NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079165

Metagenome / Metatranscriptome Family F079165

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079165
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 44 residues
Representative Sequence MIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYE
Number of Associated Samples 107
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.41 %
% of genes near scaffold ends (potentially truncated) 96.55 %
% of genes from short scaffolds (< 2000 bps) 94.83 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.276 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.207 % of family members)
Environment Ontology (ENVO) Unclassified
(22.414 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.690 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00589Phage_integrase 4.31
PF08299Bac_DnaA_C 4.31
PF08281Sigma70_r4_2 2.59
PF02517Rce1-like 1.72
PF05685Uma2 1.72
PF07992Pyr_redox_2 0.86
PF01381HTH_3 0.86
PF07969Amidohydro_3 0.86
PF13193AMP-binding_C 0.86
PF07676PD40 0.86
PF13744HTH_37 0.86
PF13683rve_3 0.86
PF01850PIN 0.86
PF02678Pirin 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 4.31
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 1.72
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 1.72
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.72
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.28 %
UnclassifiedrootN/A1.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104548220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales819Open in IMG/M
3300003889|Ga0062441_1104166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales529Open in IMG/M
3300004152|Ga0062386_101727274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales522Open in IMG/M
3300005166|Ga0066674_10371971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales668Open in IMG/M
3300005538|Ga0070731_10034233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3428Open in IMG/M
3300005610|Ga0070763_10617229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales630Open in IMG/M
3300005610|Ga0070763_10741275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales578Open in IMG/M
3300005617|Ga0068859_102129559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales619Open in IMG/M
3300005764|Ga0066903_107983383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales543Open in IMG/M
3300006172|Ga0075018_10202613All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300009038|Ga0099829_11259791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales612Open in IMG/M
3300009088|Ga0099830_11869832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales502Open in IMG/M
3300009143|Ga0099792_11134151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales528Open in IMG/M
3300009177|Ga0105248_11123618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales888Open in IMG/M
3300009500|Ga0116229_10321779All Organisms → cellular organisms → Bacteria → Acidobacteria1302Open in IMG/M
3300009510|Ga0116230_10121385All Organisms → cellular organisms → Bacteria → Acidobacteria2206Open in IMG/M
3300009545|Ga0105237_12580925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales519Open in IMG/M
3300009551|Ga0105238_12109274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales598Open in IMG/M
3300009638|Ga0116113_1147604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales588Open in IMG/M
3300009672|Ga0116215_1484645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales535Open in IMG/M
3300010049|Ga0123356_12787935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum612Open in IMG/M
3300010361|Ga0126378_11782531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales700Open in IMG/M
3300010366|Ga0126379_12266683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales644Open in IMG/M
3300010366|Ga0126379_12807182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales583Open in IMG/M
3300010379|Ga0136449_102025447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales849Open in IMG/M
3300010391|Ga0136847_11216479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales661Open in IMG/M
3300011064|Ga0138525_1007553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales517Open in IMG/M
3300012096|Ga0137389_11705368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales526Open in IMG/M
3300012209|Ga0137379_10678002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales937Open in IMG/M
3300012209|Ga0137379_10865029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales809Open in IMG/M
3300012285|Ga0137370_10134343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300012361|Ga0137360_10270295All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300012363|Ga0137390_10654712All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300012469|Ga0150984_119672281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales529Open in IMG/M
3300012944|Ga0137410_10021103All Organisms → cellular organisms → Bacteria → Proteobacteria4485Open in IMG/M
3300012971|Ga0126369_11367667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales798Open in IMG/M
3300014167|Ga0181528_10348170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales804Open in IMG/M
3300014200|Ga0181526_11000985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales525Open in IMG/M
3300014491|Ga0182014_10577044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales545Open in IMG/M
3300014492|Ga0182013_10594779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales564Open in IMG/M
3300014498|Ga0182019_10887596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales642Open in IMG/M
3300014498|Ga0182019_11331957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales531Open in IMG/M
3300014655|Ga0181516_10312017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales800Open in IMG/M
3300014838|Ga0182030_10469380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1273Open in IMG/M
3300014838|Ga0182030_11188927Not Available652Open in IMG/M
3300014969|Ga0157376_11580647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales690Open in IMG/M
3300015245|Ga0137409_11075981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales643Open in IMG/M
3300016270|Ga0182036_11318623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales603Open in IMG/M
3300017940|Ga0187853_10397072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales611Open in IMG/M
3300017941|Ga0187850_10383993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales614Open in IMG/M
3300017948|Ga0187847_10120552All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300017948|Ga0187847_10336900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales826Open in IMG/M
3300018035|Ga0187875_10773677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales502Open in IMG/M
3300018083|Ga0184628_10406835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales711Open in IMG/M
3300018085|Ga0187772_11169074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales566Open in IMG/M
3300018431|Ga0066655_10568756All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300020583|Ga0210401_10279589All Organisms → cellular organisms → Bacteria → Acidobacteria1529Open in IMG/M
3300020610|Ga0154015_1587628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales653Open in IMG/M
3300021171|Ga0210405_10540394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales911Open in IMG/M
3300021178|Ga0210408_10629363All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300021401|Ga0210393_10373518All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300021403|Ga0210397_10890786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales689Open in IMG/M
3300021407|Ga0210383_10882003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales763Open in IMG/M
3300021432|Ga0210384_10161933All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300021479|Ga0210410_11403279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales591Open in IMG/M
3300021559|Ga0210409_11205805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales632Open in IMG/M
3300022511|Ga0242651_1035286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales577Open in IMG/M
3300022557|Ga0212123_10448491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales851Open in IMG/M
3300025854|Ga0209176_10025937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium zucineum1230Open in IMG/M
3300026223|Ga0209840_1061100All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300026551|Ga0209648_10541776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales654Open in IMG/M
3300027619|Ga0209330_1108718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales630Open in IMG/M
3300027807|Ga0209208_10086084All Organisms → cellular organisms → Bacteria2249Open in IMG/M
3300027815|Ga0209726_10395598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales645Open in IMG/M
3300027817|Ga0209112_10078035All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300028381|Ga0268264_12258241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales551Open in IMG/M
3300028536|Ga0137415_10321253All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300028560|Ga0302144_10116108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales862Open in IMG/M
3300028860|Ga0302199_1265093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales515Open in IMG/M
3300028863|Ga0302218_10060148All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300028906|Ga0308309_10963806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales740Open in IMG/M
3300028906|Ga0308309_11020283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales716Open in IMG/M
3300029636|Ga0222749_10400503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales727Open in IMG/M
3300029913|Ga0311362_11249342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales547Open in IMG/M
3300029922|Ga0311363_11605366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales513Open in IMG/M
3300029945|Ga0311330_10668981Not Available805Open in IMG/M
3300029952|Ga0311346_11183701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales598Open in IMG/M
3300029985|Ga0302280_1209832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales677Open in IMG/M
3300029987|Ga0311334_11676614All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales541Open in IMG/M
3300029999|Ga0311339_11344832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales645Open in IMG/M
3300030000|Ga0311337_11560669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales579Open in IMG/M
3300030043|Ga0302306_10249450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales681Open in IMG/M
3300030617|Ga0311356_12059510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales503Open in IMG/M
3300030688|Ga0311345_10661084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales851Open in IMG/M
3300031128|Ga0170823_17068161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales511Open in IMG/M
3300031236|Ga0302324_102028062All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031446|Ga0170820_12506339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales663Open in IMG/M
3300031521|Ga0311364_10924216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales873Open in IMG/M
3300031521|Ga0311364_11334706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales711Open in IMG/M
3300031524|Ga0302320_12033872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales537Open in IMG/M
3300031708|Ga0310686_100791757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales844Open in IMG/M
3300031715|Ga0307476_11435595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales502Open in IMG/M
3300031823|Ga0307478_11823132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales500Open in IMG/M
3300031954|Ga0306926_10934865All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300031962|Ga0307479_12138154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales507Open in IMG/M
3300032008|Ga0318562_10110437All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300032805|Ga0335078_11240160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales857Open in IMG/M
3300032805|Ga0335078_11949689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales631Open in IMG/M
3300032954|Ga0335083_10764175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales778Open in IMG/M
3300033134|Ga0335073_10218482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2351Open in IMG/M
3300033158|Ga0335077_11851030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales565Open in IMG/M
3300033485|Ga0316626_11404921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales627Open in IMG/M
3300033888|Ga0334792_167934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales545Open in IMG/M
3300034199|Ga0370514_093257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales767Open in IMG/M
3300034268|Ga0372943_0893066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales591Open in IMG/M
3300034281|Ga0370481_0347371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.34%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.17%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.45%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.45%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.59%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.72%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.72%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture0.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.86%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.86%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.86%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.86%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.86%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003889Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011064Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10454822013300000364SoilMIKSDAQRERTIAQIEGFRRALAEVAEEKRGRRSAAIRGSY
Ga0062441_110416613300003889Anaerobic Enrichment CultureMIKSDAQRDRTLAQIAGFRQALAKVELESTGRRSAAIRGSYEGMIR
Ga0062386_10172727413300004152Bog Forest SoilMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAILGSYEGMIR
Ga0066674_1037197113300005166SoilMIKSDAQRDGTLAQIEGFRQALAKVEQEKPGKRSAAIRGSYESMIRQLEDE
Ga0070731_1003423373300005538Surface SoilMIKSDAQRERTTAQIEGFRQALAKVDREMTGKRAAAVRGSYEGMIRQLE
Ga0070763_1061722923300005610SoilMIKSDAQRERTAAQVEGFRQALTKVDREMAGKRAMAVR
Ga0070763_1074127523300005610SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVR
Ga0068859_10212955923300005617Switchgrass RhizosphereMIKSDAQRERTAAQIEGFRVALNKVDREMTGKRAETVRGSYEGMIRQ
Ga0066903_10798338313300005764Tropical Forest SoilMIKSDAERERTVAQIEGFRRALAKVAEEKPAKRSAAVRGSYEGMIRQLEEE
Ga0075018_1020261313300006172WatershedsMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRATAVRGSYEGMM
Ga0099829_1125979123300009038Vadose Zone SoilMIKSDAQRERTVAQIEGFRQALAKVEEGTSRKRSKAVR
Ga0099830_1186983223300009088Vadose Zone SoilMNMIKSDAQRARTLAQIEGLRQALGKVEKERPGKRSA
Ga0099792_1113415123300009143Vadose Zone SoilMIKSDAQRARTVAQIEGFRQALGKVELERPGKRSDAIRGSYEG
Ga0105248_1112361833300009177Switchgrass RhizosphereMIKSDAQRERTVAQIEGFQQALAKVGEGKPDKRSA
Ga0116229_1032177923300009500Host-AssociatedMIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEK*
Ga0116230_1012138533300009510Host-AssociatedMIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEKLT*
Ga0105237_1258092523300009545Corn RhizosphereMIKSDAQRERTEAQIKGFQQALAKVDREMTGKRAT
Ga0105238_1210927413300009551Corn RhizosphereMIKSDAQRERTAAQIEGFRVALNKVDREMTGKRAETVRGSYEGMIRQL
Ga0116113_114760423300009638PeatlandMIKSDAQRERTAAQIEGFRQALAKVDREMTGKRADAVRGSYESMIRQLEDELH
Ga0116215_148464513300009672Peatlands SoilMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGSYE
Ga0123356_1278793523300010049Termite GutMIKNDAQRVRTVAQIEGFRRALAKVDEEKPGKRSRAVRGSYEGMLRQ
Ga0126378_1178253113300010361Tropical Forest SoilMIKSDAQRERTVTQIEGFRRALAKVAEDKPGKRSDAIRGSYEGMIRQLED
Ga0126379_1226668333300010366Tropical Forest SoilMIKSDAQRDRTLAQIEGFRQALAKAEQERAGRRFAALRGS
Ga0126379_1280718213300010366Tropical Forest SoilMIKSDEQRERTVAQIEGFRRALAKAADEKAGKRSAAIRGSYEGMIRQL
Ga0136449_10202544713300010379Peatlands SoilMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAV
Ga0136847_1121647913300010391Freshwater SedimentMIKSDAQRERTLAQIEGFRKALAKVEQEAHGKRSKAI
Ga0138525_100755313300011064Peatlands SoilMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSA
Ga0137389_1170536823300012096Vadose Zone SoilMIKSEAQRERTVVRIEGFKQALAKAPRDKHGKRSVAIRGSYESMIRQL
Ga0137379_1067800223300012209Vadose Zone SoilMIKSDAQRDRTLAQIEGFRRALAMAEQAKPGTRSAAIRGSYEGMIGQLEEEL
Ga0137379_1086502933300012209Vadose Zone SoilMIKSDAQRDRTVAQIEDFRRALAKAEVEEPGKRSGAIRGSY
Ga0137370_1013434343300012285Vadose Zone SoilMIKSDAQRDRTLAQIEGFRQALAKVEQEKPGKRSAAIRGS
Ga0137360_1027029543300012361Vadose Zone SoilMIKSDAQRERIAAQIEGFRQALAKTEREMTGKRAAAVRGSYEGMIRQLEDE
Ga0137390_1065471213300012363Vadose Zone SoilMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYEGMIRQLEDELR
Ga0150984_11967228113300012469Avena Fatua RhizosphereMIKSDAQRDRTVAQIEGFRRALGKAEQEKPGKRSAVIRGSY
Ga0137410_1002110393300012944Vadose Zone SoilMIKSDAQRERTAAQIAGFRQALAQVDQDMTGKRASAARGSYEGMIRQLE
Ga0126369_1136766713300012971Tropical Forest SoilMIKSDAQRDRTLAQIEGFRRALVKVTDEKPGKRSAAIRGSYEGMIRQLEEELR
Ga0181528_1034817033300014167BogVIKSDAQRDRTLAQIEGFRRALAKQQEKPGKRSVAIRGSYE
Ga0181526_1100098523300014200BogMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYE
Ga0182014_1057704413300014491BogMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAVRGSYEGMI
Ga0182013_1059477923300014492BogMIKSDAQRDRTVAQIEGFRRALAKAEVEEPGKRSA
Ga0182019_1088759613300014498FenMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGSYEGMIRQLED
Ga0182019_1133195713300014498FenMIKSDAQRDRTIAQIEGFRRALAKAEVDEPGKRSVAIRGSYEGMIRQLEDE
Ga0181516_1031201713300014655BogMIKSDAQRDRTLAQIEGFRRALAKADEDTPGKRSAAIRGSYESMIRQLEDEL
Ga0182030_1046938043300014838BogMIKSEAQRERTMTQMAGFRQALAKVARDKPGRRSAAIRASYEGMIRQ
Ga0182030_1118892713300014838BogMDTIKSDAQRERTAAQLAGFRRALTRVQPDAARKRSAAVRASYE
Ga0157376_1158064713300014969Miscanthus RhizosphereMIKSEAQRDRTLTQIEGFRQALSKVDREKPGKRSMAIRGSYEGMIRQLEDDL
Ga0137409_1107598123300015245Vadose Zone SoilMIKSDAQRERTAAQIEGFRQALAKVDQEMAGKRAGAVRDSYEG
Ga0182036_1131862313300016270SoilMIKSDAQRERTAAQIEGFRRALTKVAQEKAGRRSAAIRGSYEGMI
Ga0187853_1039707223300017940PeatlandMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAA
Ga0187850_1038399313300017941PeatlandMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRRAAVRGS
Ga0187847_1012055233300017948PeatlandMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVHGSYEGMIRQLENELLE
Ga0187847_1033690023300017948PeatlandVIKSDAQRDRTLAQIEGFRRALAKQQEKPGKRSVAIRG
Ga0187875_1077367723300018035PeatlandMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAIRGS
Ga0184628_1040683523300018083Groundwater SedimentMIKSDAQRERTVAQIEGFHQALAKVGDGKADKRSAAVRGSYQ
Ga0187772_1116907413300018085Tropical PeatlandMIKTEAQRNRTLVQIEGFRRALGQAAEELSGKRAAAV
Ga0066655_1056875613300018431Grasslands SoilMIKSDAQRERTVVQIEGFQRALAELGERKLDKRSAAIR
Ga0210401_1027958933300020583SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMMRQL
Ga0154015_158762813300020610Corn, Switchgrass And Miscanthus RhizosphereMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAAAVRGSYEGMIRQLEEE
Ga0210405_1054039413300021171SoilMIKSDAQRERTVAQIEGFRQALTKVDREMTGKRATAV
Ga0210408_1062936333300021178SoilMIKSDAQRDRALAQIEGFRQALDTAKAELSGTRARAVVGSHEGMILQLEAEVRE
Ga0210393_1037351813300021401SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRSS
Ga0210397_1089078613300021403SoilMIKSDAQRERTASQIEGFRQALVKVEREMTGKRAAAVRGSYE
Ga0210383_1088200323300021407SoilMIKSDAQRERTTAQIEGFRQALTKVDREMTGKRATAVRSSYEGMMRQL
Ga0210384_1016193353300021432SoilMIKSDAQRERTAAQIEGFRQALAKVDREMTGKRAG
Ga0210410_1140327923300021479SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMA
Ga0210409_1120580523300021559SoilMIKSDAQRERTVAQIEGFRQALTKVDREMTGKRATAVRGSY
Ga0242651_103528613300022511SoilMIKSDAQRERAAAQIEGFRVALNKVDREMTGKRADAVRGSYAGMIRQLEDELR
Ga0212123_1044849143300022557Iron-Sulfur Acid SpringMIKSDAQRERTVVQIEGFRQALAKVAVEQPGKRSAAIRGSYEGM
Ga0209176_1002593743300025854Arctic Peat SoilMIKSDAQRERTVAQIAGFRQALAKVEREAPGKRAAAVRGS
Ga0209840_106110013300026223SoilMIKSDAQRERTVAQIAGFRQALAKVEREAPGKRAAAVRGSYEG
Ga0209648_1054177623300026551Grasslands SoilVIKSDAQRERTVVQVEGFRQALAKVEEGTSRKRSKAVRGSYESMIRQ
Ga0209330_110871813300027619Forest SoilMIKSDAQRERTAAQIEGFRQGLTKVDREMTGKRAIAVRGSYE
Ga0209208_1008608433300027807Host-AssociatedMIRSDAQRDRTGFQIEGFRGAIAQAEREMSGARAKAVRGSYEGMIRQLEKLT
Ga0209726_1039559813300027815GroundwaterMIKSDAQRERTVAQIEGFRQALAKAEREMPGKRFAAVRGSYQSMIQQLED
Ga0209112_1007803513300027817Forest SoilMIKSDAQRERTAAQIEGFRQALATVDREMTGKRAAAVRG
Ga0268264_1225824113300028381Switchgrass RhizosphereMIKSDAQRERTLAQIEGFRQALAKTEREMTGKRAAAVRGSYEG
Ga0137415_1032125343300028536Vadose Zone SoilMIKSDAQRERTAAQIEGFRQALNKANGEMTGKRAGAVRGSYEGMI
Ga0302144_1011610823300028560BogMIKSDAQRDRTLAQIEGFRRALATAEQEKRGKRSAAVRGSYE
Ga0302199_126509313300028860BogMIKSDAQRDRTLAQIEGFRRALATAEQEKRGKRSAAVRG
Ga0302218_1006014833300028863PalsaMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLEDELR
Ga0308309_1096380613300028906SoilMIKSDAQRERTAAQIEGFRQALAKVDQEMTGKRAGAVR
Ga0308309_1102028313300028906SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMMRQLEDELR
Ga0222749_1040050333300029636SoilMIKSDAQRERTVAQIEGFRQALTKVAREMTAKRAIAVRGSYEGMIRQLE
Ga0311362_1124934223300029913BogMIKSDAQRERTAAQIEGFRQALTKVDREMNGKRAIAVRGSYEGMIRQLED
Ga0311363_1160536623300029922FenMMIKSDAQRERTAAQIDGFRQALAKAEQEMTGKRAAAVRGSYE
Ga0311330_1066898123300029945BogMIKSDAQRERTAAQLEGFRQAIARVDREMTGKRAVAVRGSYEGTIRQLEDEIREY
Ga0311346_1118370113300029952BogMIKSDAQRDRTLAQIEGFRRALAKAEQEKPGKRSAAILGSYAGMIR
Ga0302280_120983213300029985FenMIKSDAQRERTAAQIEGFRQALAKVDREMTGKRADAVRGSYESM
Ga0311334_1167661423300029987FenMIKSDAQRDRTLAQIEGFRRALAKADEEKPGKRSAAI
Ga0311339_1134483213300029999PalsaMMIKSDAQRERTAAQIDGFRQALAKAEQEMTGKRAAA
Ga0311337_1156066913300030000FenMIKTDAQRARTATQIEGFRRALAEAVSAGGSRNRVNALRGSYEAMIRQLEEEIEEYD
Ga0302306_1024945023300030043PalsaMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRAIAVRGSYESMIRQL
Ga0311356_1205951013300030617PalsaMIKSDAQRDRTLAQIEGFRQALAKAGQEKPGKRAAAIRGSYQG
Ga0311345_1066108413300030688BogMIKSDAQRQRTAAQIEGFRQALTKVDREMTGKRAIAVRGSYEGMIRQLED
Ga0170823_1706816113300031128Forest SoilMIKSDAQRERTAAQLEGFRQALNKVDREMTGKRAVAVRGS
Ga0302324_10202806233300031236PalsaMIKSDAQKERTAAQIEGFRQALAKAEREMAGKRAVAIRESYEGMIRQLEDDMRDL
Ga0170820_1250633933300031446Forest SoilMIKSDAQRERAAAQLEGFRLALNKVDREMTGKRAGAVR
Ga0311364_1092421613300031521FenMIKSDAQRERTRVQIEGFRKALAQVEEQTSGKRSEAVRTSYESMIRQLE
Ga0311364_1133470613300031521FenMIKSDAQRDRTVAQIEGFRRALAKAEVDEPGKRSAAIRGSYEGMIRQLE
Ga0302320_1203387213300031524BogMIKSDAQRERTAAQIEGFRQALTKVDREMNGKRAIAV
Ga0310686_10079175723300031708SoilMIKSDAQRERTVARIEGFHQALAKVDREMTGKRAVAVRGSYEGMI
Ga0307476_1143559523300031715Hardwood Forest SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLED
Ga0307478_1182313223300031823Hardwood Forest SoilMIKSDAQRERTAAQIDGFRQALTKVDREMTGKRAIAVR
Ga0306926_1093486523300031954SoilMIKSDAQRERTVAQIEGFRRALAKVAEERAGKGSAAVRGSLKG
Ga0307479_1213815423300031962Hardwood Forest SoilMIKSDAQRERTAAQIEGFRQALTKVDREMAGKRAMAVRGSYEGMIRQLEDDL
Ga0318562_1011043743300032008SoilMIKSDAQRERTAAQIEGFRQARAKVDREMTGKRATAVR
Ga0335078_1124016013300032805SoilMIKSDTQRERTVAQIEGFRRALAKVAEEKPGKRSASI
Ga0335078_1194968913300032805SoilMIKSDAQRDRTLAQIEGFRRALAKAEQEKRDKRSAAV
Ga0335083_1076417533300032954SoilMIKSDAQRERTATQIEGFRQALAKVRDGKPDKRSAAIRGSYESMIRQLE
Ga0335073_1021848243300033134SoilMIKSDAQRERTFAQIEGFRQALAKVASEKPGKRSAAIRGSYEGMIRQ
Ga0335077_1185103023300033158SoilMIKSDAQRERTLAQIEGFRQAIAKVASEKPGKRAAAIRGSY
Ga0316626_1140492123300033485SoilMIKSDAQRERTIVQIEGFRKALAQAEEQMSDKRAAAVRA
Ga0334792_167934_1_1173300033888SoilMIKSDAQRDRTVAQIEGFRRALAKADVEEPGKRSAAIRG
Ga0370514_093257_2_1483300034199Untreated Peat SoilMIKSDAQRERTAAQIEGFRQALTKVDREMTGKRALAVRGSYEGMIRQLE
Ga0372943_0893066_2_1303300034268SoilMIKSDAQRERTAAQIEGFRQALAKVTQDKPNKRSAAVRGSYES
Ga0370481_0347371_2_1123300034281Untreated Peat SoilMIKSDAQRERTMAQIEGFRQALAKVAKDTPAKRSAAI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.