NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079524

Metagenome Family F079524

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079524
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 41 residues
Representative Sequence MENYIQAEDYELWMLIKNGPLIPKVTKEDGKVIIKKPEEF
Number of Associated Samples 11
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 88.29 %
% of genes near scaffold ends (potentially truncated) 75.65 %
% of genes from short scaffolds (< 2000 bps) 93.04 %
Associated GOLD sequencing projects 7
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (84.348 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(75.652 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.59%    β-sheet: 8.82%    Coil/Unstructured: 70.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF14223Retrotran_gag_2 20.87
PF00098zf-CCHC 0.87



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.35 %
UnclassifiedrootN/A15.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006020|Ga0058704_10004572Not Available6214Open in IMG/M
3300006020|Ga0058704_10262346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta979Open in IMG/M
3300006020|Ga0058704_10359846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta838Open in IMG/M
3300006020|Ga0058704_10375842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon820Open in IMG/M
3300006020|Ga0058704_10400888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon794Open in IMG/M
3300006020|Ga0058704_10423307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon773Open in IMG/M
3300006020|Ga0058704_10444408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon754Open in IMG/M
3300006020|Ga0058704_10554654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon674Open in IMG/M
3300006020|Ga0058704_10571023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum664Open in IMG/M
3300006020|Ga0058704_10572761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon663Open in IMG/M
3300006020|Ga0058704_10597011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max649Open in IMG/M
3300006020|Ga0058704_10647855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max622Open in IMG/M
3300006020|Ga0058704_10666433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana attenuata613Open in IMG/M
3300006020|Ga0058704_10723698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max587Open in IMG/M
3300006020|Ga0058704_10776062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max566Open in IMG/M
3300006020|Ga0058704_10794461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta559Open in IMG/M
3300006020|Ga0058704_10805132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida555Open in IMG/M
3300006020|Ga0058704_10848075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon540Open in IMG/M
3300006020|Ga0058704_10891203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon526Open in IMG/M
3300006020|Ga0058704_10907309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max521Open in IMG/M
3300009144|Ga0058702_10093282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana1143Open in IMG/M
3300009144|Ga0058702_10174422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae837Open in IMG/M
3300009144|Ga0058702_10234739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae725Open in IMG/M
3300009144|Ga0058702_10266298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon682Open in IMG/M
3300009144|Ga0058702_10296320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon649Open in IMG/M
3300009144|Ga0058702_10372789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae582Open in IMG/M
3300009144|Ga0058702_10396162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta566Open in IMG/M
3300009144|Ga0058702_10455499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae530Open in IMG/M
3300009144|Ga0058702_10470353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon522Open in IMG/M
3300009144|Ga0058702_10483356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana attenuata516Open in IMG/M
3300009144|Ga0058702_10509135Not Available504Open in IMG/M
3300009144|Ga0058702_10512876Not Available502Open in IMG/M
3300010395|Ga0058701_10073242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae2791Open in IMG/M
3300010395|Ga0058701_10076878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon2699Open in IMG/M
3300010395|Ga0058701_10142062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon1739Open in IMG/M
3300010395|Ga0058701_10172753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae1503Open in IMG/M
3300010395|Ga0058701_10203551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1328Open in IMG/M
3300010395|Ga0058701_10272390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae1067Open in IMG/M
3300010395|Ga0058701_10341049Not Available902Open in IMG/M
3300010395|Ga0058701_10348829Not Available888Open in IMG/M
3300010395|Ga0058701_10370445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae850Open in IMG/M
3300010395|Ga0058701_10416921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon781Open in IMG/M
3300010395|Ga0058701_10421678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon774Open in IMG/M
3300010395|Ga0058701_10435033Not Available758Open in IMG/M
3300010395|Ga0058701_10468988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon719Open in IMG/M
3300010395|Ga0058701_10527173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon664Open in IMG/M
3300010395|Ga0058701_10532560Not Available660Open in IMG/M
3300010395|Ga0058701_10576052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Oxalidales → Cephalotaceae → Cephalotus → Cephalotus follicularis627Open in IMG/M
3300010395|Ga0058701_10577654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae626Open in IMG/M
3300010395|Ga0058701_10596657Not Available613Open in IMG/M
3300010395|Ga0058701_10601065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta611Open in IMG/M
3300010395|Ga0058701_10608994Not Available606Open in IMG/M
3300010395|Ga0058701_10610942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae604Open in IMG/M
3300010395|Ga0058701_10647686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana583Open in IMG/M
3300010395|Ga0058701_10731383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida542Open in IMG/M
3300010395|Ga0058701_10738224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon539Open in IMG/M
3300010395|Ga0058701_10761428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta529Open in IMG/M
3300010395|Ga0058701_10779520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae522Open in IMG/M
3300010395|Ga0058701_10796881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana516Open in IMG/M
3300010395|Ga0058701_10824694Not Available506Open in IMG/M
3300027718|Ga0209795_10080080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana949Open in IMG/M
3300027766|Ga0209796_10197712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae637Open in IMG/M
3300030495|Ga0268246_10114284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae791Open in IMG/M
3300030495|Ga0268246_10147503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon693Open in IMG/M
3300030495|Ga0268246_10192561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon605Open in IMG/M
3300030495|Ga0268246_10223992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae562Open in IMG/M
3300030495|Ga0268246_10230184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon554Open in IMG/M
3300030495|Ga0268246_10257320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae525Open in IMG/M
3300030495|Ga0268246_10267971Not Available515Open in IMG/M
3300030495|Ga0268246_10271513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon511Open in IMG/M
3300030495|Ga0268246_10284388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana500Open in IMG/M
3300030498|Ga0268247_10032276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2030Open in IMG/M
3300030498|Ga0268247_10063783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae1570Open in IMG/M
3300030498|Ga0268247_10239190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon840Open in IMG/M
3300030498|Ga0268247_10249465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon821Open in IMG/M
3300030498|Ga0268247_10260571Not Available801Open in IMG/M
3300030498|Ga0268247_10275803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana776Open in IMG/M
3300030498|Ga0268247_10277082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana774Open in IMG/M
3300030498|Ga0268247_10279079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae771Open in IMG/M
3300030498|Ga0268247_10315061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae719Open in IMG/M
3300030498|Ga0268247_10364252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana attenuata661Open in IMG/M
3300030498|Ga0268247_10368725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae657Open in IMG/M
3300030498|Ga0268247_10374159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae651Open in IMG/M
3300030498|Ga0268247_10390911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon635Open in IMG/M
3300030498|Ga0268247_10394758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon631Open in IMG/M
3300030498|Ga0268247_10403052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon623Open in IMG/M
3300030498|Ga0268247_10407625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum619Open in IMG/M
3300030498|Ga0268247_10419596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta608Open in IMG/M
3300030498|Ga0268247_10436903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon594Open in IMG/M
3300030498|Ga0268247_10471655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon567Open in IMG/M
3300030498|Ga0268247_10475565Not Available565Open in IMG/M
3300030498|Ga0268247_10484397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon558Open in IMG/M
3300030498|Ga0268247_10492537Not Available553Open in IMG/M
3300030498|Ga0268247_10496158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae550Open in IMG/M
3300030498|Ga0268247_10503246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon546Open in IMG/M
3300030498|Ga0268247_10508746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae542Open in IMG/M
3300030498|Ga0268247_10517352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae537Open in IMG/M
3300030498|Ga0268247_10523479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana533Open in IMG/M
3300030498|Ga0268247_10549262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae518Open in IMG/M
3300030498|Ga0268247_10581711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon500Open in IMG/M
3300030501|Ga0268244_10239521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana904Open in IMG/M
3300030501|Ga0268244_10293253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta828Open in IMG/M
3300030501|Ga0268244_10476367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon666Open in IMG/M
3300030501|Ga0268244_10478678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon665Open in IMG/M
3300030501|Ga0268244_10570401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae613Open in IMG/M
3300030501|Ga0268244_10663970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max571Open in IMG/M
3300030501|Ga0268244_10736388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana attenuata544Open in IMG/M
3300030501|Ga0268244_10819741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae517Open in IMG/M
3300030514|Ga0268253_10025089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon1444Open in IMG/M
3300030514|Ga0268253_10251581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon595Open in IMG/M
3300030516|Ga0268255_10116211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana797Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave75.65%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave24.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030497Agave microbial communities from Guanajuato, Mexico - Mg.Sf.rz (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058704_1000457273300006020AgaveMENYIQAEDYELWMLIKNGPLIPTKVIEDGSRVHK
Ga0058704_1026234623300006020AgaveMENYVQADDYELWMIIKNGPLIPKKTIEDGSMVPKKPQEFMP*
Ga0058704_1035984623300006020AgaveMENYIQAEDYELWMLIKNGPLIPMKITEDRKSTPKEPKEFNAED*
Ga0058704_1037584223300006020AgaveMENYIQAEHYELWMLIKNGPLVPTKVLEDGKKVPKEPVEFDAEDYKKM
Ga0058704_1040088813300006020AgaveMENYIQVEDYELWMLIKNGPLIPTKVIEDGSKVHKKPEE
Ga0058704_1042330713300006020AgaveMKNYIHAEDYELWMLIKSGPLIPTKVIEDGSKVHKEPQE
Ga0058704_1044440823300006020AgaveMENYIHAEDYELWMLIKSGPLIPTKVIEDGSKVHK
Ga0058704_1055465423300006020AgaveMENYIQAEDYELWMLIKNGPLIPTKVIEDGSKVHKKP
Ga0058704_1057102313300006020AgaveMENYIQAEDYELWMLIKDGPLIPKKTTEDGKSTPK
Ga0058704_1057276133300006020AgaveMENYIQAEDYELWMLIKNGPLIPKKITEDGKSIPK
Ga0058704_1059701113300006020AgaveMENYIQAEDYELWMLIKSGPLIPTKVIEDGSKVHKKPEEFNADD
Ga0058704_1064785513300006020AgaveMENYIQAEDYELWMLIKNGPLIPTKVIEDGSRVHKK
Ga0058704_1066643313300006020AgaveMENYIRAEDYELWMLIKNGPLVPTKVLEDGKKVSKEPKEFDAEDY
Ga0058704_1072369813300006020AgaveMENYIQAEDYEFWMLIKNGPLVPTKVLEDGKKVPKEPVEFDAEDYK
Ga0058704_1077606213300006020AgaveMENYIQAEDYELWMFIKNGPLVPTKVLEDGKKVPKEPVEFDAEDYKKMEKNANAKKLL
Ga0058704_1079446113300006020AgaveMENYIQAEDYELWMLIKNGPLIPKKITEDGKSIPKEP
Ga0058704_1080513223300006020AgaveMENYIQAEDYELWMLIKNGPLIPMKEIEDGSKVHKKPEEFNARTLR*
Ga0058704_1084807523300006020AgaveMENYVQADDYELWMIIKNGPLIPKKTVEDGKTIPKEPQE
Ga0058704_1089120323300006020AgaveMENYIQAEDYELWMLIKSGSLIPTKVIEDGSKVHKKPEEFNAD
Ga0058704_1090730913300006020AgaveMENYNQAEDYELWMLIKNGPLVPTKVIEDGKKVPKEPKEFDAED
Ga0058702_1009328233300009144AgaveMENYIQAEDYELWMLIKNGPLIPMKIKEDGTKVKKKPQ*
Ga0058702_1017442213300009144AgaveMDNYIQAEDYELWMLIKNGPLIPTVTKEDGKVIIKKPESLMVMIIR*
Ga0058702_1023473913300009144AgaveMENYIQAKDYELWMLIKNGPLVPKKTKEDGTTIIKK
Ga0058702_1026629813300009144AgaveMENYIQAEDYELWMLIKNGPLIPTKVIEDGSIVHKQPDEFN
Ga0058702_1029632013300009144AgaveMENYIQAEDYELWMLIKNGPLVPKMTQEDGTTVIKKPEEF
Ga0058702_1037278913300009144AgaveMVENYIQAEDYELWMLIKNGPLIPKKATEDGKIISKKP*
Ga0058702_1039616213300009144AgaveMKNYIQAEDYELWMLIKNGPLIPTKVTANETKVRKEPN
Ga0058702_1045549923300009144AgaveMENYIQVEDYELWMLIKDGPLIPKKTTEDEKSTPKVSKEFN
Ga0058702_1047035313300009144AgaveMENYIQAEDYELWMLIKNGPLIPKVIKEDGKVIIKKPEEFD
Ga0058702_1048335613300009144AgaveMENYIKADDYELWMLIKNGPLIPKKATENGSLVPKRPEEFNAEDFRMI*
Ga0058702_1049707213300009144AgaveMENYIQAEDYELRMLIKNGPLVLKKSKEDGTAAVKKPKEFDSEDYKMMETNAKAKKLLY
Ga0058702_1050913513300009144AgaveMENYIQSEDYEL*MLIKNGPLIPVKVNEDGTKSKKK
Ga0058702_1051287613300009144AgaveMENYIQAEDYKLWMLINNGPLIPTKVVEDGIEVHKQPD
Ga0058701_1007324233300010395AgaveMEKYIQADDYELWRIIENGPLIPKKATEDGKVVPKKP*
Ga0058701_1007687813300010395AgaveMENYIQAEDYELWMLIKNGPLVPKKTKEDGTIIIKKPEEFDSEDYKMMEKN
Ga0058701_1014206223300010395AgaveMVENYIQAEDYEIWMLIKNGPLIPKKATEDGKIIAKKP*
Ga0058701_1017275343300010395AgaveMVNIIVGGKNRMQNFIQAEDYELWMLIKNGPLIPTKIIEDGTEEFNAEA*
Ga0058701_1020355123300010395AgaveMENYIQPDDYEVWMIIKNGPLIPKKATEDGKIVPNEP*
Ga0058701_1027239013300010395AgaveMESYIQAEDYELWMLIKNGPVIPAKVIEDGSKVHKKPEEFNAED
Ga0058701_1034104913300010395AgaveMENYIQAEDCELWMLIKNGPLIPIKVKEDDTTVKKKPE
Ga0058701_1034882923300010395AgaveMENYIQAEDYELWMLIKNGPLIPKRIKEDGTFIIKK
Ga0058701_1037044513300010395AgaveMENYIQAEDYELWMLIKNGPLIPMKVKEDGTKVKKAPEEF
Ga0058701_1041692113300010395AgaveMENYIQAEDYELWMLIKNGPLIPTVTKEDGKVIIKKPEEF
Ga0058701_1042167813300010395AgaveMENYIQAEDYELWMLIKNGPLIPTVTKKDGKVIIKKP
Ga0058701_1043503313300010395AgaveMGNYIQADDYELWMLIKNGPLILKKATEDGKIIPKKPCLGSNLA*
Ga0058701_1046898813300010395AgaveMKNYIQVEDYKLWMLIKNGPLIPTVTKEDGKVIIKKPEEFDGDDY
Ga0058701_1052717333300010395AgaveMENCIQAEDYELWMLIKNGPLIPTKVIEDGSIVHKQPDEFNAEDF
Ga0058701_1053256013300010395AgaveMENYIQTEDYELWMLIKNGPLIPKRIKEDGTSIIKKPEEFDGEDYKMMEKNA
Ga0058701_1057605213300010395AgaveAEDYELWMLIKNGPLIPKKTKEDSTTIVKKPKRI*
Ga0058701_1057765413300010395AgaveMENYIQAEDYELWMLIKNGPLVPKKAKEDGTTIINKP*
Ga0058701_1059665713300010395AgaveMENYIQAEDNELWMLIKNGPLIPKRIKEDGIAVVKK
Ga0058701_1060106533300010395AgaveMENYIQAEDYELWMLIKKGPLIPKKTKEDDTIIIK*
Ga0058701_1060899423300010395AgaveENYIQAEDYELWMLIKNGPLVPKKTKEDGTTIIKKPLGI*
Ga0058701_1061094223300010395AgaveMENYVQAEDYELWMLIKNGPLIPKMTKEDGTTIIRKP
Ga0058701_1064768623300010395AgaveYIQAEDYELWMLIKNGPLIPMKIKEDGTKVKKKPQ*
Ga0058701_1072255113300010395AgaveMENYIQGEDYELWMLIKNGPLIPKKTKEDGTIIIKKPEEFDSEDYKMMEKN
Ga0058701_1073138323300010395AgaveGWWKNKMENYIQAEDYELWMLIKNGPLVLKNTEEDGTTIIKKPE*
Ga0058701_1073822423300010395AgaveMENYIQAEDYELWMLIKSGPLIPMKVNEDGTTTKKKPEEFNSDDFKISR*
Ga0058701_1076142823300010395AgaveMENYVQAYDYELWMIIKNGPLIPKKTTEDGKVVPKKP*
Ga0058701_1077952013300010395AgaveMENYIQAEDYELWMLIKNGPLVPKMTKEDGTIVIKKSEEFNSEDYKMVEKN
Ga0058701_1079688123300010395AgaveWKNRMENYIQAEDYELWMLIKNGPLIPKVIKEDGKVIIKKP*
Ga0058701_1082469423300010395AgaveMVAAYIQAEDYELWMLIKNGPLIPKRIKEDGTTVMKKPEE
Ga0209795_1008008013300027718AgaveYIQAEDYELWMLIKNGPLVLKNTEEDGTTIIKKPE
Ga0209796_1019771213300027766AgaveMENYIQAEDYELWMLIKNGPLVPKKIKEDGTTIIK
Ga0268246_1011428413300030495AgaveMVENYIQAEDYELWMLIKNGPLIPKKATEDGKIISKKP
Ga0268246_1014750313300030495AgaveMENYIQAEDYELWMLIKNGPLIPTVTKKDGKVIIK
Ga0268246_1016790713300030495AgaveMENYTQVDDYELWMIIENGALVPKKAAEDRKVVPKKPQEFN
Ga0268246_1019256113300030495AgaveMENYIQAEDFELWMLIKNGPLIPKVTKEDGKMIIKKPEEFDSEDYK
Ga0268246_1022399213300030495AgaveMENYIQAEDYELWMLIKNGPLIPKKTKEDGTTVVKKEAKRI
Ga0268246_1023018423300030495AgaveMENYIQAEDYELWMLIKNGPLIPIKVNEDGTTIPKKLEEFTIEDYKMMEK
Ga0268246_1025732013300030495AgaveMEDYIQVEDYELWMLIKNGPLIPKRIKENGAVVVK
Ga0268246_1026797123300030495AgaveMENYIQAEDYELWMLIKNRPPLIPTKVIENGTAVRKAPNE
Ga0268246_1027151313300030495AgaveMDNYIQAEDYELWMLIKNGPLIPTVTKEDGKVIIKKPESLMVMIIR
Ga0268246_1028438813300030495AgaveMENYIQAEDYELWMLIKNGPLILTKVIEDGSIVHRQPNEFNAEDFKMMEK
Ga0268252_110168313300030497AgaveDYELWMLIKSGPLIPTKVIEDGSKVHKKPEEFNADDFKMM
Ga0268247_1003227633300030498AgaveMENYIQAEDYELWMLTKNGPLIPTKVIEDGTEVHKQP
Ga0268247_1006378313300030498AgaveMENYIQAEDYELWMLINNGPLIPVKVKKDGTTVKKKPEE
Ga0268247_1023919013300030498AgaveMENYIQAEDYELWMLIKNGPLIPVKVNEEGKAIKKKPEEFDSTD
Ga0268247_1024946513300030498AgaveMENYIQAEDYELWMLIKNGPLVPKMTKEDGTTVIKKPEEFNSEDYKMMEK
Ga0268247_1026057113300030498AgaveMVENYIQAEDYEIWMLIKNGPLIPKKATEDGKIIAKKP
Ga0268247_1027580313300030498AgaveMKNYIQAEDYELWMLIKNGPLIPTKVTEDGTEVYKQPGAF
Ga0268247_1027708223300030498AgaveMENYIQAEDYELWMLIKNGPLIPKVIKEDGKVIIKKP
Ga0268247_1027907913300030498AgaveMENYIQAEDYELWMLIKNEPLIPKRIKEDGTAVVKKPEEFNGED
Ga0268247_1031506113300030498AgaveMENYIQAEDYELWMLIKNGPLIPMKVNEDGTTSKKKPE
Ga0268247_1036425213300030498AgaveMENYIQAEDYELWMLIKNGPLIPKRIKEDGTAVVKKPEKFDSNDF
Ga0268247_1036872513300030498AgaveMENYIQAEDNELWMLIKNGPLILVKITEEGKSIRKKPKEFDSTD
Ga0268247_1037415923300030498AgaveMENYIQAEDYELWVLIKNXPLVPKKTKEDGTIVVKKPERIX
Ga0268247_1039091113300030498AgaveMENYIQTEDYELWMLIKNCPLVPKVIKEDGKVIIKKPEEFDSEDYRM
Ga0268247_1039475813300030498AgaveMENYIQAEDYELWMLIKNGPLIPKVTKEDGKVIIKKPEEF
Ga0268247_1040305213300030498AgaveMENYIQVEDYELWMLIKNGPLVPKKTKEDDTTVVKK
Ga0268247_1040762513300030498AgaveMENYIQAENYKLWMLIKNGPLIPMKVNEDDTKTHKK
Ga0268247_1041959613300030498AgaveMENYIQAEDYELWMLIKNGPLIPKRIKEDGTAVIKK
Ga0268247_1043690313300030498AgaveMEDYIQAEDYELWMLIKNGPLVPKMTKEDGAVVVKKP
Ga0268247_1047165513300030498AgaveMENYIQAEDYELWLLIKNGPLIPTVTKEDGKVIIK
Ga0268247_1047556513300030498AgaveMENYIQAEDYELWMLIKNGPLIPIKVKEDGTTIPKKLEEFT
Ga0268247_1048439723300030498AgaveMENYIQAEDYELWMLIKNGPLIPKVTKEDGKVIIKKPEEFDSDRL
Ga0268247_1049253713300030498AgaveMENYIQAEDYELWILIKNGTRVPKRIKEDGTSIIKKPEEFDGEDYKM
Ga0268247_1049615813300030498AgaveMENYIRANDYELRMLIKNGPLTSKKVTEDGEDYSQET
Ga0268247_1050324613300030498AgaveMENYIQAEDYELWMLIKNGPLIPKVIKEDGNVIIKKPEEFDS
Ga0268247_1050874623300030498AgaveMENYIQVEDYELWMLIKNGLLVPKKTKEDGTTVLKKPEEFDSED
Ga0268247_1051735213300030498AgaveMENYIQTEDYELWMLIKNGPLIPKRIKEDGTAVVKK
Ga0268247_1052347913300030498AgaveMENYIQAEDYELWMLIKNGPLILIKAKEDGPIIHKKPEEFTAEDCKMMEKNA
Ga0268247_1054926213300030498AgaveMENYIQAEDYELWMLTKNGPLVPKKTKEDGTTIVKKL
Ga0268247_1058171113300030498AgaveMENYIQAEDYELWMLIKNGPLIPKVTKEDGKVIIKKPEEFDGDDYRM
Ga0268244_1023952133300030501AgaveMENYIQVEDYELWMLIKNGPLIPRKVIEDGSKVHKKPEEFNADDFKMM
Ga0268244_1029325323300030501AgaveMENYVQADDYELWMIIKNGPLIPKKTIEDGSMVPKKPQEFMP
Ga0268244_1047636713300030501AgaveMENYIQAEDYKLWMLIKNGPLIPTKVIEDGSKVHKKPEEFNA
Ga0268244_1047867813300030501AgaveMENYIQAEDYELWMLIKSGPLIPTKVIEDGSKVHKKPEEFNANDFK
Ga0268244_1057040113300030501AgaveMENYIQAEDYELWMLIKDGPLIPKKTTKDGKSILKE
Ga0268244_1066397013300030501AgaveMENYIQAEDYELWMLIKSGPLIPTKVIEDGSKLHKKPEEFNADDFKMME
Ga0268244_1073638813300030501AgaveMENYIQVEDYELWMLIKNGPFVPIKALPEGKTTPKEPHEFDAEDY
Ga0268244_1081974123300030501AgaveMENYIQAEDYELWMLIKNGPLVPMKALPDGTTVAK
Ga0268253_1002508913300030514AgaveMESYIQAEDYELWMLIKNGPLIPKKITADGNSIPKELKEF
Ga0268253_1025158113300030514AgaveMENYIQAEDYELWMLIKNGPLIPKKITEDGKSIPKEPK
Ga0268255_1011621113300030516AgaveMENYIQAEDYELWMLIKNGPLVLKNTEEDGTTIIKKPE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.