NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078398

Metagenome / Metatranscriptome Family F078398

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078398
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 158 residues
Representative Sequence HRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Number of Associated Samples 102
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.93 %
% of genes near scaffold ends (potentially truncated) 82.76 %
% of genes from short scaffolds (< 2000 bps) 99.14 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.586 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(18.965 % of family members)
Environment Ontology (ENVO) Unclassified
(33.621 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.72%    β-sheet: 0.00%    Coil/Unstructured: 48.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.76 %
UnclassifiedrootN/A17.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003754|Ga0005853_1082915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102669Open in IMG/M
3300004054|Ga0063232_10160874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102658Open in IMG/M
3300004123|Ga0066181_10254565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102501Open in IMG/M
3300004124|Ga0066178_10168208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102622Open in IMG/M
3300004125|Ga0066182_10192195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102514Open in IMG/M
3300004240|Ga0007787_10483632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102619Open in IMG/M
3300005517|Ga0070374_10217676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102981Open in IMG/M
3300005517|Ga0070374_10291392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102829Open in IMG/M
3300006803|Ga0075467_10639206All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma floridae543Open in IMG/M
3300006805|Ga0075464_10588531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102684Open in IMG/M
3300006868|Ga0075481_10230177All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma floridae657Open in IMG/M
3300007231|Ga0075469_10061911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021099Open in IMG/M
3300007231|Ga0075469_10101504Not Available808Open in IMG/M
3300007522|Ga0105053_10783303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102702Open in IMG/M
3300007550|Ga0102880_1147046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102617Open in IMG/M
3300007555|Ga0102817_1114173All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula597Open in IMG/M
3300007623|Ga0102948_1181345All Organisms → cellular organisms → Eukaryota → Opisthokonta640Open in IMG/M
3300008258|Ga0114840_1055465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102619Open in IMG/M
3300009068|Ga0114973_10468604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102654Open in IMG/M
3300009154|Ga0114963_10649850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102549Open in IMG/M
3300009154|Ga0114963_10740259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102507Open in IMG/M
3300009155|Ga0114968_10552721Not Available613Open in IMG/M
3300009182|Ga0114959_10242245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102918Open in IMG/M
3300009183|Ga0114974_10287067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102972Open in IMG/M
3300009185|Ga0114971_10376259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102809Open in IMG/M
3300009426|Ga0115547_1119862Not Available855Open in IMG/M
3300009436|Ga0115008_10382191All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula999Open in IMG/M
3300009441|Ga0115007_11068345Not Available557Open in IMG/M
3300009442|Ga0115563_1082564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021416Open in IMG/M
3300009544|Ga0115006_11920205All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula543Open in IMG/M
3300010368|Ga0129324_10178266Not Available872Open in IMG/M
3300010374|Ga0114986_1077423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102600Open in IMG/M
3300011011|Ga0139556_1054214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102597Open in IMG/M
3300013010|Ga0129327_10087445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021536Open in IMG/M
3300013014|Ga0164295_10500045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102932Open in IMG/M
3300013014|Ga0164295_11266464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102572Open in IMG/M
3300017252|Ga0186341_123896All Organisms → cellular organisms → Eukaryota → Opisthokonta662Open in IMG/M
3300017751|Ga0187219_1221145Not Available517Open in IMG/M
3300017783|Ga0181379_1274686Not Available577Open in IMG/M
3300017951|Ga0181577_10666936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102636Open in IMG/M
3300017957|Ga0181571_10319041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102976Open in IMG/M
3300017957|Ga0181571_10918268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102515Open in IMG/M
3300017986|Ga0181569_10333284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021047Open in IMG/M
3300018417|Ga0181558_10410334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102717Open in IMG/M
3300018418|Ga0181567_10402879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102906Open in IMG/M
3300018426|Ga0181566_11166565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102514Open in IMG/M
3300018428|Ga0181568_10254940All Organisms → cellular organisms → Eukaryota1440Open in IMG/M
3300018876|Ga0181564_10292177Not Available912Open in IMG/M
3300019253|Ga0182064_1021271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102603Open in IMG/M
3300020052|Ga0181554_1292485All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula615Open in IMG/M
3300020055|Ga0181575_10602974All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula573Open in IMG/M
3300020056|Ga0181574_10038692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1023422Open in IMG/M
3300020151|Ga0211736_10764629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021007Open in IMG/M
3300020166|Ga0206128_1184737All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula812Open in IMG/M
3300020184|Ga0181573_10269394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102858Open in IMG/M
3300020184|Ga0181573_10455148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102573Open in IMG/M
3300020601|Ga0181557_1155892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102924Open in IMG/M
3300021371|Ga0213863_10195973All Organisms → cellular organisms → Eukaryota892Open in IMG/M
3300021371|Ga0213863_10383102Not Available572Open in IMG/M
3300021373|Ga0213865_10398866Not Available612Open in IMG/M
3300021957|Ga0222717_10502334All Organisms → cellular organisms → Eukaryota → Opisthokonta653Open in IMG/M
3300021959|Ga0222716_10519687All Organisms → cellular organisms → Eukaryota → Opisthokonta666Open in IMG/M
3300021964|Ga0222719_10723204All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula559Open in IMG/M
3300022900|Ga0255771_1131586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021070Open in IMG/M
3300022900|Ga0255771_1229847All Organisms → cellular organisms → Eukaryota → Opisthokonta662Open in IMG/M
3300022905|Ga0255756_1126954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021069Open in IMG/M
(restricted) 3300022913|Ga0233404_10043291All Organisms → cellular organisms → Eukaryota1027Open in IMG/M
(restricted) 3300022920|Ga0233426_10231527Not Available743Open in IMG/M
(restricted) 3300022933|Ga0233427_10175966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102960Open in IMG/M
(restricted) 3300023086|Ga0233407_10042081All Organisms → cellular organisms → Eukaryota666Open in IMG/M
3300023110|Ga0255743_10512489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102565Open in IMG/M
3300023175|Ga0255777_10324345All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula861Open in IMG/M
3300023178|Ga0255759_10300228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021011Open in IMG/M
3300024329|Ga0228631_1093459Not Available724Open in IMG/M
3300024554|Ga0255242_1121550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102545Open in IMG/M
3300025690|Ga0209505_1082590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102951Open in IMG/M
3300025821|Ga0209600_1105756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102835Open in IMG/M
3300025869|Ga0209308_10396786All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula551Open in IMG/M
3300025881|Ga0209309_10272168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102776Open in IMG/M
3300025881|Ga0209309_10316591All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula698Open in IMG/M
3300025897|Ga0209425_10221908All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula993Open in IMG/M
3300027518|Ga0208787_1146048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102531Open in IMG/M
3300027720|Ga0209617_10212194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102743Open in IMG/M
3300027833|Ga0209092_10290023Not Available888Open in IMG/M
3300027833|Ga0209092_10396647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102723Open in IMG/M
3300027883|Ga0209713_10555429Not Available744Open in IMG/M
3300027883|Ga0209713_10682347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102656Open in IMG/M
3300027892|Ga0209550_10491020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102739Open in IMG/M
3300027963|Ga0209400_1198702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102832Open in IMG/M
3300027963|Ga0209400_1274252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102658Open in IMG/M
(restricted) 3300028045|Ga0233414_10531708All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300028131|Ga0228642_1100910Not Available726Open in IMG/M
(restricted) 3300028559|Ga0247831_1292109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102548Open in IMG/M
3300029349|Ga0238435_118798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102563Open in IMG/M
3300031594|Ga0302131_1278778All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula528Open in IMG/M
3300031597|Ga0302116_1209898All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula575Open in IMG/M
3300031626|Ga0302121_10081839All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula963Open in IMG/M
3300031766|Ga0315322_10475403All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula822Open in IMG/M
3300031786|Ga0315908_11158856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102615Open in IMG/M
3300031851|Ga0315320_10896615Not Available546Open in IMG/M
3300032073|Ga0315315_10444864Not Available1203Open in IMG/M
3300032073|Ga0315315_10698563All Organisms → cellular organisms → Eukaryota → Opisthokonta930Open in IMG/M
3300032540|Ga0314682_10169288All Organisms → cellular organisms → Eukaryota1140Open in IMG/M
3300032713|Ga0314690_10206178Not Available953Open in IMG/M
3300032724|Ga0314695_1097877Not Available1052Open in IMG/M
3300032730|Ga0314699_10537992All Organisms → cellular organisms → Eukaryota525Open in IMG/M
3300032743|Ga0314707_10328090All Organisms → cellular organisms → Eukaryota → Opisthokonta797Open in IMG/M
3300032744|Ga0314705_10164943All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula1123Open in IMG/M
3300032744|Ga0314705_10179358All Organisms → cellular organisms → Eukaryota1085Open in IMG/M
3300032749|Ga0314691_10384805All Organisms → cellular organisms → Eukaryota → Opisthokonta583Open in IMG/M
3300033984|Ga0334989_0622137Not Available515Open in IMG/M
3300034050|Ga0335023_0319178All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula838Open in IMG/M
3300034051|Ga0335024_0542202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102562Open in IMG/M
3300034060|Ga0334983_0460425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102720Open in IMG/M
3300034103|Ga0335030_0770681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102568Open in IMG/M
3300034105|Ga0335035_0404910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102772Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh18.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.90%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.03%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.31%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.31%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.59%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.59%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.72%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.72%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.72%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.72%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.86%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.86%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.86%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004123Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004125Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007522Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010374Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17EnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300017252Metatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 388 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0990)Host-AssociatedOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020601Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023086 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024554Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027518Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0005853_108291513300003754Freshwater And SedimentGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0063232_1016087413300004054Freshwater LakeITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWHKLVTEPPFKLGKPCVRQPRGDTRLTPEDKQRVAEQRAAETARRRADFIANNN*
Ga0066181_1025456513300004123Freshwater LakeTYVYRITSEGLQKRSGVFSLEHYLAIGTLLWAGHMARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTEPPFKLGKPFVRQPRGDTRVTPEDKLRLAKERAAEIAKRRADFNATNN*
Ga0066178_1016820813300004124Freshwater LakeLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTKPPFKLGKPFVRQPRGDTRVTPEDKLRLAKERAAEIAKRRADFNATNN*
Ga0066182_1019219513300004125Freshwater LakeLQKRTGVFSLEHYLASRTLLWAVHAARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTEPPFKLGNPFVRQPRGDTRVTPEDKLRLAKERAAEIAKRRADFNAINN*
Ga0007787_1048363213300004240Freshwater LakeREMCRVTMLQTYVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYSPSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTEPPFKLGKPFVRQPRGDTRVTPEDKLRLAKERAAEIAKRRADFNAINN*
Ga0070374_1021767613300005517Freshwater LakeRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWHKLVTEPPFKLGKPCVRQPRGDTRLTPEDKQRVAEQRAAETARRRADFIANNN*
Ga0070374_1029139213300005517Freshwater LakeITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTDWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0075467_1063920613300006803AqueousQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN*
Ga0075464_1058853113300006805AqueousWGHPGVAPWLSHEGCESWCLTAESLRRLANWHNKRIREMCRVTMLQTHVYRNTAESLQKLTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGLYKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0075481_1023017713300006868AqueousESWCLTAESVRRLSNWHNKRVHEMCRVTICQTLVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
Ga0075469_1006191113300007231AqueousCLTAESVRRLSNWHNKRVREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN*
Ga0075469_1010150413300007231AqueousITSVSLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRSPKRLMLSWVPEPRIAGGQEMTYGRSLERHLKRFGLPLAYTEWAHIAQNRADWHKRVAQPPFAIGKPFVRRPRGDTRRTPEQKREDEARHAAEAAERRAVFDANDNDEGWA*
Ga0105053_1078330313300007522FreshwaterEYLQKRAGVFSLEHYLASRTLLWAGHVALMNKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTKPTFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEVAERRAVFDANNNN*
Ga0102880_114704613300007550EstuarineRITSESLHKRTGVFSLEHYLASRTLLWAGHVARMPKSRLAKRLVLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRATPEDKRRAVAQRAAEIAERRAVFDASNNSLKTEEAR*
Ga0102817_111417313300007555EstuarineSVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLTWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN*
Ga0102948_118134513300007623WaterVEARILKAPQAFGSLRTKVFGSADVPERLKGKLHAGGMHAALLYCCESRSLTESSLRRLGSWHSKRIREICRVTMRQTYVHHISSKSLQQRTGVFELEHYLASTTLRWAGHVARMPKSRLPKKLMLSWVQAPRITGGQEMSYGRSLERYLKRFYLPLNYSGWAPIAQNRDDWRRRVTQPPFAIGKPFVRRPRGDIRRTPEQKNVRTRHAARPR
Ga0114840_105546513300008258Freshwater, PlanktonGVFSVEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGQPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0114973_1046860413300009068Freshwater LakeAESVRRLANWHNKRIREMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWRKLVTEPPFKLGKPFVRQPRGDTRLTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0114963_1064985013300009154Freshwater LakeTMLQTHVYRITSDSLQKRTGVFSFEHYLACRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFKLPADFTEWAPLAQDRAGWRKLVTEPPFKLGKPCVRQPRGDTRVTPEDKMRVARQRAADIAKRRADFIAANN*
Ga0114963_1074025913300009154Freshwater LakeMLQAHVYGITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKGLMLSWIPEPRVAGGQEMTYGRSLQRHLTHFNLPTAFTEWAPLAQDRAGWRKLVTKPPFRLGKPFVRQPRGDTRATPEDKQR
Ga0114968_1055272113300009155Freshwater LakeESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0114959_1024224513300009182Freshwater LakeSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWRKLVTEPPLKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0114974_1028706723300009183Freshwater LakeMLQTYVYRITSESLQQRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFIEWAPLAQDRAGWHQLVTEPPFKLGKPYVRKPRGDTRVTPEDKKRLAEQRVAEIAKRQADFNITNNIMNCFQHTRPNRLHNTRLLIQTPCTSAFAPYLPFSA*
Ga0114971_1037625923300009185Freshwater LakeESWCLTAESVRRLANWHNKRMREMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGQVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLVHFNLPTAFTEWAPLAQDRAGWHNLVTKPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0115547_111986213300009426Pelagic MarineRITSKSLQQRTGVFDLQHYVASRTLLWAGHVARIPKSRLPKRLMLSWVQEPRLSGGQEMNFGRSLSRHLQHFGLPLAFTDWATIAQDRAQWHRLATKPPFAIGKPFLRQPRGDTRATPEDLRLAIARRAAEVKERRAIFAANANANAVAFNKQSMI*
Ga0115008_1038219113300009436MarineTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN*
Ga0115007_1106834513300009441MarineQRTGVFDLQYYVASRTLLLAGHVACMSKSRLPKRLMLSWVHEPHLSGSQEMNFGRCLSRHLQNFDLALAFTEWATIAQYRTKLHRAVTKPPFTIEKPFLRHPRGDTRTTPEDQRMVLARHAAEIQERRAIFATNANADATTPTNNP*
Ga0115563_108256423300009442Pelagic MarineMYPGVSVGKLQHYLASRMLLWAGHVARMPKSRLPKRLLLSWVRTPRVAGGQEMTFGRSLERHLEHFDLPTTFTEWATLAQDRAAWHKLVTHPPFAIGKPFVRRPRGDTRLTPEDRRRHMAQRTAEIAERQAAFHANTDQQHT*
Ga0115006_1192020513300009544MarineTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN*
Ga0129324_1017826613300010368Freshwater To Marine Saline GradientSGSAAGTTSVSARFATLPCANHPSTKSLQQRTGVFEVEHYLASRTLLWAGHVARMAKIRLPKRIMLSWVRAPRVAGGQEMNYGRSLARHLKRFDLPLAFVEWATLAQDRAAWRQRVTQPPFAIGKPFVRSPRGDSRATPEEKLRAKAQRAAEAAERRAEFLTNLTAHQPQNYS*
Ga0114986_107742313300010374Deep SubsurfaceVYAGGVLAVLLYGFESRCLTAESVRWLAYWHNKRIREMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTERAPLAQDRAGWRKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLTEERAAEIAKRRADFNATNN*
Ga0139556_105421413300011011FreshwaterLTFNWRKKQIREMCRLKARQARVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWATLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN*
Ga0129327_1008744523300013010Freshwater To Marine Saline GradientVFELQHYLASRTLLWAGHVARMPKSRLPKRLLLSWVRTPRVAGGQEMTFGRSLERHLEHFDLPTTFTEWATLAQDRAAWHKLVTHPPFAIGKPFVRRPRGDTRLTPEDRRRHMAQRTAEIAERQAAFHANTDQQHT*
Ga0164295_1050004513300013014FreshwaterQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWHKLVTEPPFKLGKPCVRQPRGDTRLTPEDKQRVAEQRAAETARRRADFIANNN*
Ga0164295_1126646413300013014FreshwaterREMYRVTMLQTHVYRVTSESLLKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLTHFNLPTAFTEWASLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLADQRAAEIAKRRADFNATNN*
Ga0186341_12389613300017252Host-AssociatedGKVHHCLQQRTGVFDLLHYVVSCTLLWAGHVARMSKNNPPKRLMLSWVHEPRLSGGQDMTFSRSLSRHLQNFDLPLAFTEWATIAQDRAKWHRIVTKPPFAIGKPFLRQPRGDTRATPEDQRMAIARHTAEIQEHRTIIAVSANINATTPTNDL
Ga0187219_122114513300017751SeawaterKSIKRLSRWHNKRIREMCRVTMCQTFVHGITSKSLQQRTGVFEIEHYLASRTLLWAGHVARMAKTRLPKRIMLPWVRAPRVASGQEMNYGRSLARHLKRFDLPLAFVEWAILMQDHAAWRQRVTQPPFAIGKPFVRSPRGDSRAFAGGEAAGESATRRRGRRTPSRVPHEPH
Ga0181379_127468613300017783SeawaterCRVTMCQTFVYRITSKSLQHRTGLFEIQHYLASRTLLWAGHVARLSKHRLPKRLMLSWVSTPRVTGGQEMTYGRSLKRHFRGFDLPLTFTEWASLAQDRAGWHKRVTHPPFEIGKPFTRQPRGDTRVAPEEKRRRMAQHKAETEARRAAFNANAHQAPSNS
Ga0181577_1066693613300017951Salt MarshGLRRHRPGGPALRLRILMSHSRAGAAAEQQAQQADPRDVPRHHMRPAFVHRTTSESPQKRTGDFSPEHNPASRTLLWAGHVARMPMNLLPKRLMLSWIREPRVAGSQEVTYGRSLQRHLNRFGLPAVFAKWAYLAQDRAGWHKPVTTPPFAIGKPFVWQSRDDIGVTPEDKRQAVAQCAAEIDERRAAFHANNNN
Ga0181571_1031904123300017957Salt MarshMTLAWCRIVKVFSLEHYLASRTLLWAGHVARMPKSSLPKRLMLSWIREPCVVGGQEMTYGRSLQRHLYHFGLPAVFTEWAHLAQDRAGWQKLVTTPPFAIGKPFEGGGDSGGRRAVAQRAAEIAERRAVFDANNKN
Ga0181571_1091826813300017957Salt MarshMCRVTMCQTFVHRITSESLQKRNGVFSLEHYLASRTLLWAGHVARTPKNRLPKRLVLSWIREPRFAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGRHKPVTTPPFAIGKPFVRQPRGDTRVTPED
Ga0181569_1033328423300017986Salt MarshAEQVAQQADPRDVPRHHMRPAFVHRTTSESPQKRTGDFSPEHNPASRTLLWAGHVARMPMNLLPKRLMLSWIREPRVAGSQEVTYGRSLQRHLNRFGLPAVFAKWAYLAQDRAGWHKPVTTPPFAIGKPFVWQSRDDIGVTPEDKRQAVAQCAAEITERRVAFDAKNSN
Ga0181558_1041033413300018417Salt MarshTSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIQEPRVTGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
Ga0181567_1040287913300018418Salt MarshVRRLSNWHYKRVREMCRVTTCQTFVYRITSKSLQKRTGVLALEHYLASRALLWAEHVARMPKNCIPKRLVLSWIREPRVAGGEEVTYGRSLQRHLNHFDLPTALTEWAHWGQDRAGWHKLVTKPPFAIGKPFVRQPRGLTRVTPEDKRRAAAQRAAEVVERRAVFNANSNWQPLHTQARHTDANSFVDPGRAWGWG
Ga0181566_1116656513300018426Salt MarshSESLQKRTGVFSPEHYPASRTLLWAGRVARMPKNRLPKRLMLSWIREPRIAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGRHKPVTTPPFAIGKPFVRQPRGDTRVTPKDKRRAVAQRAAEIAERRAVFDANNNN
Ga0181568_1025494023300018428Salt MarshVLSVLLYGCESWCLTEASVSRLSSWHNKRIREMCRVTMRQTYIHRISSRSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVAGGQEMTYGRSLERHLKRFSLPLAYTEWAGIAQNRVDWHKRVTKPPFTIGKPFLRRPRGDSRRTAEQKREDEARRAAEIAERRAIFDANDNDEGWALKWSRFSHG
Ga0181564_1029217713300018876Salt MarshIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVACMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLVYIEWEGIAQNRAEWYKRAAKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0182064_102127113300019253Salt MarshCESWCLTAESVRRLSNWHNKRVREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLYHFGLPTKLTERAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDRRRAMAQRAAEIAERRAVFDANDN
Ga0181554_129248513300020052Salt MarshHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0181575_1060297413300020055Salt MarshLRYVLETVHDVFGGYLVCGGISFYPHARPGAEGNPTCRVTMCQAFVHRITSEGLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLPWIREPRVAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGWHKLVITPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERWAVFDANNN
Ga0181574_1003869233300020056Salt MarshVPRHHMRPAFVHRTTSESPQKRTGDFSPEHNPASRTLLWAGHVARMPMNLLPKRLMLSWIREPRVAGSQEVTYGRSLQRHLNRFGLPAVFAKWAYLAQDRAGWHKPVTTPPFAIGKPFVWQSRDDIGVTPEDKRQAVAQCAAEITERRVAFDAKNSN
Ga0211736_1076462913300020151FreshwaterMLQTHVYRITSESLQKRTGVFSLEHYLESRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFPKWAPLAENRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATSN
Ga0206128_118473713300020166SeawaterLEHYLASRTLLWAGHVARMHKNRLPKRLMLSRIREPRVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN
Ga0181573_1026939413300020184Salt MarshMCRVTMCQTFVHRITSESLQKRNGVFSLEHYLASRTLLWAGHVARTPKNRLPKRLVLSWIREPRFAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGRHKPVTTPPFAIGKPFVRQPRGDTRVTPKDKRRAVAQRAAEIAERRAVFDAHTNN
Ga0181573_1045514813300020184Salt MarshVCKALGWVGVGVNQTFVHRITSEGLQKRTGVFSLEHYLASRTLLWAGHVARMPKTRFHKRPVLSWIREPRVAGGQEMTYGRSLQHHLYHFGLPTVLTEWAHLAQDRARWHKLVTTPPFAIGKPLVRQPRGDTRVTPEDKRRVVAQRAAEIAERRAVFDANNS
Ga0181557_115589213300020601Salt MarshVREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIQEPRVTGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
Ga0213863_1019597313300021371SeawaterLSSWHNKRIREMCRVTMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWYKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0213863_1038310213300021371SeawaterCHTAESIKRLSRWHNKRLREMCRVTMCQTFVHGITSKSLQQRTGVFEVEHYLASRTLLWAGHVARMAKIRLPKRIMLSWVRAPRVAGGQEMNYGRSLARHLKRFDLPLAFVEWATLAQDRAAWRQRVTQPPFAIGKPFVRSPRGDSRATPEEKLRAKAQRAAEAAERRAEFLTNLTAHQPQNYS
Ga0213865_1039886623300021373SeawaterDPRPCHISSKSLQQRTGVFELGHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWYKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0222717_1050233423300021957Estuarine WaterMCRVTMRQTYVHHISSKSLQQRTGVFELEHYLASTTLRWAGHVARMPKSRLPKRLMLSWVRKARDPGGQEMTYGRSLERYLKRFDLPLSYSGWAPIAQSRDDWRRRVAQPPFAIGKPFVRRPRGDTRRTPEQRREDEARRAAETAERQANFDAASHAHHNTYP
Ga0222716_1051968713300021959Estuarine WaterRIREMFRVTMRQTYVHHISSKSLQQRTGVFELEHYLASTTLRWAGHVARMPKSRLPKRLMLSWVQEPRATGGQEMSYGRSLERYLKRFDLPLSYSGWAPIAQSRDDWRRRVAQPPFAIGKPFVRRPRGDTRRTPEQRREDEARRAAETAERQANFDAASHAHHNTYP
Ga0222719_1072320413300021964Estuarine WaterLGNWHNKRIREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0255771_113158613300022900Salt MarshMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIQEPRVTGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
Ga0255771_122984713300022900Salt MarshHRISSKSLQQRTGAFELEHYLASRTFLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWYKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0255756_112695423300022905Salt MarshMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIQEPRVTGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWQKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
(restricted) Ga0233404_1004329123300022913SeawaterLLYGCESWCLTEASVSRLSSWHNKRIREMCRITMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVTGGQEMTYGRSLERHLKRFGLPLAYTEWAHIAQNRADWHKRVAQPPFAIGKPFVRRPRGDTRRTPEQKREDEARHAAEAAERRAVFDANDNDEGWA
(restricted) Ga0233426_1023152713300022920SeawaterQQRTGVFDLQHYVASRTLLWAGHVARMPKSRLPKRLMLSWVQEPRLSGGQEMNFGRSLSRHLQHFGLPLAFTDWATIAQDRAQWHRLATKPPFAIGKPFLRQPRGDTRATPEDQRLAIARRNAEIKERRAIFAANANANADTPTNNP
(restricted) Ga0233427_1017596613300022933SeawaterVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIQEPRVTGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDKRRAVVQRAAEIAERRAVFDANNNN
(restricted) Ga0233407_1004208113300023086SeawaterDKIFSSASVPGRLKGKLYAGGVLSVLLYGCESWCLTEASVSRLSSWHNKRIREMCRITMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLLLSWVRAPRVTGGQEMTYGRSLERHLKRFGLPLAYTEWAHIAQNRADWHKRVAQPPFAIGKPFVRRPRGDTRRTPEQKREDEARHAAEAAERRAVSDANDNDEGWA
Ga0255743_1051248913300023110Salt MarshVAQQADPRDVPRHHMRPAFVHRTTSESPQKRTGDFSPEHNPASRTLLWAGHVARMPMNLLPKRLMLSWIREPRVAGSQEVTYGRSLQRHLNRFGLPAVFAKWAYLAQDRAGWHKPVTTPPFAIGKPFVWQSRDDIGVTPEDKRQAVAQCAAEITERRVAFDAKNSN
Ga0255777_1032434513300023175Salt MarshLRKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0255759_1030022813300023178Salt MarshHNPASRTLLWAGHVARMPMNLLPKRLMLSWIREPRVAGSQEVTYGRSLQRHLNRFGLPAVFAKWAYLAQDRAGWHKPVTTPPFAIGKPFVWQSRDDIGVTPEDKRQAVAQCAAEITERRVAFDAKNSN
Ga0228631_109345913300024329SeawaterQRTGVFEVEHYPASCTLPWAGHVARMAKIRLPKRIMLPWVRAPRVAGGQEMNYGRSLARHLKRFDLPLAFVEWATLAQDRAAWRQRVTQPPFAIGKPFVRSPRGDSRATPEEKLRAKAQRAAEAAERRAEFLTNLTAHQPQNYS
Ga0255242_112155013300024554FreshwaterRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTELPFKLGKPFVRQSRGDTRVTPEDKQRLAEQRAAKIAKRRADFNATNI
Ga0209505_108259013300025690Pelagic MarineRTGVFSLEHYLASRTLLWAGHVARMSKNRLPKRLMLSWIREPRVAGGQEMTYGRSIQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN
Ga0209600_110575613300025821Pelagic MarineFQTYVHRITSKSLQQRTGVFELQHYLASRTLLWAGHVARMPKSRLPKRLLLSWVRTPRVAGGQEMTFGRSLERHLEHFDLPTTFTEWATLAQDRAAWHKLVTHPPFAIGKPFVRRPRGDTRLTPEDRRRHMAQRTAEIAERQAAFHANTDQQHT
Ga0209308_1039678613300025869Pelagic MarineNWHNKRIREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIQEPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPENRRRAVAQRAAEVAERRAVFDAHNNN
Ga0209309_1027216813300025881Pelagic MarineVHRITSKSLQQRTGVFELQHYLASRTLLWAGHVARMPKSRLPKRLLLSWVRTPRVAGGQEMTFGRSLERHLEHFDLPTTFTEWATLAQDRAAWHKLVTHPPFAIGKPFVRRPRGDTRLTPEDRRRHMAQRTAEIAERQAAFHANTDQQHT
Ga0209309_1031659113300025881Pelagic MarineFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWHKLVTAPPFAIGKPFVRQPRGDTRVTPEDQRRAVAQRAAEVAERRAVFDAHNNN
Ga0209425_1022190813300025897Pelagic MarineRVREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLVLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAEDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0208787_114604813300027518Deep SubsurfaceNWHNKRIREMFRVTVLQTHIYRITSESLQKRTGVFSLEYYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTKPPFKLGKPFVRQPRGDTRVTPEDKQRLAQEYAAEIVRRRADFNATIN
Ga0209617_1021219413300027720Freshwater And SedimentRVTVLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTQPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEIARRRADFNATIN
Ga0209092_1029002313300027833MarineHNKRIREMCRVTMCQTSVYRITSKSLQQRTGLFEIQHYLASRTLLWAGHVARMPKHRLPKRLVLSWVSTPRVTGGQEMTYGRSLERHLKRFDLPLTFTEWASLAQNRAGWHKRVTHPPFEIGKPFTWQPRGDTRVTPEEKRRGMAQHKAETEARRAAFNANAHQAPSNS
Ga0209092_1039664713300027833MarineEMCRATMCQASVYRITSESKQKRAGVFSLEHYLASRLLLWAGLVARMSKNRLPKRRLLPWIREPRVASGQGVAFGRSLQRHLDHFDLPTVFTEWAHLAQDRAGWQELVTEPPFAIGKPSLRQPRGDTRVTPEGKRRAVAQRAAEIAERRAVFDVNNNK
Ga0209713_1055542913300027883MarineNWHNKRIREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMSKNRLPKRLMLSWIREPRVAGGQEMTYGRSIQRHLNHFDLPTKFTEWARLAQDRAGWQKPATTPPFAIGKPFVRQPRGDTWVTP
Ga0209713_1068234713300027883MarineTFAHRITSESLQKRTGAFSLEHYLASRTLPSAGHVARMPKNRLPKRLVLSWIREPRVAGGQEMTYGRSLQRHLDHFDLPTVPEWARLTQDRAGWHKPLTTPPFAIGKPFVRQPRGDTGATPEDRRRVVAQRAAEIAERRAIFYANNNN
Ga0209550_1049102013300027892Freshwater LakeESLQKRIGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN
Ga0209400_119870213300027963Freshwater LakeLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGPSLQRHLTHFNLPTAFTDWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAERRADFNATNN
Ga0209400_127425213300027963Freshwater LakeEMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTQPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEIARRRADFNATIN
(restricted) Ga0233414_1053170813300028045SeawaterGRLSSWHNKRIREMCRITMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVTGGQEMTYGRSLERHLKRFGLPLAYTEWAHIAQNRADWHKRVAQPPFAIGKPFVRRPRGDTRRTPEQKREDEARHAAEAAERRAVFDANDNDEGWA
Ga0228642_110091013300028131SeawaterVTMCQTFVHGITSKSLQQRTGVFEVEHYLASRTLLWAGHVARMAKIRLPKRIMLSWVRAPRVAGGQEMNYGRSLARHLKRFDLPLAFVEWATLAQDRAAWRQRVTQPPFAIGKPFVRSPRGDSRATPEEKLRAKAQRAAEAAERRAEFLTNLTAHQPQK
(restricted) Ga0247831_129210913300028559FreshwaterTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAERRADFNATNN
Ga0238435_11879813300029349FreshwaterVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTQPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEISRRRADFNATIN
Ga0302131_127877813300031594MarineMCQTFAHRITSESPQKRTGVFSLEHYLASRTLLWAGHVVRMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0302116_120989813300031597MarineNKRIREMYRVTICQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0302121_1008183913300031626MarineSWCLTAESVRRLGNWHNKRIREMCRVTMCQTFVHRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLNHFDLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0315322_1047540313300031766SeawaterVAQQAGPQDVPRYHMPDVRPPITSESLQKRTGVFSLEHYLASRTLLWAGHVARMPKNRLPKRLMLSWIREPRVAGGQEMTYGRSLQRHLYHFGLPTVFTEWAHLAQDRAGWHKLVTTPPFAIGKPFVRQPRGDTRVTPEDKRRAVAQRAAEIAERRAVFDANNNN
Ga0315908_1115885613300031786FreshwaterSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTEPPFKLGKPFVRQPRGDTRVTPEDKLRLAKERAAEIAKRRADFNATNN
Ga0315320_1089661513300031851SeawaterWHNKRIREMCRVTMCQTFVHGITSKSLQQRTGVFEIEHYLASRTLLWAGHVARMAKTRLPKRIMLSWVCAPRVAGGQEMNYGRSLVHHLKRFDLPLAFVEWATLAQDRAAWRERVTEPPFAIGKPFVRSPRGDSRATPEEKLRAKVQRAAEAAERRAEFLTNLTAHQPQNYS
Ga0315315_1044486413300032073SeawaterFVYRITSKSLQHRTGLFEIQHYLASRTLLWAGHVARMPKHRLLKRLMLSWVSTPRVTGGQEMTYGRSLERHLKRFDLPLTFTEWASPAQDRAGWHKRVTHPPFEIGKPFTRQPRGDTRVTPEEKHRRMAQHKAETEARRAAFNANAHQAPSNS
Ga0315315_1069856313300032073SeawaterKRIREMCRVTMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQDRAEWYKRVTKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0314682_1016928823300032540SeawaterMESSLRRLSSWHNKRIREMCRVTMRQTYIHRISFKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHHKRFNIPLAYTEWAGIAQNRADSHKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0314690_1020617813300032713SeawaterMIQKLSRWHNKRIREMCRVTMYQTFVYRITSKSLQQRTGLFEIQHYLASRTLLWAGHVARMPKHRLPKRLMLSWVSTPRVTGGQEMTYGRSLERHLKRFDLPLTFTEWASLAQDRAGWHKRVTHPPFEIGKPFTRQPRGDTRVTPEEKRRRMAQHKAETEARRAAFNANAHQATPNS
Ga0314695_109787713300032724SeawaterLSSWHNKRIREMCGVTMRQTYIHRISSKSLKQRTGVFELEHYLASRTLLWVGRVARMLRSRLPKRLVLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWHKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0314699_1053799213300032730SeawaterRCLTEASVSKLSSWHNKRVREMRCVTMRQTHIHRISIKSLKQRTGVFELEHYSASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWHKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRTVFDA
Ga0314707_1032809013300032743SeawaterLTEASVSRLSSWHNKRIREMCRVTMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWYKRATKPPFTIGKPFLRRPRGDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0314705_1016494313300032744SeawaterKSLQHRTGLFEIQHYLASRTLLWAGHVARMPKHRLPKRLMLSWVSTPRVTGGQEMTYGRSLERHLKRFDLPLTFTEWASLAQDRAGWHKRVTHPPFEIGKPFTRQPRGDTRVTPEEKRRRMAQHKAETEARRAAFNTNAHQ
Ga0314705_1017935823300032744SeawaterKLYAGGVLSVLPYGCESSCLTEASVRRPSSWHNERIREMCRVTMRQTYIHRISSKSLQQRTGVFELEHYLASRTLLWVGHVARMPKSRLPKRLMLSWVRAPRVSGGQEMTYGRSLERHLKRFNLPLAYIEWAGIAQNRAEWYKRATKPPFTVGKPFLRRPRSDSRRTAEQKHEDEARRTAEIAERRAVFDANDNDEGWA
Ga0314691_1038480513300032749SeawaterRLSSWHNKRIGEMCRVTMRQTYVHRISSKSLQQRTGVFELEHYLTSTTLHWAGHVARMPKSRLPKRLMLSWVRKARDTGGQEMTYGRSLERHLKRFDLPPDYTDWAPIAQNRDDWRRRVTQPPFTIGKPFVRRPRGGTRRTPEQKHENETRRAAETAERQANFDAASHAHHNTYS
Ga0334989_0622137_46_5013300033984FreshwaterMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN
Ga0335023_0319178_305_8173300034050FreshwaterVRRLANWHNKRIREMCRVTMLQTYVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTEPPFQLGKPHVRQPRGDTRVTPEDKQRLAEQRAAEIAERRADFNATNN
Ga0335024_0542202_41_5533300034051FreshwaterVRRLANWHNKRIREMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTQPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEIARRRADFNATIN
Ga0334983_0460425_245_7153300034060FreshwaterMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTQPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEIARRRADFNATIN
Ga0335030_0770681_27_5393300034103FreshwaterVRRLANWHNKRIREMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVVGGQEMTYGRSLQRHLAHFNLPAAFTEWAPLAQDRAGWRKLVTKPPFKLGKPFVRQPRGDTRVTPEDKQRLAKERAAEIARRRADFNATIN
Ga0335035_0404910_55_5253300034105FreshwaterMCRVTMLQTHVYRITSESLQKRTGVFSLEHYLASRTLLWAGHVARMHKNRLPKRLMLSWIPEPRVAGGQEMTYGRSLQRHLAHFNLPTAFTEWAPLAQDRAGWHKLVTEPPFKLGKPFVRQPRGDTRVTPEDKQRLAEQRAAEIAKRRADFNATNN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.