQKERDLVEYLKDDPNMRQIVLQKILDKKGDSEDDKTVSSAASSSPPKPGDHCLQDS
Ga0268247_1016824713300030498AgaveVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYHLFDKTQAPITPSKKESKQEKSSSSSTKFQARGLSQKERDLLEYLKDDPAMKQIMLQKILDKQTNEDDDTVSSTSSSAPPKPEDFQDSQDPYEL
Ga0268247_1017957113300030498AgaveMFGCTPVIFPMEAREGWDHWLKSTLTMEPYMKDVHFFRQFCVAWIFSWEYRRQSFLPHPYLLSLVRVYKIKWWPEFKTQLYGKENVEYFCKNGKRKFTLHKLHLFVKAKVAPAAPTKKDVKXEKSSSSSTKTKTKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNSDDDTVSSAASSSPPKPDDLQNSQDPYDL
Ga0268247_1019405123300030498AgaveLGILSATISPPPYPLSLVRVYKIKWWPEFKTQLCGKENVDYFCKNGKRKFTLHNLHLFVKSKVAPATLAKKEVEREKSYSSSTKTKAKGQSQKERDLLEYLKDDPSMKQIVLQKILDKQMESDDEIVSSAASSSPLKQEDLQDSQDPYDL
Ga0268247_1020274613300030498AgaveMFGCLTILLPAEAKEGWDYWSQANINLELYMKDVQFFKQFNVGWIFSWEYRLQHFLPNPYTLSLVRIYKIKWWTEFKTRLCDKENVEYFYRTNKKKFTLHNLHLFETSKAIAPITPVKREKKEQSSSSSAKLKARGLSQKERDLLEYLKHDPSMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQ
Ga0268247_1023685723300030498AgaveMLLPKEAQEGWTHWSHVSTNMDLYMKDVLFFKTFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFDKAKEPTTPIKREVKQEKSSSSSTKSKARGLSQNERDLLEYLKDDPSMKQIVLQKHLDKQTNSDDDTISSASSFSPPKP
Ga0268247_1027868913300030498AgaveWWSEFKTRLCSKENVAYFCKTGKRKFTLHNVHLFEKTKVAPATPAQKYTKKEHSSSSSTKPKNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTNSDEDTVSSAASSSPPKPEDFQDSQDPYEL
Ga0268247_1028233813300030498AgaveHWWTMFGCTPVIFPMEAREGWDHWLKATLTMEPYMKDVHFFRQFCVAWIFSWEYRMQSFLPHPYPLSLVRVYKIKWWPEFKTQLCGKENVEYFCKNGKSKFTLHNLHLFVKAKVAPATPTKKDVKREKSSSSSTKTKTKGLSQKERDLLEYLKDDPSMKQIVIQKILDKQGNSDDDTVSSAASSSPPKPDDLQDSQDPYEL
Ga0268247_1031597213300030498AgaveYHWWTMFGCLTMLLPAEAQEGWSYWVQMSNLDLYMKDVLFFKNFNVAWIFSWEFQLQHFLPHPYPLSLVRIYKVKWWTEFKTRLCCKENVEHFCKTGKRKFTLHDYHLFDKTKAPLTPTKKEVKQDQSSSSSAKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNAEDETASSASSSSPPKPEDFQDSQDPYEF
Ga0268247_1031853613300030498AgaveIFSWEYRLQSFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFYKYGKRKFTLHNYHLFDKAQAPITPSKKESTHEKSSWSSTKSKARGLSQKERDLLEYLKDDSSMKQLVLQKILDKQTNVDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268247_1032826213300030498AgaveMFGCLTMLLLAEAQEGWTYWSQVATNMDLYMKDVQFSKNFNIAWIFSREYRLQPFLPHPYPLSLVHIYKFKXWPEFKTRLCGKENVEHFCKHGKRKFTLHDLHLFDKAKEPTTPIKREDKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTKSDDDTISSASSSSPPM
Ga0268247_1034628313300030498AgaveFSMEAREGWDFWLKATLTMDPYMKDVHFFRQFCVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEFFCKQGKRKFTLHNLHLFEKAKAPATPSKQDVKKEKSSSSSAIIKAKGFSQKEKDLLEYLKDDPGMKQIVLQKILDKHCNSDEDTVSSAASSSPPKPDDLQDSQDPYEL
Ga0268247_1034894313300030498AgaveFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKAKLCGKENVEHFCKYGKRKFTLHNYHLFEKAQAPITPSKKESKQEKSSSSSTKSQARGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNEDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268247_1037900623300030498AgaveWLQVSNLDLYMKDVQFFKNFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKPCCKENVEHFCRYGKRKFALYNYHLFDKAQAPITPIKRESKQEMSSSSSTKSKARRLSQKEHDLLDYLKDDPSMKQIVLQKILDKQTNVDDETVSSASSSSPPKPEDFQDSQDPYEL
Ga0268247_1039527313300030498AgaveSVWFFHWWTMFGCTPVIFPMEAREGWDHWLKATLTMEPYMKDVHFVXQFCVAWIFSWEYRLQSFLPHPCPLSLVRVYKIKWXPEFKTQLCGKENVEYFCKNGKRKFTLHNLHLFVKAKVAPATPTKKDVKREKSSSSSTKTKTKGLSQKECDLLEYLKDDPSMKQIVLQKILDKQGNSDDDTVSSAASSSPPKPDDLQDSHDPYEL
Ga0268247_1042775913300030498AgaveVSNLDLYMKDVQFFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCRYGKRKFTLHNYHLFDKAQALITPIKRESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVPQKILDKQTNVDDDTVSSASSSSPPKPEDFHDSQDPYEL
Ga0268247_1042898213300030498AgaveLSLVHIYKIKWWSEFKTRLCGKENVEYFCKTNKKKFTLHNLHLFEKLKLAPATPTKKEKSSSSSLRTKAKGLSQKEKDLLEYLKDDPGMKQIVLQKILDKQADSDDDTVSSVASSSSPKPEDLQDC
Ga0268247_1044452213300030498AgaveCLQHFLPNPYPLSLVRIYKVKWWNEFKTRLCGKENVEYFCHTNKKKFTLHNLHLFETSKAVAPATPIKREKNEQSSSSSTKFKAKGLSQKEQDLLEYLKDDPSMKQIVQQKILDKQGNADDETVSSASSSSPPKPEDFQDSQDPYEL
Ga0268247_1054197013300030498AgaveAKAHEGWIYWSQVSTNLDLYMKDVQFFKHFNVAWIFSWEYQLQPFLPHPYPLSLVRIYKVKWWSEFKTKLCGKENVEHFCKYGKRKFTLHNYHLFDKAQAPITPSKKESKQEKSSSSSTKSKARGLSQKERDLLEYLKDDPSMKQLVLQKILDKQTTVDDDTVSSASSSAPPK
Ga0268255_1010886923300030516AgaveMLFPVEAQDGWLYWNQTATNIELYMRDVQFFKQFNVAWIFSWEYRLQHFLPHPYPLSLVRIYKVKWWSEFKTRLCSKENVAYFCKTGKRKFTLHNVHLFEKTKIAPATPSQKDTKKEHSSSSSTKPKNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTNSDEDTVSSAASSSPPKPEDFQDSQDPYEL
Ga0268255_1021288623300030516AgaveCRLQPFLPHPYPLSLVRIYKVKWWSEFKAKLCGKENVEHFCKYGKRKFTLHNYHLFNKTQAPITPSKKESKQEKSSSLSTKSKAKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNEDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268250_1073802713300030692AgaveWTMFGCLTMLLPTEAQKGWLHWSQMTTNMDLYMKDVQLFKNFNVAWIFSWEYRLQPFLPHPYPLSLVRIYKVKWWPEFKTRLCGKENVEHFCKHGKRKFTLHNLHLFDKAKEPTTSIKWEDKQEKTSSSSIKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTKSDDDTISST

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.