 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F079320 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.07 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.241 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.483 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 4.31 |
| PF01068 | DNA_ligase_A_M | 1.72 |
| PF04404 | ERF | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.72 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.24 % |
| All Organisms | root | All Organisms | 32.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.52% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.66% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.17% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.45% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.45% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.45% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.59% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.72% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.72% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.72% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.72% |
| Cinachyra Sp. (Marine Sponge) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) | 1.72% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.86% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.86% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.86% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.86% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.86% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300005820 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007057 | Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg17ic | Host-Associated | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021542 | Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg17ic 200bp no Eukaryotes last | Host-Associated | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028672 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100934581 | 3300000115 | Marine | SWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSKK* |
| DelMOSpr2010_101040265 | 3300000116 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKTKKNVKK* |
| DelMOWin2010_101811441 | 3300000117 | Marine | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNAK* |
| JGI24006J15134_101808771 | 3300001450 | Marine | LYSWTKFYQDRGNKESIRKCQTEIAQLKQAFNNLKSKK* |
| JGI24003J15210_101463851 | 3300001460 | Marine | YSWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| JGI24003J15210_101537351 | 3300001460 | Marine | SWTKFYQDRADKEAIRKCQTEIAQLKTAFNQLKI* |
| JGI24003J15210_101666091 | 3300001460 | Marine | TKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| JGI24004J15324_100528161 | 3300001472 | Marine | KFYQDRGNKESIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| JGI24004J15324_101121171 | 3300001472 | Marine | LYSWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| JGI24004J15324_101229151 | 3300001472 | Marine | LYSWTKFYQDRADKEAIRKCQTEIAQLKTAFNQLKSNKNGKK* |
| JGI24005J15628_102123571 | 3300001589 | Marine | LYSWTKFYQDRADKEAIRKCQTEIAQLKTAFNQLKSKK* |
| JGI24005J15628_102124922 | 3300001589 | Marine | WTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSXKNGKX* |
| Ga0078747_1068049 | 3300005820 | Marine Sediment | SWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSKKNGKK* |
| Ga0098038_10158641 | 3300006735 | Marine | FYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| Ga0098038_11265674 | 3300006735 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0098037_11244451 | 3300006737 | Marine | FYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0098048_10036631 | 3300006752 | Marine | KFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK* |
| Ga0098054_11190795 | 3300006789 | Marine | WTKFYQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKTKNAK* |
| Ga0098054_12125003 | 3300006789 | Marine | TKFYQDRGNKEQIRKCQTEIAQLKQAYNKLKSKK* |
| Ga0070754_102854703 | 3300006810 | Aqueous | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| Ga0070754_104715761 | 3300006810 | Aqueous | TKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNA* |
| Ga0070750_101105816 | 3300006916 | Aqueous | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNA* |
| Ga0070748_11630384 | 3300006920 | Aqueous | SWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0098060_11507903 | 3300006921 | Marine | LYSWTKFYQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKTKNAK* |
| Ga0101644_10273043 | 3300007057 | Cinachyra Sp. (Marine Sponge) | SWTQFYQEVGNKEQIRKCQTQIAALKKAYNETKTKK* |
| Ga0070752_10643961 | 3300007345 | Aqueous | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKK* |
| Ga0070753_12578173 | 3300007346 | Aqueous | YQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNAK* |
| Ga0099849_13703891 | 3300007539 | Aqueous | YQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKK* |
| Ga0099849_13775493 | 3300007539 | Aqueous | WTQFYQEVGNKEQIRKCQTEIAQLKKAYNQTKTKKNG* |
| Ga0099847_100911710 | 3300007540 | Aqueous | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNVKK* |
| Ga0099847_10391581 | 3300007540 | Aqueous | SWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSKKNGKK* |
| Ga0099847_12006262 | 3300007540 | Aqueous | DRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0099846_10710105 | 3300007542 | Aqueous | YSWTQFYQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKK* |
| Ga0070751_12240711 | 3300007640 | Aqueous | GNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNA* |
| Ga0105741_11084463 | 3300007956 | Estuary Water | TKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKK* |
| Ga0110931_10166921 | 3300007963 | Marine | FYQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKK* |
| Ga0115371_111967621 | 3300008470 | Sediment | LYSWTAFYQNRANKEAIRKCQTEIAQLKQAFNQLKTKKNVKK* |
| Ga0102854_10281491 | 3300009058 | Estuarine | SWTKFYQDRGNKEAIRKCQTEIAQLKQAFNKLKSKK* |
| Ga0102814_106989172 | 3300009079 | Estuarine | WTKFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK* |
| Ga0115545_11037635 | 3300009433 | Pelagic Marine | WTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0114925_110833663 | 3300009488 | Deep Subsurface | LYSWTQFYQARGNKTQIRKCQTEIAQLKKAYNELKSKKK* |
| Ga0115571_14029382 | 3300009495 | Pelagic Marine | SWTKFYQDRGNKESIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK* |
| Ga0115571_14375682 | 3300009495 | Pelagic Marine | TKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSNKNGKK* |
| Ga0098049_10216408 | 3300010149 | Marine | SWTKFYQDRGNKEQIRKCQTEIAQLKQAYNKLKSKK* |
| Ga0098056_12078403 | 3300010150 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNKLKSKK* |
| Ga0098059_11567914 | 3300010153 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKK* |
| Ga0098047_1001626311 | 3300010155 | Marine | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNKLKSKK* |
| Ga0118731_1126323413 | 3300010392 | Marine | LYSWTKFYQDRADKESIRKCQTEIAQLKQAFNQLKSKK* |
| Ga0118733_1066637661 | 3300010430 | Marine Sediment | SWTKFYQDRADKESIRKCQTEIAQLKQAFNQLKSKK* |
| Ga0163111_123627481 | 3300012954 | Surface Seawater | LYSWTKFYQDRGNKKQIRKCQTEIAQLKQAYNELKKKK* |
| Ga0164313_111483311 | 3300013101 | Marine Sediment | TQFYQEVGNKDQIRKCQTQIAELKKAYNQTKSKKNGKA* |
| Ga0181372_10595191 | 3300017705 | Marine | RGFYQERGEKTQIRKCQTEIAQLKQAFNDLKNKKKK |
| Ga0181391_10293525 | 3300017713 | Seawater | NKEQIRKCQTEIAQLKQAYNQLKSNKNGKTKNAKRD |
| Ga0181391_10419856 | 3300017713 | Seawater | TKFYQDRGNKEQIRKCQTEIAQLKKAFNESRNKKK |
| Ga0181404_10355634 | 3300017717 | Seawater | SWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0181390_11524161 | 3300017719 | Seawater | YSWTKFYQDRADKESIRKCQTEIAQLKQAFNKLKSKK |
| Ga0181381_10811913 | 3300017726 | Seawater | WTKFYQDRGNKEQIRKCQTEIAQLKQAYNQLKSNKNGKK |
| Ga0187218_11507111 | 3300017737 | Seawater | YQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0181421_10262576 | 3300017741 | Seawater | YSWTKFYQDRGNKDGIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0181399_10336721 | 3300017742 | Seawater | RGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0181389_11379133 | 3300017746 | Seawater | WTKFYQDRGNKEAIRKCQTEIAQLKQAYNKLKSKK |
| Ga0187219_11183083 | 3300017751 | Seawater | LYSWTRFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0181400_11616321 | 3300017752 | Seawater | FYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0187217_11137171 | 3300017770 | Seawater | WTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0181425_10236787 | 3300017771 | Seawater | AKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0181425_10280906 | 3300017771 | Seawater | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0181379_10571316 | 3300017783 | Seawater | SWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0194021_10071505 | 3300019703 | Sediment | WTQFYQEVGNKEQIRKCQTEIAQLKKAYNQTKTKKNG |
| Ga0206131_102602111 | 3300020185 | Seawater | LYSWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0211505_10189861 | 3300020352 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNKLKSKK |
| Ga0211505_11662791 | 3300020352 | Marine | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKK |
| Ga0211580_100089291 | 3300020420 | Marine | YQERGNKEQIRKCQTQIAELKKAYNQTKSNKNGKTKNAKRD |
| Ga0206687_10742851 | 3300021169 | Seawater | TKFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0206692_11436051 | 3300021350 | Seawater | LYSWTKFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0213863_101208085 | 3300021371 | Seawater | TRFYQDRGNKEQIRKCQTQIAELKKAFNQLKSKKNGKK |
| Ga0224700_1711973 | 3300021542 | Cinachyra Sp. (Marine Sponge) | SWTQFYQEVGNKEQIRKCQTQIAALKKAYNETKTKK |
| Ga0222716_101025217 | 3300021959 | Estuarine Water | YSWTKFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0222716_106141273 | 3300021959 | Estuarine Water | WTKFYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0212030_10180414 | 3300022053 | Aqueous | GSKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0196903_10285613 | 3300022169 | Aqueous | FYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNVKK |
| (restricted) Ga0233404_100689764 | 3300022913 | Seawater | QDRGDKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| (restricted) Ga0233432_101860445 | 3300023109 | Seawater | KFYQDRGDKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| (restricted) Ga0255040_101572313 | 3300024059 | Seawater | YSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0228676_10764231 | 3300024248 | Seawater | LYSWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKK |
| (restricted) Ga0255042_100799253 | 3300024340 | Seawater | TFSKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSKK |
| (restricted) Ga0255048_106546481 | 3300024518 | Seawater | LYSWTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0209535_10921211 | 3300025120 | Marine | LYSWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0209232_10228488 | 3300025132 | Marine | SWTQFYQERGNKDQIRKCQTQIAELKKAYNQTKTKK |
| Ga0209232_10294991 | 3300025132 | Marine | WTQFYQERGNKDQIRKCQTQIAELKKAYNKTKSKK |
| Ga0209232_10706865 | 3300025132 | Marine | SWTQFYQERGNKDQIRKCQTQIAELKKAYNQTKSKK |
| Ga0209336_100561061 | 3300025137 | Marine | TKFYQDRGNKESIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0208814_11082604 | 3300025276 | Deep Ocean | LYSWTKFYQDRGNKEKIRTCQAEIAQLKQAFNQLKTKKNGKK |
| Ga0208303_10209241 | 3300025543 | Aqueous | TKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0208643_100797312 | 3300025645 | Aqueous | LYSWTKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0209251_10891951 | 3300025668 | Marine | LYSWTKFYQDRGDKEQIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0209603_10373339 | 3300025849 | Pelagic Marine | SWTKFYQDRGNKESIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0209632_1003135713 | 3300025886 | Pelagic Marine | WTKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0228620_10823591 | 3300026483 | Seawater | KDQIRKCQTQIAELKKVYNQLKSNKNGKTKNAKRN |
| Ga0208304_101941113 | 3300027751 | Estuarine | FYQDRGNKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0208305_101306741 | 3300027753 | Estuarine | SWTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSKK |
| (restricted) Ga0233413_101343284 | 3300027996 | Seawater | SWTKFYQDRGDKEAIRKCQTEIAQLKMAFNQLKSNKNGKK |
| Ga0247596_10388121 | 3300028106 | Seawater | LYSWTQFYQERGNKDQIRKCQTQIAELKKVYNQLKSNKNGKTKNAKRN |
| Ga0256368_100101412 | 3300028125 | Sea-Ice Brine | YQDRADKEAIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0228634_11263311 | 3300028129 | Seawater | RGNKEAIRKCQTEIAQLKQAFNQLKSKKXKILTLLKKH |
| Ga0256413_13516932 | 3300028282 | Seawater | YQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0265309_110654831 | 3300028599 | Sediment | TKFYQDRGNKESIRKCQTEIAQLKQAFNQLKSNKNGKTKNAK |
| Ga0265303_109428421 | 3300028600 | Sediment | TKFYQDRGNKEAIRKCQTEIAQLKQAFNQLKSKKNGKK |
| Ga0257128_11161781 | 3300028672 | Marine | KFYQDRADKESIRKCQTEIAQLKQAFNNLKSKKXKILMQ |
| Ga0257128_11196081 | 3300028672 | Marine | WTKFYQDRADKEAIRKCQTEIAQLKQAFNQLKSNKNGKK |
| Ga0135211_10022875 | 3300029293 | Marine Harbor | VFLLVFPSHDRGDKEQIRKCQTQIAALKKAYNETKTKKNG |
| Ga0135222_10139203 | 3300029301 | Marine Harbor | FPSHDQEVGNKEQIRKCQTEIAQLKKAYNETKTKKNG |
| Ga0183755_10299996 | 3300029448 | Marine | YSWTQFYQERGNKDQIRKCQTQIAELKKAYNNTKTKK |
| Ga0307999_11149971 | 3300031608 | Marine | YSWTAFYQNRANKEAIRKCQTEIAQLKQAFNQLKTKKNVKK |
| Ga0308011_100370666 | 3300031688 | Marine | SWTAFYQNRANKEAIRKCQTEIAQLKQAFNQLKTKKNVKK |
| Ga0314858_174034_417_551 | 3300033742 | Sea-Ice Brine | EGEKAWTKFYQDRADKEAIRKCQTEIAQLKTAFNQLKSNKNGKK |
| Ga0348335_130904_594_722 | 3300034374 | Aqueous | TKFYQDRGNKEQIRKCQTEIAQLKQAFNQLKSKKNGKTKNAK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |