Basic Information | |
---|---|
Family ID | F079375 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 48 residues |
Representative Sequence | MAETQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTR |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.83 % |
% of genes near scaffold ends (potentially truncated) | 98.28 % |
% of genes from short scaffolds (< 2000 bps) | 91.38 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.448 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.483 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.621 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.931 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.57% β-sheet: 0.00% Coil/Unstructured: 82.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF03446 | NAD_binding_2 | 16.38 |
PF09084 | NMT1 | 12.93 |
PF02195 | ParBc | 10.34 |
PF14833 | NAD_binding_11 | 5.17 |
PF00355 | Rieske | 3.45 |
PF01541 | GIY-YIG | 0.86 |
PF07992 | Pyr_redox_2 | 0.86 |
PF04909 | Amidohydro_2 | 0.86 |
PF13379 | NMT1_2 | 0.86 |
PF00872 | Transposase_mut | 0.86 |
PF13520 | AA_permease_2 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 12.93 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 12.93 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.45 % |
Unclassified | root | N/A | 21.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000574|JGI1357J11328_10112490 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1034887 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300001372|YBBDRAFT_1258912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300002149|C687J26657_10130585 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300002485|C687J35088_10144336 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300003324|soilH2_10169325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2201 | Open in IMG/M |
3300003349|JGI26129J50193_1015355 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300004061|Ga0055487_10011953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1084 | Open in IMG/M |
3300004779|Ga0062380_10342988 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005093|Ga0062594_103296714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 507 | Open in IMG/M |
3300005181|Ga0066678_10468907 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300005218|Ga0068996_10038434 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005294|Ga0065705_11207047 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005295|Ga0065707_11109299 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005339|Ga0070660_101835872 | Not Available | 516 | Open in IMG/M |
3300005340|Ga0070689_100593820 | Not Available | 958 | Open in IMG/M |
3300005355|Ga0070671_100035687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4119 | Open in IMG/M |
3300005363|Ga0008090_15418539 | Not Available | 542 | Open in IMG/M |
3300005364|Ga0070673_101941593 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005441|Ga0070700_100776157 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300005457|Ga0070662_100078078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2458 | Open in IMG/M |
3300005457|Ga0070662_101957537 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005536|Ga0070697_100103560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2366 | Open in IMG/M |
3300005545|Ga0070695_101674199 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005546|Ga0070696_101624149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300005713|Ga0066905_101789784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300005718|Ga0068866_10785237 | Not Available | 661 | Open in IMG/M |
3300005764|Ga0066903_107975296 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005836|Ga0074470_11432456 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300006358|Ga0068871_101500554 | Not Available | 637 | Open in IMG/M |
3300006844|Ga0075428_100066002 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
3300006847|Ga0075431_100989027 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300006847|Ga0075431_101465955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300006854|Ga0075425_101324096 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300006865|Ga0073934_10249580 | Not Available | 1166 | Open in IMG/M |
3300006914|Ga0075436_100151565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1632 | Open in IMG/M |
3300009091|Ga0102851_10790896 | Not Available | 1013 | Open in IMG/M |
3300009100|Ga0075418_11456890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
3300009147|Ga0114129_10135901 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
3300009153|Ga0105094_10902715 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300009816|Ga0105076_1008071 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300010043|Ga0126380_12011701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
3300010046|Ga0126384_11823086 | Not Available | 578 | Open in IMG/M |
3300010398|Ga0126383_12177968 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300010401|Ga0134121_13097708 | Not Available | 513 | Open in IMG/M |
3300011438|Ga0137451_1072445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1027 | Open in IMG/M |
3300012200|Ga0137382_11184054 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012207|Ga0137381_10618725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 943 | Open in IMG/M |
3300012351|Ga0137386_10897334 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012532|Ga0137373_10991165 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300012884|Ga0157300_1050114 | Not Available | 655 | Open in IMG/M |
3300012893|Ga0157284_10281424 | Not Available | 537 | Open in IMG/M |
3300012898|Ga0157293_10038809 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300012922|Ga0137394_10314461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1338 | Open in IMG/M |
3300012929|Ga0137404_10485636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1100 | Open in IMG/M |
3300012957|Ga0164303_10046888 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1891 | Open in IMG/M |
3300012958|Ga0164299_11534568 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300013308|Ga0157375_13373680 | Not Available | 532 | Open in IMG/M |
3300014270|Ga0075325_1009313 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300014272|Ga0075327_1164570 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300014311|Ga0075322_1013759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1596 | Open in IMG/M |
3300014745|Ga0157377_10765710 | Not Available | 708 | Open in IMG/M |
3300014873|Ga0180066_1053305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
3300014883|Ga0180086_1058910 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300015264|Ga0137403_10149297 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300015371|Ga0132258_13638768 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300016357|Ga0182032_10663618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
3300017966|Ga0187776_10171738 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300018078|Ga0184612_10013475 | All Organisms → cellular organisms → Bacteria | 4160 | Open in IMG/M |
3300018079|Ga0184627_10435115 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300018084|Ga0184629_10006734 | All Organisms → cellular organisms → Bacteria | 4332 | Open in IMG/M |
3300018089|Ga0187774_11369535 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300018422|Ga0190265_12800880 | Not Available | 583 | Open in IMG/M |
3300018469|Ga0190270_12153231 | Not Available | 617 | Open in IMG/M |
3300018920|Ga0190273_11994996 | Not Available | 537 | Open in IMG/M |
3300019881|Ga0193707_1064882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1142 | Open in IMG/M |
3300020003|Ga0193739_1100614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
3300021081|Ga0210379_10328512 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300021560|Ga0126371_12615781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300025159|Ga0209619_10216594 | Not Available | 1062 | Open in IMG/M |
3300025326|Ga0209342_11020776 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300025550|Ga0210098_1027137 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300025901|Ga0207688_10434834 | Not Available | 817 | Open in IMG/M |
3300025910|Ga0207684_10873333 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300025933|Ga0207706_10161303 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
3300025933|Ga0207706_11312315 | Not Available | 598 | Open in IMG/M |
3300025940|Ga0207691_11499206 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300025959|Ga0210116_1106920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
3300025960|Ga0207651_11517694 | Not Available | 603 | Open in IMG/M |
3300025960|Ga0207651_11562040 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300026058|Ga0208421_1010215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
3300027056|Ga0209879_1026187 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300027637|Ga0209818_1128352 | Not Available | 695 | Open in IMG/M |
3300027843|Ga0209798_10223601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. 15-1 | 922 | Open in IMG/M |
3300027886|Ga0209486_10443949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 796 | Open in IMG/M |
3300027886|Ga0209486_10475590 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300027886|Ga0209486_10957488 | Not Available | 572 | Open in IMG/M |
3300027909|Ga0209382_10979656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 883 | Open in IMG/M |
3300027957|Ga0209857_1091830 | Not Available | 508 | Open in IMG/M |
3300028536|Ga0137415_11009104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
3300031731|Ga0307405_10143183 | Not Available | 1670 | Open in IMG/M |
3300031744|Ga0306918_10883375 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300031754|Ga0307475_10754486 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300031820|Ga0307473_11573409 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031824|Ga0307413_10852081 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031908|Ga0310900_11954867 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031965|Ga0326597_10822786 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300032180|Ga0307471_100299018 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300032180|Ga0307471_101613181 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300032180|Ga0307471_101692847 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300033289|Ga0310914_10622094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 973 | Open in IMG/M |
3300033406|Ga0316604_10647081 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300033407|Ga0214472_10152217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2266 | Open in IMG/M |
3300033513|Ga0316628_102991068 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300034115|Ga0364945_0163716 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300034148|Ga0364927_0224524 | Not Available | 558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.45% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.45% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.59% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.59% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.86% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.86% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.86% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.86% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.86% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.86% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
3300002149 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 | Environmental | Open in IMG/M |
3300002485 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1357J11328_101124902 | 3300000574 | Groundwater | MAEAQYLVGTVRPTNRPESGQELDLDTLIPAKIKF |
AF_2010_repII_A100DRAFT_10348871 | 3300000655 | Forest Soil | MPETQKEYVVGTVRPTNRPESGQEIDLDEKIPAKIKFLT |
YBBDRAFT_12589121 | 3300001372 | Marine Estuarine | MAESEKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTMNFTQGTPE |
C687J26657_101305851 | 3300002149 | Soil | MAEAQKEYLVGTVRPTNRPEAGQELDLEALIPAKIKFVS |
C687J35088_101443362 | 3300002485 | Soil | MAEAQKEYLVGTVRPTNRPEAGQELDLEALIPAKIKFVSLTMNFT |
soilH2_101693252 | 3300003324 | Sugarcane Root And Bulk Soil | MAQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEEFSTSXXXRKSRN* |
JGI26129J50193_10153552 | 3300003349 | Arabidopsis Thaliana Rhizosphere | MAEIGKEYLVGTVRPTNRPEAGRELDLDTLIPAKIKFVYLTMNFTRGTEEEFSTSMPG |
Ga0055487_100119531 | 3300004061 | Natural And Restored Wetlands | MADSEKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTMNFTKGTPEEFS |
Ga0062380_103429881 | 3300004779 | Wetland Sediment | MADSEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTQGTP |
Ga0062594_1032967141 | 3300005093 | Soil | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTQGTEEEFSTS |
Ga0066678_104689072 | 3300005181 | Soil | MAETQKEYLVGTVRPTNRPEAGHELDLDSLIPAKIKFVYLTMNFTRGTEEEFSTSM |
Ga0068996_100384342 | 3300005218 | Natural And Restored Wetlands | MADTQYLVGTVRPTNRPEAGQELDLEALIPAKIKFVSLTMNFTRGT |
Ga0065705_112070472 | 3300005294 | Switchgrass Rhizosphere | MSETEKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITCTMNFTR |
Ga0065707_111092991 | 3300005295 | Switchgrass Rhizosphere | MEDMNMAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIK |
Ga0070660_1018358722 | 3300005339 | Corn Rhizosphere | MAEAEKEFVVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTM |
Ga0070689_1005938201 | 3300005340 | Switchgrass Rhizosphere | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYS |
Ga0070671_1000356871 | 3300005355 | Switchgrass Rhizosphere | MAEAEKEYLVGTVRPTNRPETGQELDLDTLIPAKIKFLYSTMNFTRGTEDEFSTSMPGY |
Ga0008090_154185391 | 3300005363 | Tropical Rainforest Soil | MTEAQKEYIVGTVRPTNRPESGEELDLETKIPAKIQFLTRTMNFTRGTEEE |
Ga0070673_1019415932 | 3300005364 | Switchgrass Rhizosphere | MEDMNMAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFL |
Ga0070700_1007761571 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETEKEYLVGTVRPTNRPEAGQEIDLDERIPATIRFVTLTMNFTRGTEDEFRTSMTGYEAKSAELAKMG |
Ga0070662_1000780781 | 3300005457 | Corn Rhizosphere | MAEAEKEFVVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGT |
Ga0070662_1019575372 | 3300005457 | Corn Rhizosphere | MPETEKEYLVGTVRPTNRPEAGQEIDLDERIPATIRFVTLTMNFTRGTEDEFR |
Ga0070697_1001035603 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETQREYIVGTVRPTNRPESGQEIDLEEKIPAQIKFLTRTMNFTRGTEEEFS |
Ga0070695_1016741992 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MADNEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEEFSTSM |
Ga0070696_1016241492 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LKYLQRRKIMAEDQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIK |
Ga0066905_1017897842 | 3300005713 | Tropical Forest Soil | MAEKQKEYFVGTVRPTNRPEAGHELDLDTLIPEKIKFVTLTMNFTRGTEEEFITSM |
Ga0068866_107852372 | 3300005718 | Miscanthus Rhizosphere | MAEAEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEDEFSTSM |
Ga0066903_1079752962 | 3300005764 | Tropical Forest Soil | MAETLKEYIVGTVRPTNRPESGQELDLETKIPEKIQFL |
Ga0074470_114324561 | 3300005836 | Sediment (Intertidal) | MADNEKEYLVGTVRPTDRPEAGQELDLDTLIPANI |
Ga0068871_1015005541 | 3300006358 | Miscanthus Rhizosphere | MAEAEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKF |
Ga0075428_1000660024 | 3300006844 | Populus Rhizosphere | MPETEKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTRGTEEE |
Ga0075431_1009890272 | 3300006847 | Populus Rhizosphere | MPDTEKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLIT |
Ga0075431_1014659551 | 3300006847 | Populus Rhizosphere | MAETQKEYLVGTVRPTNRPEAGQELDLDSLIPAKIKFVYLTMNFTRG |
Ga0075425_1013240962 | 3300006854 | Populus Rhizosphere | MTETQKEYIVGTVRPTNRPEAGQEIDLEEKIPVKIKFLT |
Ga0073934_102495802 | 3300006865 | Hot Spring Sediment | MAENQKEYLVGTVRPTNRPEAGQELDPDTLIPAKIKF |
Ga0075436_1001515651 | 3300006914 | Populus Rhizosphere | MAEAQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNF |
Ga0102851_107908962 | 3300009091 | Freshwater Wetlands | MAEAQKEYLVGTVRPTNRPEAGQELDLEALIPAKIKFVSLTMNFTR |
Ga0075418_114568901 | 3300009100 | Populus Rhizosphere | MAESEKEYLVGTVRPTNRPEAGQEVDLDTLIPAKIKFLASTMNFTRGTEEEFSTSMPG |
Ga0114129_101359011 | 3300009147 | Populus Rhizosphere | MAETQKEYLVGTVRPTNRPEAGQELDLDSLIPAKIKFVYLTMNFTRGTEEEFSTSM |
Ga0105094_109027151 | 3300009153 | Freshwater Sediment | MADNEREYLVGTVRPTDRPEAGQELDLDTLIPAKIK |
Ga0105076_10080713 | 3300009816 | Groundwater Sand | MPETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRT |
Ga0126380_120117012 | 3300010043 | Tropical Forest Soil | MGEKEYLVGTVRPTNRPEAGQELDLDALIPERIKFVSLTMNFTRGTEEEF |
Ga0126384_118230861 | 3300010046 | Tropical Forest Soil | MTEAQKEYIVGTVRPTNRPEAGQELDLETKIPEKIQFLTRTMNFTRGTEEEF |
Ga0126383_121779682 | 3300010398 | Tropical Forest Soil | MTEAQKQYIVGTVRPTNRPESGQELDLETKIPAKIHFLTR |
Ga0134121_130977081 | 3300010401 | Terrestrial Soil | MAEAEKEFVVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEDEFSTSMP |
Ga0137451_10724451 | 3300011438 | Soil | LEEFNMAADEKEYVVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEEFSTS |
Ga0137382_111840541 | 3300012200 | Vadose Zone Soil | MPETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTRGTE |
Ga0137381_106187251 | 3300012207 | Vadose Zone Soil | MAETQKEYLVGTVRPTNRPEAGQELDLDSLIPAKIKFV |
Ga0137386_108973342 | 3300012351 | Vadose Zone Soil | MSETEKEYIVGTVRPTNRPESGQEIDLDDKIPAKIKRLTRTMNFTRGT |
Ga0137373_109911652 | 3300012532 | Vadose Zone Soil | MSETEKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTR |
Ga0157300_10501141 | 3300012884 | Soil | MLENAKNYLVGTVRPTNRPEAGQEIDLDERIPAKIRFVTLTMNFTRGTEEEFRTSMPGY |
Ga0157284_102814241 | 3300012893 | Soil | MAEAEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTE |
Ga0157293_100388091 | 3300012898 | Soil | MAEAEKEYLVGTVRPTNRPETGQELDLDTLIPAKIKFL |
Ga0137394_103144613 | 3300012922 | Vadose Zone Soil | LEYLQRRKIMAEAQKEYFVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEEFS |
Ga0137404_104856362 | 3300012929 | Vadose Zone Soil | LLVQRRKIMAESQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFT |
Ga0164303_100468883 | 3300012957 | Soil | MAETKREYIVGTVRPTNRPESGQEIDLEEKIPAQIKFLTRTMNFTRGTEEEFSTSMP |
Ga0164299_115345681 | 3300012958 | Soil | MAETKREYIVGTVRPTNRPESGQEIDLEEKIPAQIKFLTRTMNFTRGTE |
Ga0157375_133736801 | 3300013308 | Miscanthus Rhizosphere | MAEAEKEYLVGTVRPTNRPETGQELDLDTLIPAKIKFLYSTMNF |
Ga0075325_10093131 | 3300014270 | Natural And Restored Wetlands | MAETQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEEE |
Ga0075327_11645701 | 3300014272 | Natural And Restored Wetlands | MAETQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLTSTMNFTQGTEEEFSK |
Ga0075322_10137594 | 3300014311 | Natural And Restored Wetlands | MGGKLMAEIEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFVYLTMNFTRGTEEEFST |
Ga0157377_107657101 | 3300014745 | Miscanthus Rhizosphere | MAEAEKEFVVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEDEFSTSM |
Ga0180066_10533052 | 3300014873 | Soil | MADTPKEYLVGTVRPTNRPEAGQELDLEALIPAKIKFVSLTMNF |
Ga0180086_10589102 | 3300014883 | Soil | MAEEKEYLVGTVRPTNRPEAGQELDLDTLIPEKIQFVTLTMNFTRG |
Ga0137403_101492974 | 3300015264 | Vadose Zone Soil | MPETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTRGTEEEFGASMRGYEAKAAELAK |
Ga0132258_136387681 | 3300015371 | Arabidopsis Rhizosphere | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKF |
Ga0182032_106636181 | 3300016357 | Soil | MAETQKEYLVGTVRPTNRPEAGQELDFDTLIPAKIKFLSSTMNFTRGTEEEFSTS |
Ga0187776_101717382 | 3300017966 | Tropical Peatland | MADSEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYS |
Ga0184612_100134755 | 3300018078 | Groundwater Sediment | MPETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFT |
Ga0184627_104351152 | 3300018079 | Groundwater Sediment | MAETDKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEE |
Ga0184629_100067345 | 3300018084 | Groundwater Sediment | MADTQKDYLVGTVRPTNRPEAGQELDLEALIPAKIKFVSLTMNFTRG |
Ga0187774_113695351 | 3300018089 | Tropical Peatland | MPENQKDHIVGTGRPTNRPESGQEIDLDERIPAKIKFLTRTMNFTKGTEEE |
Ga0190265_128008801 | 3300018422 | Soil | MPETEKEYLVGTVRPTNRPEAGQEIDLDERIPAKIRFL |
Ga0190270_121532311 | 3300018469 | Soil | MAAEEKEYVVGTVRPTDRPEAGQELDLDTLIPAKIKFL |
Ga0190273_119949962 | 3300018920 | Soil | MAADEKEYDEIEYIVGTVRPTDRPEAGQELDLDTLIPAKI |
Ga0193707_10648822 | 3300019881 | Soil | MAESQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLR |
Ga0193739_11006141 | 3300020003 | Soil | MAETDKEYLVGTVRPTNRPEAGQELDLDTLVPAKIKFLSSTMN |
Ga0210379_103285122 | 3300021081 | Groundwater Sediment | MAADEKEYDEIEYIVGTVRPTDRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEEEFSTSMPGY |
Ga0126371_126157812 | 3300021560 | Tropical Forest Soil | MAETQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTR |
Ga0209619_102165942 | 3300025159 | Soil | MADTQKEYLVGVVHPTNRPEAGQELNLDTLIPAKIKFVSLTMNFTRGTE |
Ga0209342_110207761 | 3300025326 | Soil | MAEAQKEYLVGTVRPTNRPEAGQVLDLEALIPAKIKFVSLTMNFTRGTEEE |
Ga0210098_10271373 | 3300025550 | Natural And Restored Wetlands | MAESDKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTM |
Ga0207688_104348341 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEE |
Ga0207684_108733332 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQNQEEYIVGTVRPTNRPEAGQELDLETKIPAKIRFLTRTMNFT |
Ga0207706_101613031 | 3300025933 | Corn Rhizosphere | MAEAEKEFVVGTVRPTNRPEAGQELDLDTLIPAKIKFLYST |
Ga0207706_113123152 | 3300025933 | Corn Rhizosphere | MAEAEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYST |
Ga0207691_114992062 | 3300025940 | Miscanthus Rhizosphere | MPETEKEYLVGTVRPTNRPEAGQEIDLDERIPATIRFVTLTMNFTRGTEDE |
Ga0210116_11069202 | 3300025959 | Natural And Restored Wetlands | MADSEKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLSS |
Ga0207651_115176942 | 3300025960 | Switchgrass Rhizosphere | MAEAEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTED |
Ga0207651_115620401 | 3300025960 | Switchgrass Rhizosphere | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFL |
Ga0208421_10102151 | 3300026058 | Natural And Restored Wetlands | MAEIEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFVYLTMNFTRGTEEEFSTS |
Ga0209879_10261872 | 3300027056 | Groundwater Sand | MAETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTRGTEEEFG |
Ga0209818_11283522 | 3300027637 | Agricultural Soil | MAENGKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGNEEEFS |
Ga0209798_102236012 | 3300027843 | Wetland Sediment | MAENEKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTMNFTKGTPEEFST |
Ga0209486_104439492 | 3300027886 | Agricultural Soil | MAENGKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLYSTMNFTRGTEEEFST |
Ga0209486_104755901 | 3300027886 | Agricultural Soil | MPETEKGYLVGTVRPTNRPEAGQEIDLDDRIPAKI |
Ga0209486_109574881 | 3300027886 | Agricultural Soil | MPETEKEYLVGTVRPTNRPEAGQEIDLDDRIPAKI |
Ga0209382_109796561 | 3300027909 | Populus Rhizosphere | MAQTEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEE |
Ga0209857_10918301 | 3300027957 | Groundwater Sand | MAETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKI |
Ga0137415_110091041 | 3300028536 | Vadose Zone Soil | MPETQKEYIVGTVRPTNRPESGQEIDLDEKIPAKIKLITRTMNFTRGTEEEFGASMRGYEAKAA |
Ga0307405_101431831 | 3300031731 | Rhizosphere | MLETEKEYLVGTVRPTNRPEAGQEIDLDERIPAKIRFVTLTMNFTRGTEEEFRTSITDYEAKSAELAKIGA |
Ga0306918_108833752 | 3300031744 | Soil | MAETEREYIVGTVRPTNRPESGQEIDLEEKIPAQIKFLT |
Ga0307475_107544862 | 3300031754 | Hardwood Forest Soil | MAQNQKEYIVGTVRPTNRPEAGQELDLETKIPAKIQFLTRTMNF |
Ga0307473_115734092 | 3300031820 | Hardwood Forest Soil | MAETLKQYIVGTVRPTNRPEAGQELDLETKIPAKIQFLTRTMNFTRG |
Ga0307413_108520812 | 3300031824 | Rhizosphere | MADSEKEYLVGTVRPTNRPEAGQELDLDTLIPAKINFLYSTMNFTQGTAEEFSTS |
Ga0310900_119548671 | 3300031908 | Soil | MAETEKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEEEFST |
Ga0326597_108227863 | 3300031965 | Soil | MPDAQGEYLVGTVRPTNRPEAGQELDLDTLIPAKIRFVSLTMNFTRGTEEEFG |
Ga0307471_1002990183 | 3300032180 | Hardwood Forest Soil | MTETLKEYIVGTVRPTNRPEAGQELDLETKIPEKIQFLTRTMNFTRGTEEEFS |
Ga0307471_1016131812 | 3300032180 | Hardwood Forest Soil | MAETKREYIVGTVRPTNRPESGQEIDLEEKIPAQIKFLTRTMNFTR |
Ga0307471_1016928472 | 3300032180 | Hardwood Forest Soil | MAQNQEEYIVGTVRPTNRPEAGQELDLETKIPAKIQFLTRTMNFTRGTEEEFSTSMP |
Ga0310914_106220942 | 3300033289 | Soil | MAETQKEYLVGTVRPTNRPEAGQELDLDTLIPAKIKFLSSTMNFT |
Ga0316604_106470811 | 3300033406 | Soil | MADNEKEYLVGTVRPTDRPEAGQELDLDTLIPAKIKFLYS |
Ga0214472_101522171 | 3300033407 | Soil | MAEKEYLVGTVRPTNRPEAGQELDLDTLIPEKIKFVALTMNFTSGTAEE |
Ga0316628_1029910682 | 3300033513 | Soil | MADTQKEYLVGTVRPTNRPEAGQELDLDTVIPAKIKF |
Ga0364945_0163716_505_669 | 3300034115 | Sediment | LEEFNMAADEKEYVVGTVRPTDRPEAGQELDLDTLIPAKIKFLSSTMNFTRGTEE |
Ga0364927_0224524_2_124 | 3300034148 | Sediment | LEEFNMAADEKEYVVGTVRPTDRPEAGQELDLDTLIPAKIK |
⦗Top⦘ |