NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079180

Metagenome / Metatranscriptome Family F079180

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079180
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 47 residues
Representative Sequence MSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKFAKHKAEAKAAETK
Number of Associated Samples 98
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 50.86 %
% of genes near scaffold ends (potentially truncated) 39.66 %
% of genes from short scaffolds (< 2000 bps) 88.79 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.759 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.379 % of family members)
Environment Ontology (ENVO) Unclassified
(43.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.966 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 57.69%    β-sheet: 0.00%    Coil/Unstructured: 42.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00160Pro_isomerase 51.72
PF13349DUF4097 18.97
PF13345Obsolete Pfam Family 6.03
PF10576EndIII_4Fe-2S 3.45
PF14791DNA_pol_B_thumb 1.72
PF00633HHH 1.72
PF02518HATPase_c 0.86
PF00999Na_H_Exchanger 0.86
PF00440TetR_N 0.86
PF00679EFG_C 0.86
PF16859TetR_C_11 0.86
PF00884Sulfatase 0.86
PF13419HAD_2 0.86
PF02811PHP 0.86
PF00873ACR_tran 0.86
PF07690MFS_1 0.86
PF00730HhH-GPD 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 51.72
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.86
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.86
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.86
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.86
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.86
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.86
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.86
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.86
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.86
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.76 %
UnclassifiedrootN/A17.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_106257502All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300002128|JGI24036J26619_10075217All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca674Open in IMG/M
3300003324|soilH2_10183122All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3702Open in IMG/M
3300003324|soilH2_10319265All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1152Open in IMG/M
3300004463|Ga0063356_100210268All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2307Open in IMG/M
3300004480|Ga0062592_101342675All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300004643|Ga0062591_102938350All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis506Open in IMG/M
3300005293|Ga0065715_10481813All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005329|Ga0070683_100878190Not Available860Open in IMG/M
3300005332|Ga0066388_104997510All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005337|Ga0070682_101546275All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005338|Ga0068868_100163699All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1839Open in IMG/M
3300005340|Ga0070689_100190137All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300005345|Ga0070692_10917634Not Available607Open in IMG/M
3300005355|Ga0070671_100091548All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2547Open in IMG/M
3300005356|Ga0070674_100075410All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2395Open in IMG/M
3300005364|Ga0070673_100732274All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis910Open in IMG/M
3300005367|Ga0070667_100279527All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300005456|Ga0070678_101231945All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005459|Ga0068867_100193174All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1625Open in IMG/M
3300005459|Ga0068867_102137440Not Available530Open in IMG/M
3300005471|Ga0070698_100225357All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1808Open in IMG/M
3300005549|Ga0070704_101510724All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis618Open in IMG/M
3300005618|Ga0068864_102694705All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005713|Ga0066905_101340873All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005834|Ga0068851_11092581Not Available506Open in IMG/M
3300005841|Ga0068863_101344386All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006169|Ga0082029_1441094All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006175|Ga0070712_100111026All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2046Open in IMG/M
3300006755|Ga0079222_10207474All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1186Open in IMG/M
3300006755|Ga0079222_10895101All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006844|Ga0075428_101225697All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.790Open in IMG/M
3300006844|Ga0075428_101561605All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes690Open in IMG/M
3300006845|Ga0075421_100052747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis5144Open in IMG/M
3300006845|Ga0075421_100697588All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1180Open in IMG/M
3300006845|Ga0075421_102184405All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes585Open in IMG/M
3300006845|Ga0075421_102747630All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006847|Ga0075431_100690483All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium999Open in IMG/M
3300006853|Ga0075420_101264506All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300006871|Ga0075434_100828811All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300006894|Ga0079215_10203543All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1004Open in IMG/M
3300006969|Ga0075419_10818485Not Available667Open in IMG/M
3300006969|Ga0075419_11349496All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales531Open in IMG/M
3300007004|Ga0079218_10850442All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium886Open in IMG/M
3300007004|Ga0079218_12503331All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis610Open in IMG/M
3300007004|Ga0079218_12673056Not Available595Open in IMG/M
3300009094|Ga0111539_12618617All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300009162|Ga0075423_11615596Not Available697Open in IMG/M
3300009176|Ga0105242_10750031All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300010037|Ga0126304_10028098All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3281Open in IMG/M
3300010045|Ga0126311_11278438All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300010397|Ga0134124_10207577All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1782Open in IMG/M
3300010398|Ga0126383_10841730All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1002Open in IMG/M
3300010403|Ga0134123_11863184All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis656Open in IMG/M
3300011266|Ga0151622_1048557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3389Open in IMG/M
3300011333|Ga0127502_10858068All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012212|Ga0150985_105285776All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1916Open in IMG/M
3300012212|Ga0150985_115463923All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012479|Ga0157348_1028894Not Available518Open in IMG/M
3300012493|Ga0157355_1018315All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes627Open in IMG/M
3300012908|Ga0157286_10332261All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012961|Ga0164302_11202514All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes606Open in IMG/M
3300012989|Ga0164305_10134386All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1652Open in IMG/M
3300013296|Ga0157374_11995510Not Available606Open in IMG/M
3300013297|Ga0157378_11930873All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300014745|Ga0157377_11105884All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300015262|Ga0182007_10077337All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1091Open in IMG/M
3300015372|Ga0132256_101146029All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300015374|Ga0132255_101359189All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1072Open in IMG/M
3300018476|Ga0190274_11042514All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300021445|Ga0182009_10081630All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1441Open in IMG/M
3300022756|Ga0222622_10314059All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1082Open in IMG/M
3300022880|Ga0247792_1033667All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300025315|Ga0207697_10003631All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7569Open in IMG/M
3300025321|Ga0207656_10656694Not Available536Open in IMG/M
3300025893|Ga0207682_10557891All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300025898|Ga0207692_10711101All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300025899|Ga0207642_10293004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis940Open in IMG/M
3300025908|Ga0207643_10477579All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300025916|Ga0207663_10844234All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300025919|Ga0207657_10278757All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1328Open in IMG/M
3300025920|Ga0207649_11394136All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025925|Ga0207650_11856750All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025931|Ga0207644_10128109All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1940Open in IMG/M
3300025931|Ga0207644_11426056Not Available582Open in IMG/M
3300025932|Ga0207690_11541980All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis555Open in IMG/M
3300025935|Ga0207709_10815581Not Available754Open in IMG/M
3300025937|Ga0207669_11875770Not Available512Open in IMG/M
3300025938|Ga0207704_10212740All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300025942|Ga0207689_11724301All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300025945|Ga0207679_10033775All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3603Open in IMG/M
3300025945|Ga0207679_11409803Not Available639Open in IMG/M
3300025981|Ga0207640_10518391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis996Open in IMG/M
3300026023|Ga0207677_10719262Not Available887Open in IMG/M
3300026023|Ga0207677_11159517All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300026041|Ga0207639_11995862Not Available541Open in IMG/M
3300026089|Ga0207648_10384146All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1270Open in IMG/M
3300027880|Ga0209481_10729608Not Available515Open in IMG/M
3300027907|Ga0207428_10197496All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1514Open in IMG/M
3300027909|Ga0209382_10456030All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1415Open in IMG/M
3300027909|Ga0209382_11121546Not Available810Open in IMG/M
3300027909|Ga0209382_11239651All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis760Open in IMG/M
3300027909|Ga0209382_12092578All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300028379|Ga0268266_10799192Not Available911Open in IMG/M
3300028381|Ga0268264_10351451All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300028381|Ga0268264_11406154All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031548|Ga0307408_100001587All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis16782Open in IMG/M
3300031716|Ga0310813_11630003Not Available603Open in IMG/M
3300031740|Ga0307468_100894181All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300031824|Ga0307413_10279078All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1256Open in IMG/M
(restricted) 3300031825|Ga0255338_1000132All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae327979Open in IMG/M
3300031938|Ga0308175_100875211All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis987Open in IMG/M
3300032012|Ga0310902_10028693All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2535Open in IMG/M
3300032421|Ga0310812_10069068All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1401Open in IMG/M
3300033475|Ga0310811_10821711All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis861Open in IMG/M
3300034664|Ga0314786_187716All Organisms → cellular organisms → Bacteria506Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere8.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.72%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.72%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.72%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.86%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.86%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.86%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.86%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011266Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 55EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012479Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031825 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10625750223300000956SoilMSLHLGDKKAAFVGLIMTAGLLFVMAFTIVKLTNAHFEKEKAAEKAK*
JGI24036J26619_1007521723300002128Corn, Switchgrass And Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKXAETK*
soilH2_1018312223300003324Sugarcane Root And Bulk SoilMALYPEDKKAAFIGLIVTAILLFTMSFTIVKLTNAKYAHEKGEARQEQAK*
soilH2_1031926523300003324Sugarcane Root And Bulk SoilMSLYPEDKKAAFIGMIVTALLLFTMSFTIVKLTNAKFARHKAEAKAGETK*
Ga0063356_10021026823300004463Arabidopsis Thaliana RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTAETK*
Ga0062592_10134267513300004480SoilGDKKAAFIGMIVTAGLLFAMAFTIVKLTNAKFARHAAEGKAAETK*
Ga0062591_10293835013300004643SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK*
Ga0065715_1048181323300005293Miscanthus RhizosphereMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKA
Ga0070683_10087819013300005329Corn RhizosphereDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK*
Ga0066388_10499751013300005332Tropical Forest SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYAKHKAEAKSGETK*
Ga0070682_10154627523300005337Corn RhizosphereMSLHLEDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK*
Ga0068868_10016369923300005338Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNRHKAEAKTAETK*
Ga0070689_10019013733300005340Switchgrass RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYAKHKAEAKSAETK*
Ga0070692_1091763413300005345Corn, Switchgrass And Miscanthus RhizosphereDHYRLSTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK*
Ga0070671_10009154833300005355Switchgrass RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYSKHKAEAKTAETK*
Ga0070674_10007541023300005356Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFMMSFTIVKLTNAKYTKHKAEAKTAETK*
Ga0070673_10073227423300005364Switchgrass RhizosphereRLSTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK*
Ga0070667_10027952713300005367Switchgrass RhizosphereMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKAK*
Ga0070678_10123194513300005456Miscanthus RhizosphereMSLHLGDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK*
Ga0068867_10019317423300005459Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYSRHKAEAKAGETK*
Ga0068867_10213744023300005459Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKAAETK*
Ga0070698_10022535723300005471Corn, Switchgrass And Miscanthus RhizosphereMSLHLEDKKAAFAGLLVTALLLFGMAFTIVKLTNAKFEREKAEAKK*
Ga0070704_10151072413300005549Corn, Switchgrass And Miscanthus RhizosphereRAAFVGMIVTTALLFIMAFTIVKLTNAKFAGHKAEGKAGETK*
Ga0068864_10269470513300005618Switchgrass RhizosphereMSLHLGDKKAAFVGMIVTTALLFAMAFTIVKLTNAHFEKEKAGEKAK*
Ga0066905_10134087313300005713Tropical Forest SoilMSLYPEDKKAAFIGMIVTAVLLFTMSFTIVKLTNAKFARHKA
Ga0068851_1109258123300005834Corn RhizosphereGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKAK*
Ga0068863_10134438623300005841Switchgrass RhizosphereMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAAEK
Ga0082029_144109413300006169Termite NestMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKFARHKAEAKAGETK*
Ga0070712_10011102643300006175Corn, Switchgrass And Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYARHKAEAKSAETK*
Ga0079222_1020747423300006755Agricultural SoilMALYPEDKKAAFIGLIVTAILLVTMSFTIVKLVNAKFAREKGDAKAAQTR*
Ga0079222_1089510123300006755Agricultural SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGQTK*
Ga0075428_10122569723300006844Populus RhizosphereMSLYPEDKKAAFIGLIVTAVLLFAMSFTIVKLTNAKFARHKAETKAAETK*
Ga0075428_10156160523300006844Populus RhizosphereMSLYPEDKKAAFIGLIVTAALLFAMSFTIVKLTNAKFAKHKAEAKSAETK*
Ga0075421_10005274763300006845Populus RhizosphereMAHHHGSDKGAAFVGMIVTTALLFIMAFTIVKLTNAKFAGHAAEAKAGQNK*
Ga0075421_10069758823300006845Populus RhizosphereMAHTHGSDKGAAFIGMIVTSALLFIMCFTIVKLTNAKFEGHAAEAKAGQTK*
Ga0075421_10218440523300006845Populus RhizosphereMSLHTGDKSAAFIGMIVTAGLLFAMAFGIVKATNAKFEAHKAEAKAGAPKH*
Ga0075421_10274763023300006845Populus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNA
Ga0075431_10069048323300006847Populus RhizosphereMSLYPGDKKAAFIGLIVTALLLFTMSFTIVKLTNAKYNKHKAEAKTAETK*
Ga0075420_10126450623300006853Populus RhizosphereMSLHPGDKKAAFIGMIVTTALLFIMAFTIVKLTNAK
Ga0075434_10082881123300006871Populus RhizosphereMSLYHGDKKAAFIGMIVTALLLVTMSFTIVKLTNAKFAREKGEAKAGERK*
Ga0079215_1020354313300006894Agricultural SoilMSLHPGDKRAAFIGMIVTAALLFVMSLAIVKLTNAKFEGHKAEAKAGETK*
Ga0075419_1081848513300006969Populus RhizosphereAFIGLIVTALLLFTMSFTIVKLTNAKFARHKAEAKSAETK*
Ga0075419_1134949623300006969Populus RhizosphereMSLYPEDKKAAFIGMIVTAVLLFAMSFTIVRLTNAKFARHKA
Ga0079218_1085044233300007004Agricultural SoilMAHKHGSDKGAAFIGMIVTSALLFIMCLVIVKWTNAKFAGHAAE
Ga0079218_1250333123300007004Agricultural SoilMSLHAGDKRAAFIGMIVTAALLFIMSYTIVKLTNAKFEGHAAEGKAAETK*
Ga0079218_1267305613300007004Agricultural SoilAFIGMIVTAALLFVMSLAIVKLTNAKFEGHKAEAKAGETK*
Ga0111539_1261861713300009094Populus RhizosphereMSLYPEDKRAAFIGMIVTAALLFVMAFTIVKLTNVKFERHKAEAKAGETKR*
Ga0075423_1161559613300009162Populus RhizosphereKKAAFIGMIVTALLLVTMLFTIVKLTNAKFAREKGEAKAGERK*
Ga0105242_1075003113300009176Miscanthus RhizosphereMALHHGDKKAAFIGMIVTTLLLVAMSFTIVKLTNAKFAHEKAEAKAETK*
Ga0126304_1002809833300010037Serpentine SoilMSLYAGDKRAAFVGMIVTAALLFVMAFTIVKLTNAKFSGHKAEGKAGEAK*
Ga0126311_1127843813300010045Serpentine SoilMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKA
Ga0134124_1020757723300010397Terrestrial SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTSETK*
Ga0126383_1084173023300010398Tropical Forest SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTTAKYARHEAEEATAGQTK*
Ga0134123_1186318423300010403Terrestrial SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYSRHKADAKAGETK*
Ga0151622_104855733300011266SedimentMALFKEDKSAAFIGLIVTAALLFIMAFTIVTLTNKKYAGERGTTATETK*
Ga0127502_1085806823300011333SoilMSLHEGDKRAAFIGMIVTSALLFVLSYAIVQYTNAKFEGHKAEAKAGAATKH*
Ga0150985_10528577623300012212Avena Fatua RhizosphereMSLYPQDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYAKHKAEAKTAETK*
Ga0150985_11546392313300012212Avena Fatua RhizosphereMSLHLEDKKAAFVGMIVTTALLFVIAFTIVKLTNAHFEKEKAAEKAK*
Ga0157348_102889423300012479Unplanted SoilLLNPPTTTGLSTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTAETK*
Ga0157355_101831523300012493Unplanted SoilGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTAETK*
Ga0157286_1033226113300012908SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAHFEKEKAGEKAK*
Ga0164302_1120251423300012961SoilMSLQLGDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK*
Ga0164305_1013438623300012989SoilMSLYPEDKKAAFIGLIVTAALLVTMSFTIVKLTNAKYSRHKAEAKAGETK*
Ga0157374_1199551023300013296Miscanthus RhizosphereMALHKEDKSAAMIGMVVTAALLVIMSFTIVKLTNNKYAGEKHEAGAAAEKK*
Ga0157378_1193087323300013297Miscanthus RhizosphereMSLHLGDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEK
Ga0157377_1110588423300014745Miscanthus RhizosphereMSLHLEDKKAASVGMIVTTALLFVMAFTMVKLTNAHFEKEKAGEKAK*
Ga0182007_1007733723300015262RhizosphereMSLYPEDKKAAYIGLIVTAILLVTMSFTIVKLVNAKFAREKGEAKAEQTK*
Ga0132256_10114602913300015372Arabidopsis RhizosphereMSLYPEDKKAAFLGMIVTAVLLFAMSCTIVKLTNAKFAHEKGEAKAGATK*
Ga0132255_10135918913300015374Arabidopsis RhizosphereMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKSAEKAK*
Ga0190274_1104251433300018476SoilFVGMIVTAALLFVMAFTIVKLTNAKFAGHKAEGKAGETK
Ga0182009_1008163013300021445SoilTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGQTK
Ga0222622_1031405923300022756Groundwater SedimentMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKAK
Ga0247792_103366713300022880SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKAAETK
Ga0207697_1000363113300025315Corn, Switchgrass And Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTAETK
Ga0207656_1065669423300025321Corn RhizosphereHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKAK
Ga0207682_1055789113300025893Miscanthus RhizosphereMSLHLEDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK
Ga0207692_1071110113300025898Corn, Switchgrass And Miscanthus RhizosphereKAAFIGLIVTAALLFTMSFTIVKLTNAKYARHKAEAKSAETK
Ga0207642_1029300413300025899Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYSRHKAEAKAGETK
Ga0207643_1047757923300025908Miscanthus RhizosphereMSLNLGDKKAAFVGMIVTAALLFVMAFTIVKLTNAHFEKEKAGEKAK
Ga0207663_1084423413300025916Corn, Switchgrass And Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYARHKAEAKSAQTK
Ga0207657_1027875713300025919Corn RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYN
Ga0207649_1139413613300025920Corn RhizosphereMSLHLGDKKAAFVGMIGTAALLFVMAFTIVKLTNSHFEKEKAAEKK
Ga0207650_1185675013300025925Switchgrass RhizosphereMSLHLGDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAAEKK
Ga0207644_1012810933300025931Switchgrass RhizosphereRQLRLSTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYSKHKAEAKTAETK
Ga0207644_1142605623300025931Switchgrass RhizosphereKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEKAGEKAK
Ga0207690_1154198023300025932Corn RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYAKHKAEAKSAETK
Ga0207709_1081558113300025935Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGQTK
Ga0207669_1187577023300025937Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFMMSFTIVKLTNAKYTKHKAEAKTAETK
Ga0207704_1021274013300025938Miscanthus RhizosphereSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKAAETK
Ga0207689_1172430123300025942Miscanthus RhizosphereMSLYAGDKRAAFVGMIVTAALLFVMAFTIVKLTNAKF
Ga0207679_1003377513300025945Corn RhizosphereMSLHLGDKKAAFVGMIVTAALLFVMAFTIVKLTNSHFEKEKAGEK
Ga0207679_1140980313300025945Corn RhizosphereLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGQTK
Ga0207640_1051839123300025981Corn RhizosphereMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNAHFEKEMAGEKAK
Ga0207677_1071926213300026023Miscanthus RhizosphereIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGQTK
Ga0207677_1115951723300026023Miscanthus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKA
Ga0207639_1199586213300026041Corn RhizosphereYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKTAETK
Ga0207648_1038414613300026089Miscanthus RhizosphereAAFVGMIVTTALLFIMAFTIVKLTNAKFAGHKAEGKAGETK
Ga0209481_1072960813300027880Populus RhizosphereAFIGLIVTALLLFTMSFTIVKLTNAKFARHKAEAKSAETK
Ga0207428_1019749633300027907Populus RhizosphereMSLYPEDKKAAFIGLIVTAALLFAMSFTIVKLTNAKFAKHKAEAKSAETK
Ga0209382_1045603013300027909Populus RhizosphereMAHHHGSDKGAAFVGMIVTTALLFIMAFTIVKLTNAKFAGHAAEAKAGQNK
Ga0209382_1112154613300027909Populus RhizosphereGLIVTALLLFTMSFTIVKLTNAKFARHKAEAKSAETK
Ga0209382_1123965123300027909Populus RhizosphereMSLYPEDKKAAFIGLIVTAVLLFAMSFTIVKLTNAKFARHKAETKAAETK
Ga0209382_1209257813300027909Populus RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKT
Ga0268266_1079919223300028379Switchgrass RhizosphereDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK
Ga0268264_1035145113300028381Switchgrass RhizosphereSTMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKHKAEAKAAETK
Ga0268264_1140615423300028381Switchgrass RhizosphereMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKQQAEAK
Ga0307408_100001587143300031548RhizosphereMSLYPEDKKAAFIGLIVTAALLFAMSFTIVKLTNAKFARHKAEAKAAETK
Ga0310813_1163000323300031716SoilKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK
Ga0307468_10089418123300031740Hardwood Forest SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKFAKHKAEAKAAETK
Ga0307413_1027907823300031824RhizosphereMSLHAGDKSAAFIGMIVTAGLLFAMAFGIVKATNAKFEAHKAEAKAGAPKH
(restricted) Ga0255338_10001322313300031825Sandy SoilMSLHTGDKRAGFVGLIATAGLLFLMSFTIVKLTNAKYAGHGAEEKAGQRK
Ga0308175_10087521113300031938SoilMSLHLEDKKAAFVGMIVTTALLFVMAFTIVKLTNSHFEKEKAAEKK
Ga0310902_1002869313300032012SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNK
Ga0310812_1006906823300032421SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKLKAEEAKAGATK
Ga0310811_1082171113300033475SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKYNKH
Ga0314786_187716_330_4823300034664SoilMSLYPEDKKAAFIGLIVTAALLFTMSFTIVKLTNAKFAKHKAEAKSAETK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.