| Basic Information | |
|---|---|
| Family ID | F079165 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.41 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 94.83 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.276 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 4.31 |
| PF08299 | Bac_DnaA_C | 4.31 |
| PF08281 | Sigma70_r4_2 | 2.59 |
| PF02517 | Rce1-like | 1.72 |
| PF05685 | Uma2 | 1.72 |
| PF07992 | Pyr_redox_2 | 0.86 |
| PF01381 | HTH_3 | 0.86 |
| PF07969 | Amidohydro_3 | 0.86 |
| PF13193 | AMP-binding_C | 0.86 |
| PF07676 | PD40 | 0.86 |
| PF13744 | HTH_37 | 0.86 |
| PF13683 | rve_3 | 0.86 |
| PF01850 | PIN | 0.86 |
| PF02678 | Pirin | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 4.31 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.72 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.72 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.28 % |
| Unclassified | root | N/A | 1.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104548220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 819 | Open in IMG/M |
| 3300003889|Ga0062441_1104166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 529 | Open in IMG/M |
| 3300004152|Ga0062386_101727274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 522 | Open in IMG/M |
| 3300005166|Ga0066674_10371971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 668 | Open in IMG/M |
| 3300005538|Ga0070731_10034233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3428 | Open in IMG/M |
| 3300005610|Ga0070763_10617229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 630 | Open in IMG/M |
| 3300005610|Ga0070763_10741275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 578 | Open in IMG/M |
| 3300005617|Ga0068859_102129559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 619 | Open in IMG/M |
| 3300005764|Ga0066903_107983383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 543 | Open in IMG/M |
| 3300006172|Ga0075018_10202613 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009038|Ga0099829_11259791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 612 | Open in IMG/M |
| 3300009088|Ga0099830_11869832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 502 | Open in IMG/M |
| 3300009143|Ga0099792_11134151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 528 | Open in IMG/M |
| 3300009177|Ga0105248_11123618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 888 | Open in IMG/M |
| 3300009500|Ga0116229_10321779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300009510|Ga0116230_10121385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2206 | Open in IMG/M |
| 3300009545|Ga0105237_12580925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 519 | Open in IMG/M |
| 3300009551|Ga0105238_12109274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 598 | Open in IMG/M |
| 3300009638|Ga0116113_1147604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 588 | Open in IMG/M |
| 3300009672|Ga0116215_1484645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 535 | Open in IMG/M |
| 3300010049|Ga0123356_12787935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 612 | Open in IMG/M |
| 3300010361|Ga0126378_11782531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 700 | Open in IMG/M |
| 3300010366|Ga0126379_12266683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 644 | Open in IMG/M |
| 3300010366|Ga0126379_12807182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 583 | Open in IMG/M |
| 3300010379|Ga0136449_102025447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 849 | Open in IMG/M |
| 3300010391|Ga0136847_11216479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 661 | Open in IMG/M |
| 3300011064|Ga0138525_1007553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 517 | Open in IMG/M |
| 3300012096|Ga0137389_11705368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 526 | Open in IMG/M |
| 3300012209|Ga0137379_10678002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 937 | Open in IMG/M |
| 3300012209|Ga0137379_10865029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 809 | Open in IMG/M |
| 3300012285|Ga0137370_10134343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300012361|Ga0137360_10270295 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300012363|Ga0137390_10654712 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012469|Ga0150984_119672281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 529 | Open in IMG/M |
| 3300012944|Ga0137410_10021103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4485 | Open in IMG/M |
| 3300012971|Ga0126369_11367667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 798 | Open in IMG/M |
| 3300014167|Ga0181528_10348170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 804 | Open in IMG/M |
| 3300014200|Ga0181526_11000985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 525 | Open in IMG/M |
| 3300014491|Ga0182014_10577044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 545 | Open in IMG/M |
| 3300014492|Ga0182013_10594779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 564 | Open in IMG/M |
| 3300014498|Ga0182019_10887596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 642 | Open in IMG/M |
| 3300014498|Ga0182019_11331957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 531 | Open in IMG/M |
| 3300014655|Ga0181516_10312017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 800 | Open in IMG/M |
| 3300014838|Ga0182030_10469380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1273 | Open in IMG/M |
| 3300014838|Ga0182030_11188927 | Not Available | 652 | Open in IMG/M |
| 3300014969|Ga0157376_11580647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 690 | Open in IMG/M |
| 3300015245|Ga0137409_11075981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 643 | Open in IMG/M |
| 3300016270|Ga0182036_11318623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 603 | Open in IMG/M |
| 3300017940|Ga0187853_10397072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 611 | Open in IMG/M |
| 3300017941|Ga0187850_10383993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 614 | Open in IMG/M |
| 3300017948|Ga0187847_10120552 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300017948|Ga0187847_10336900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 826 | Open in IMG/M |
| 3300018035|Ga0187875_10773677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 502 | Open in IMG/M |
| 3300018083|Ga0184628_10406835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 711 | Open in IMG/M |
| 3300018085|Ga0187772_11169074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 566 | Open in IMG/M |
| 3300018431|Ga0066655_10568756 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300020583|Ga0210401_10279589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
| 3300020610|Ga0154015_1587628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 653 | Open in IMG/M |
| 3300021171|Ga0210405_10540394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 911 | Open in IMG/M |
| 3300021178|Ga0210408_10629363 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300021401|Ga0210393_10373518 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300021403|Ga0210397_10890786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 689 | Open in IMG/M |
| 3300021407|Ga0210383_10882003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 763 | Open in IMG/M |
| 3300021432|Ga0210384_10161933 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300021479|Ga0210410_11403279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 591 | Open in IMG/M |
| 3300021559|Ga0210409_11205805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 632 | Open in IMG/M |
| 3300022511|Ga0242651_1035286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 577 | Open in IMG/M |
| 3300022557|Ga0212123_10448491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 851 | Open in IMG/M |
| 3300025854|Ga0209176_10025937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium zucineum | 1230 | Open in IMG/M |
| 3300026223|Ga0209840_1061100 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300026551|Ga0209648_10541776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 654 | Open in IMG/M |
| 3300027619|Ga0209330_1108718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 630 | Open in IMG/M |
| 3300027807|Ga0209208_10086084 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300027815|Ga0209726_10395598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 645 | Open in IMG/M |
| 3300027817|Ga0209112_10078035 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300028381|Ga0268264_12258241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 551 | Open in IMG/M |
| 3300028536|Ga0137415_10321253 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300028560|Ga0302144_10116108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 862 | Open in IMG/M |
| 3300028860|Ga0302199_1265093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 515 | Open in IMG/M |
| 3300028863|Ga0302218_10060148 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300028906|Ga0308309_10963806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 740 | Open in IMG/M |
| 3300028906|Ga0308309_11020283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 716 | Open in IMG/M |
| 3300029636|Ga0222749_10400503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 727 | Open in IMG/M |
| 3300029913|Ga0311362_11249342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 547 | Open in IMG/M |
| 3300029922|Ga0311363_11605366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 513 | Open in IMG/M |
| 3300029945|Ga0311330_10668981 | Not Available | 805 | Open in IMG/M |
| 3300029952|Ga0311346_11183701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 598 | Open in IMG/M |
| 3300029985|Ga0302280_1209832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 677 | Open in IMG/M |
| 3300029987|Ga0311334_11676614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 541 | Open in IMG/M |
| 3300029999|Ga0311339_11344832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 645 | Open in IMG/M |
| 3300030000|Ga0311337_11560669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 579 | Open in IMG/M |
| 3300030043|Ga0302306_10249450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 681 | Open in IMG/M |
| 3300030617|Ga0311356_12059510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 503 | Open in IMG/M |
| 3300030688|Ga0311345_10661084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 851 | Open in IMG/M |
| 3300031128|Ga0170823_17068161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 511 | Open in IMG/M |
| 3300031236|Ga0302324_102028062 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031446|Ga0170820_12506339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 663 | Open in IMG/M |
| 3300031521|Ga0311364_10924216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 873 | Open in IMG/M |
| 3300031521|Ga0311364_11334706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 711 | Open in IMG/M |
| 3300031524|Ga0302320_12033872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 537 | Open in IMG/M |
| 3300031708|Ga0310686_100791757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 844 | Open in IMG/M |
| 3300031715|Ga0307476_11435595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 502 | Open in IMG/M |
| 3300031823|Ga0307478_11823132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 500 | Open in IMG/M |
| 3300031954|Ga0306926_10934865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300031962|Ga0307479_12138154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 507 | Open in IMG/M |
| 3300032008|Ga0318562_10110437 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300032805|Ga0335078_11240160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 857 | Open in IMG/M |
| 3300032805|Ga0335078_11949689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 631 | Open in IMG/M |
| 3300032954|Ga0335083_10764175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 778 | Open in IMG/M |
| 3300033134|Ga0335073_10218482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2351 | Open in IMG/M |
| 3300033158|Ga0335077_11851030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 565 | Open in IMG/M |
| 3300033485|Ga0316626_11404921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 627 | Open in IMG/M |
| 3300033888|Ga0334792_167934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 545 | Open in IMG/M |
| 3300034199|Ga0370514_093257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 767 | Open in IMG/M |
| 3300034268|Ga0372943_0893066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 591 | Open in IMG/M |
| 3300034281|Ga0370481_0347371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.17% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 0.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.86% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003889 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1045482201 | 3300000364 | Soil | MIKSDAQRERTIAQIEGFRRALAEVAEEKRGRRSAAIRGSY |
| Ga0062441_11041661 | 3300003889 | Anaerobic Enrichment Culture | MIKSDAQRDRTLAQIAGFRQALAKVELESTGRRSAAIRGSYEGMIR |
| Ga0062386_1017272741 | 3300004152 | Bog Forest Soil | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAILGSYEGMIR |
| Ga0066674_103719711 | 3300005166 | Soil | MIKSDAQRDGTLAQIEGFRQALAKVEQEKPGKRSAAIRGSYESMIRQLEDE |
| Ga0070731_100342337 | 3300005538 | Surface Soil | MIKSDAQRERTTAQIEGFRQALAKVDREMTGKRAAAVRGSYEGMIRQLE |
| Ga0070763_106172292 | 3300005610 | Soil | MIKSDAQRERTAAQVEGFRQALTKVDREMAGKRAMAVR |
| Ga0070763_107412752 | 3300005610 | Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVR |
| Ga0068859_1021295592 | 3300005617 | Switchgrass Rhizosphere | MIKSDAQRERTAAQIEGFRVALNKVDREMTGKRAETVRGSYEGMIRQ |
| Ga0066903_1079833831 | 3300005764 | Tropical Forest Soil | MIKSDAERERTVAQIEGFRRALAKVAEEKPAKRSAAVRGSYEGMIRQLEEE |
| Ga0075018_102026131 | 3300006172 | Watersheds | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRATAVRGSYEGMM |
| Ga0099829_112597912 | 3300009038 | Vadose Zone Soil | MIKSDAQRERTVAQIEGFRQALAKVEEGTSRKRSKAVR |
| Ga0099830_118698322 | 3300009088 | Vadose Zone Soil | MNMIKSDAQRARTLAQIEGLRQALGKVEKERPGKRSA |
| Ga0099792_111341512 | 3300009143 | Vadose Zone Soil | MIKSDAQRARTVAQIEGFRQALGKVELERPGKRSDAIRGSYEG |
| Ga0105248_111236183 | 3300009177 | Switchgrass Rhizosphere | MIKSDAQRERTVAQIEGFQQALAKVGEGKPDKRSA |
| Ga0116229_103217792 | 3300009500 | Host-Associated | MIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEK* |
| Ga0116230_101213853 | 3300009510 | Host-Associated | MIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEKLT* |
| Ga0105237_125809252 | 3300009545 | Corn Rhizosphere | MIKSDAQRERTEAQIKGFQQALAKVDREMTGKRAT |
| Ga0105238_121092741 | 3300009551 | Corn Rhizosphere | MIKSDAQRERTAAQIEGFRVALNKVDREMTGKRAETVRGSYEGMIRQL |
| Ga0116113_11476042 | 3300009638 | Peatland | MIKSDAQRERTAAQIEGFRQALAKVDREMTGKRADAVRGSYESMIRQLEDELH |
| Ga0116215_14846451 | 3300009672 | Peatlands Soil | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGSYE |
| Ga0123356_127879352 | 3300010049 | Termite Gut | MIKNDAQRVRTVAQIEGFRRALAKVDEEKPGKRSRAVRGSYEGMLRQ |
| Ga0126378_117825311 | 3300010361 | Tropical Forest Soil | MIKSDAQRERTVTQIEGFRRALAKVAEDKPGKRSDAIRGSYEGMIRQLED |
| Ga0126379_122666833 | 3300010366 | Tropical Forest Soil | MIKSDAQRDRTLAQIEGFRQALAKAEQERAGRRFAALRGS |
| Ga0126379_128071821 | 3300010366 | Tropical Forest Soil | MIKSDEQRERTVAQIEGFRRALAKAADEKAGKRSAAIRGSYEGMIRQL |
| Ga0136449_1020254471 | 3300010379 | Peatlands Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAV |
| Ga0136847_112164791 | 3300010391 | Freshwater Sediment | MIKSDAQRERTLAQIEGFRKALAKVEQEAHGKRSKAI |
| Ga0138525_10075531 | 3300011064 | Peatlands Soil | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSA |
| Ga0137389_117053682 | 3300012096 | Vadose Zone Soil | MIKSEAQRERTVVRIEGFKQALAKAPRDKHGKRSVAIRGSYESMIRQL |
| Ga0137379_106780022 | 3300012209 | Vadose Zone Soil | MIKSDAQRDRTLAQIEGFRRALAMAEQAKPGTRSAAIRGSYEGMIGQLEEEL |
| Ga0137379_108650293 | 3300012209 | Vadose Zone Soil | MIKSDAQRDRTVAQIEDFRRALAKAEVEEPGKRSGAIRGSY |
| Ga0137370_101343434 | 3300012285 | Vadose Zone Soil | MIKSDAQRDRTLAQIEGFRQALAKVEQEKPGKRSAAIRGS |
| Ga0137360_102702954 | 3300012361 | Vadose Zone Soil | MIKSDAQRERIAAQIEGFRQALAKTEREMTGKRAAAVRGSYEGMIRQLEDE |
| Ga0137390_106547121 | 3300012363 | Vadose Zone Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYEGMIRQLEDELR |
| Ga0150984_1196722811 | 3300012469 | Avena Fatua Rhizosphere | MIKSDAQRDRTVAQIEGFRRALGKAEQEKPGKRSAVIRGSY |
| Ga0137410_100211039 | 3300012944 | Vadose Zone Soil | MIKSDAQRERTAAQIAGFRQALAQVDQDMTGKRASAARGSYEGMIRQLE |
| Ga0126369_113676671 | 3300012971 | Tropical Forest Soil | MIKSDAQRDRTLAQIEGFRRALVKVTDEKPGKRSAAIRGSYEGMIRQLEEELR |
| Ga0181528_103481703 | 3300014167 | Bog | VIKSDAQRDRTLAQIEGFRRALAKQQEKPGKRSVAIRGSYE |
| Ga0181526_110009852 | 3300014200 | Bog | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYE |
| Ga0182014_105770441 | 3300014491 | Bog | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAVRGSYEGMI |
| Ga0182013_105947792 | 3300014492 | Bog | MIKSDAQRDRTVAQIEGFRRALAKAEVEEPGKRSA |
| Ga0182019_108875961 | 3300014498 | Fen | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGSYEGMIRQLED |
| Ga0182019_113319571 | 3300014498 | Fen | MIKSDAQRDRTIAQIEGFRRALAKAEVDEPGKRSVAIRGSYEGMIRQLEDE |
| Ga0181516_103120171 | 3300014655 | Bog | MIKSDAQRDRTLAQIEGFRRALAKADEDTPGKRSAAIRGSYESMIRQLEDEL |
| Ga0182030_104693804 | 3300014838 | Bog | MIKSEAQRERTMTQMAGFRQALAKVARDKPGRRSAAIRASYEGMIRQ |
| Ga0182030_111889271 | 3300014838 | Bog | MDTIKSDAQRERTAAQLAGFRRALTRVQPDAARKRSAAVRASYE |
| Ga0157376_115806471 | 3300014969 | Miscanthus Rhizosphere | MIKSEAQRDRTLTQIEGFRQALSKVDREKPGKRSMAIRGSYEGMIRQLEDDL |
| Ga0137409_110759812 | 3300015245 | Vadose Zone Soil | MIKSDAQRERTAAQIEGFRQALAKVDQEMAGKRAGAVRDSYEG |
| Ga0182036_113186231 | 3300016270 | Soil | MIKSDAQRERTAAQIEGFRRALTKVAQEKAGRRSAAIRGSYEGMI |
| Ga0187853_103970722 | 3300017940 | Peatland | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAA |
| Ga0187850_103839931 | 3300017941 | Peatland | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRRAAVRGS |
| Ga0187847_101205523 | 3300017948 | Peatland | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVHGSYEGMIRQLENELLE |
| Ga0187847_103369002 | 3300017948 | Peatland | VIKSDAQRDRTLAQIEGFRRALAKQQEKPGKRSVAIRG |
| Ga0187875_107736772 | 3300018035 | Peatland | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGS |
| Ga0184628_104068352 | 3300018083 | Groundwater Sediment | MIKSDAQRERTVAQIEGFHQALAKVGDGKADKRSAAVRGSYQ |
| Ga0187772_111690741 | 3300018085 | Tropical Peatland | MIKTEAQRNRTLVQIEGFRRALGQAAEELSGKRAAAV |
| Ga0066655_105687561 | 3300018431 | Grasslands Soil | MIKSDAQRERTVVQIEGFQRALAELGERKLDKRSAAIR |
| Ga0210401_102795893 | 3300020583 | Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMMRQL |
| Ga0154015_15876281 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAAAVRGSYEGMIRQLEEE |
| Ga0210405_105403941 | 3300021171 | Soil | MIKSDAQRERTVAQIEGFRQALTKVDREMTGKRATAV |
| Ga0210408_106293633 | 3300021178 | Soil | MIKSDAQRDRALAQIEGFRQALDTAKAELSGTRARAVVGSHEGMILQLEAEVRE |
| Ga0210393_103735181 | 3300021401 | Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRSS |
| Ga0210397_108907861 | 3300021403 | Soil | MIKSDAQRERTASQIEGFRQALVKVEREMTGKRAAAVRGSYE |
| Ga0210383_108820032 | 3300021407 | Soil | MIKSDAQRERTTAQIEGFRQALTKVDREMTGKRATAVRSSYEGMMRQL |
| Ga0210384_101619335 | 3300021432 | Soil | MIKSDAQRERTAAQIEGFRQALAKVDREMTGKRAG |
| Ga0210410_114032792 | 3300021479 | Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMA |
| Ga0210409_112058052 | 3300021559 | Soil | MIKSDAQRERTVAQIEGFRQALTKVDREMTGKRATAVRGSY |
| Ga0242651_10352861 | 3300022511 | Soil | MIKSDAQRERAAAQIEGFRVALNKVDREMTGKRADAVRGSYAGMIRQLEDELR |
| Ga0212123_104484914 | 3300022557 | Iron-Sulfur Acid Spring | MIKSDAQRERTVVQIEGFRQALAKVAVEQPGKRSAAIRGSYEGM |
| Ga0209176_100259374 | 3300025854 | Arctic Peat Soil | MIKSDAQRERTVAQIAGFRQALAKVEREAPGKRAAAVRGS |
| Ga0209840_10611001 | 3300026223 | Soil | MIKSDAQRERTVAQIAGFRQALAKVEREAPGKRAAAVRGSYEG |
| Ga0209648_105417762 | 3300026551 | Grasslands Soil | VIKSDAQRERTVVQVEGFRQALAKVEEGTSRKRSKAVRGSYESMIRQ |
| Ga0209330_11087181 | 3300027619 | Forest Soil | MIKSDAQRERTAAQIEGFRQGLTKVDREMTGKRAIAVRGSYE |
| Ga0209208_100860843 | 3300027807 | Host-Associated | MIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEKLT |
| Ga0209726_103955981 | 3300027815 | Groundwater | MIKSDAQRERTVAQIEGFRQALAKAEREMPGKRFAAVRGSYQSMIQQLED |
| Ga0209112_100780351 | 3300027817 | Forest Soil | MIKSDAQRERTAAQIEGFRQALATVDREMTGKRAAAVRG |
| Ga0268264_122582411 | 3300028381 | Switchgrass Rhizosphere | MIKSDAQRERTLAQIEGFRQALAKTEREMTGKRAAAVRGSYEG |
| Ga0137415_103212534 | 3300028536 | Vadose Zone Soil | MIKSDAQRERTAAQIEGFRQALNKANGEMTGKRAGAVRGSYEGMI |
| Ga0302144_101161082 | 3300028560 | Bog | MIKSDAQRDRTLAQIEGFRRALATAEQEKRGKRSAAVRGSYE |
| Ga0302199_12650931 | 3300028860 | Bog | MIKSDAQRDRTLAQIEGFRRALATAEQEKRGKRSAAVRG |
| Ga0302218_100601483 | 3300028863 | Palsa | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLEDELR |
| Ga0308309_109638061 | 3300028906 | Soil | MIKSDAQRERTAAQIEGFRQALAKVDQEMTGKRAGAVR |
| Ga0308309_110202831 | 3300028906 | Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMMRQLEDELR |
| Ga0222749_104005033 | 3300029636 | Soil | MIKSDAQRERTVAQIEGFRQALTKVAREMTAKRAIAVRGSYEGMIRQLE |
| Ga0311362_112493422 | 3300029913 | Bog | MIKSDAQRERTAAQIEGFRQALTKVDREMNGKRAIAVRGSYEGMIRQLED |
| Ga0311363_116053662 | 3300029922 | Fen | MMIKSDAQRERTAAQIDGFRQALAKAEQEMTGKRAAAVRGSYE |
| Ga0311330_106689812 | 3300029945 | Bog | MIKSDAQRERTAAQLEGFRQAIARVDREMTGKRAVAVRGSYEGTIRQLEDEIREY |
| Ga0311346_111837011 | 3300029952 | Bog | MIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAILGSYAGMIR |
| Ga0302280_12098321 | 3300029985 | Fen | MIKSDAQRERTAAQIEGFRQALAKVDREMTGKRADAVRGSYESM |
| Ga0311334_116766142 | 3300029987 | Fen | MIKSDAQRDRTLAQIEGFRRALAKADEEKPGKRSAAI |
| Ga0311339_113448321 | 3300029999 | Palsa | MMIKSDAQRERTAAQIDGFRQALAKAEQEMTGKRAAA |
| Ga0311337_115606691 | 3300030000 | Fen | MIKTDAQRARTATQIEGFRRALAEAVSAGGSRNRVNALRGSYEAMIRQLEEEIEEYD |
| Ga0302306_102494502 | 3300030043 | Palsa | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYESMIRQL |
| Ga0311356_120595101 | 3300030617 | Palsa | MIKSDAQRDRTLAQIEGFRQALAKAGQEKPGKRAAAIRGSYQG |
| Ga0311345_106610841 | 3300030688 | Bog | MIKSDAQRQRTAAQIEGFRQALTKVDREMTGKRAIAVRGSYEGMIRQLED |
| Ga0170823_170681611 | 3300031128 | Forest Soil | MIKSDAQRERTAAQLEGFRQALNKVDREMTGKRAVAVRGS |
| Ga0302324_1020280623 | 3300031236 | Palsa | MIKSDAQKERTAAQIEGFRQALAKAEREMAGKRAVAIRESYEGMIRQLEDDMRDL |
| Ga0170820_125063393 | 3300031446 | Forest Soil | MIKSDAQRERAAAQLEGFRLALNKVDREMTGKRAGAVR |
| Ga0311364_109242161 | 3300031521 | Fen | MIKSDAQRERTRVQIEGFRKALAQVEEQTSGKRSEAVRTSYESMIRQLE |
| Ga0311364_113347061 | 3300031521 | Fen | MIKSDAQRDRTVAQIEGFRRALAKAEVDEPGKRSAAIRGSYEGMIRQLE |
| Ga0302320_120338721 | 3300031524 | Bog | MIKSDAQRERTAAQIEGFRQALTKVDREMNGKRAIAV |
| Ga0310686_1007917572 | 3300031708 | Soil | MIKSDAQRERTVARIEGFHQALAKVDREMTGKRAVAVRGSYEGMI |
| Ga0307476_114355952 | 3300031715 | Hardwood Forest Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLED |
| Ga0307478_118231322 | 3300031823 | Hardwood Forest Soil | MIKSDAQRERTAAQIDGFRQALTKVDREMTGKRAIAVR |
| Ga0306926_109348652 | 3300031954 | Soil | MIKSDAQRERTVAQIEGFRRALAKVAEERAGKGSAAVRGSLKG |
| Ga0307479_121381542 | 3300031962 | Hardwood Forest Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLEDDL |
| Ga0318562_101104374 | 3300032008 | Soil | MIKSDAQRERTAAQIEGFRQARAKVDREMTGKRATAVR |
| Ga0335078_112401601 | 3300032805 | Soil | MIKSDTQRERTVAQIEGFRRALAKVAEEKPGKRSASI |
| Ga0335078_119496891 | 3300032805 | Soil | MIKSDAQRDRTLAQIEGFRRALAKAEQEKRDKRSAAV |
| Ga0335083_107641753 | 3300032954 | Soil | MIKSDAQRERTATQIEGFRQALAKVRDGKPDKRSAAIRGSYESMIRQLE |
| Ga0335073_102184824 | 3300033134 | Soil | MIKSDAQRERTFAQIEGFRQALAKVASEKPGKRSAAIRGSYEGMIRQ |
| Ga0335077_118510302 | 3300033158 | Soil | MIKSDAQRERTLAQIEGFRQAIAKVASEKPGKRAAAIRGSY |
| Ga0316626_114049212 | 3300033485 | Soil | MIKSDAQRERTIVQIEGFRKALAQAEEQMSDKRAAAVRA |
| Ga0334792_167934_1_117 | 3300033888 | Soil | MIKSDAQRDRTVAQIEGFRRALAKADVEEPGKRSAAIRG |
| Ga0370514_093257_2_148 | 3300034199 | Untreated Peat Soil | MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRALAVRGSYEGMIRQLE |
| Ga0372943_0893066_2_130 | 3300034268 | Soil | MIKSDAQRERTAAQIEGFRQALAKVTQDKPNKRSAAVRGSYES |
| Ga0370481_0347371_2_112 | 3300034281 | Untreated Peat Soil | MIKSDAQRERTMAQIEGFRQALAKVAKDTPAKRSAAI |
| ⦗Top⦘ |