| Basic Information | |
|---|---|
| Family ID | F077977 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGATYFHKPK |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.67 % |
| % of genes near scaffold ends (potentially truncated) | 23.08 % |
| % of genes from short scaffolds (< 2000 bps) | 83.76 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.376 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (30.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.829 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01464 | SLT | 14.53 |
| PF13577 | SnoaL_4 | 8.55 |
| PF00313 | CSD | 3.42 |
| PF04471 | Mrr_cat | 2.56 |
| PF07045 | DUF1330 | 2.56 |
| PF01381 | HTH_3 | 2.56 |
| PF00589 | Phage_integrase | 1.71 |
| PF13467 | RHH_4 | 1.71 |
| PF00561 | Abhydrolase_1 | 0.85 |
| PF05724 | TPMT | 0.85 |
| PF01070 | FMN_dh | 0.85 |
| PF03330 | DPBB_1 | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF04828 | GFA | 0.85 |
| PF04909 | Amidohydro_2 | 0.85 |
| PF00154 | RecA | 0.85 |
| PF16576 | HlyD_D23 | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF00155 | Aminotran_1_2 | 0.85 |
| PF00034 | Cytochrom_C | 0.85 |
| PF07369 | DUF1488 | 0.85 |
| PF00582 | Usp | 0.85 |
| PF13682 | CZB | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 2.56 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.85 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.85 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.85 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.38 % |
| Unclassified | root | N/A | 31.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_82422_len_714_cov_16_130253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 764 | Open in IMG/M |
| 2140918008|ConsensusfromContig316408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 2140918008|ConsensusfromContig328051 | Not Available | 660 | Open in IMG/M |
| 2170459024|GZTSFBX01DKI66 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300000313|WSSedB1CaDRAFT_10090228 | Not Available | 580 | Open in IMG/M |
| 3300001394|JGI20191J14862_1029533 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300001397|JGI20177J14857_1018110 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300001423|JGI20199J14953_1016959 | Not Available | 614 | Open in IMG/M |
| 3300002549|JGI24130J36418_10051705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1072 | Open in IMG/M |
| 3300003369|JGI24140J50213_10010388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3563 | Open in IMG/M |
| 3300003369|JGI24140J50213_10062243 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300003861|Ga0031654_10105255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 791 | Open in IMG/M |
| 3300004022|Ga0055432_10168942 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005205|Ga0068999_10073763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 643 | Open in IMG/M |
| 3300005213|Ga0068998_10105358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 634 | Open in IMG/M |
| 3300005938|Ga0066795_10137187 | Not Available | 729 | Open in IMG/M |
| 3300005947|Ga0066794_10087152 | Not Available | 931 | Open in IMG/M |
| 3300005949|Ga0066791_10074022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 678 | Open in IMG/M |
| 3300005980|Ga0066798_10035023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1645 | Open in IMG/M |
| 3300005980|Ga0066798_10167387 | Not Available | 607 | Open in IMG/M |
| 3300006052|Ga0075029_100315147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1001 | Open in IMG/M |
| 3300006052|Ga0075029_100323622 | Not Available | 988 | Open in IMG/M |
| 3300006055|Ga0097691_1019046 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300006055|Ga0097691_1023504 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300006354|Ga0075021_10910032 | Not Available | 571 | Open in IMG/M |
| 3300006638|Ga0075522_10189278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300006638|Ga0075522_10213825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 968 | Open in IMG/M |
| 3300006640|Ga0075527_10020523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1725 | Open in IMG/M |
| 3300006640|Ga0075527_10087066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 858 | Open in IMG/M |
| 3300006642|Ga0075521_10460448 | Not Available | 621 | Open in IMG/M |
| 3300006795|Ga0075520_1115057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. CF142 | 1205 | Open in IMG/M |
| 3300006795|Ga0075520_1131407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1107 | Open in IMG/M |
| 3300006795|Ga0075520_1134231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1093 | Open in IMG/M |
| 3300006795|Ga0075520_1136796 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1080 | Open in IMG/M |
| 3300006949|Ga0075528_10130911 | Not Available | 668 | Open in IMG/M |
| 3300006949|Ga0075528_10215507 | Not Available | 522 | Open in IMG/M |
| 3300006950|Ga0075524_10298177 | Not Available | 706 | Open in IMG/M |
| 3300007351|Ga0104751_1076834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1430 | Open in IMG/M |
| 3300007740|Ga0104326_112637 | Not Available | 1246 | Open in IMG/M |
| 3300009029|Ga0066793_10486459 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009091|Ga0102851_10110604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2406 | Open in IMG/M |
| 3300009506|Ga0118657_11357226 | Not Available | 846 | Open in IMG/M |
| 3300009649|Ga0105855_1309641 | Not Available | 504 | Open in IMG/M |
| 3300009660|Ga0105854_1315705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300010366|Ga0126379_11691296 | Not Available | 737 | Open in IMG/M |
| 3300010379|Ga0136449_101790974 | Not Available | 919 | Open in IMG/M |
| 3300010397|Ga0134124_10005809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9912 | Open in IMG/M |
| 3300011992|Ga0120146_1022019 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012964|Ga0153916_11482254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 754 | Open in IMG/M |
| 3300013503|Ga0120127_10007693 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300014489|Ga0182018_10166878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1249 | Open in IMG/M |
| 3300014490|Ga0182010_10277617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 895 | Open in IMG/M |
| 3300014501|Ga0182024_10181557 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300017927|Ga0187824_10297649 | Not Available | 570 | Open in IMG/M |
| 3300017944|Ga0187786_10219346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 735 | Open in IMG/M |
| 3300017959|Ga0187779_10001789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13391 | Open in IMG/M |
| 3300017959|Ga0187779_10871330 | Not Available | 618 | Open in IMG/M |
| 3300018029|Ga0187787_10130375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300018058|Ga0187766_10237023 | Not Available | 1163 | Open in IMG/M |
| 3300018058|Ga0187766_10679328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 709 | Open in IMG/M |
| 3300018064|Ga0187773_10490846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 730 | Open in IMG/M |
| 3300019786|Ga0182025_1136591 | Not Available | 1174 | Open in IMG/M |
| 3300022518|Ga0224548_1042839 | Not Available | 502 | Open in IMG/M |
| 3300025146|Ga0209322_10232392 | Not Available | 778 | Open in IMG/M |
| 3300025313|Ga0209431_10361630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1126 | Open in IMG/M |
| 3300025313|Ga0209431_10884009 | Not Available | 642 | Open in IMG/M |
| 3300025314|Ga0209323_10051505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2824 | Open in IMG/M |
| 3300025325|Ga0209341_10384816 | Not Available | 1139 | Open in IMG/M |
| 3300025327|Ga0209751_10212784 | Not Available | 1652 | Open in IMG/M |
| 3300025457|Ga0208850_1005830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 2570 | Open in IMG/M |
| 3300025481|Ga0208079_1021680 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300025482|Ga0208715_1010648 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300025482|Ga0208715_1017790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1381 | Open in IMG/M |
| 3300025495|Ga0207932_1006135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3840 | Open in IMG/M |
| 3300025495|Ga0207932_1014024 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300025504|Ga0208356_1049730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300025505|Ga0207929_1012461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1606 | Open in IMG/M |
| 3300025509|Ga0208848_1001132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5104 | Open in IMG/M |
| 3300025535|Ga0207423_1073272 | Not Available | 616 | Open in IMG/M |
| 3300025544|Ga0208078_1045423 | Not Available | 940 | Open in IMG/M |
| 3300025579|Ga0207927_1100412 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300025604|Ga0207930_1007279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3400 | Open in IMG/M |
| 3300025625|Ga0208219_1037977 | Not Available | 1265 | Open in IMG/M |
| 3300025625|Ga0208219_1050860 | Not Available | 1033 | Open in IMG/M |
| 3300025650|Ga0209385_1015885 | All Organisms → cellular organisms → Bacteria | 3089 | Open in IMG/M |
| 3300025829|Ga0209484_10197714 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026272|Ga0209913_1022850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1662 | Open in IMG/M |
| 3300026272|Ga0209913_1028915 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300026291|Ga0209890_10007785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4457 | Open in IMG/M |
| 3300027394|Ga0209904_1004066 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300027815|Ga0209726_10102049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1731 | Open in IMG/M |
| 3300027819|Ga0209514_10146857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1270 | Open in IMG/M |
| 3300027819|Ga0209514_10208125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 973 | Open in IMG/M |
| 3300027902|Ga0209048_10028700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4739 | Open in IMG/M |
| 3300027902|Ga0209048_10040489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3876 | Open in IMG/M |
| 3300027902|Ga0209048_10546528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 777 | Open in IMG/M |
| 3300028800|Ga0265338_10850471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300031469|Ga0170819_12266729 | Not Available | 627 | Open in IMG/M |
| 3300032770|Ga0335085_11652592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 662 | Open in IMG/M |
| 3300032782|Ga0335082_10195495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1925 | Open in IMG/M |
| 3300032782|Ga0335082_11145662 | Not Available | 644 | Open in IMG/M |
| 3300032828|Ga0335080_10506867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300032892|Ga0335081_10890245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300032893|Ga0335069_11542870 | Not Available | 714 | Open in IMG/M |
| 3300032897|Ga0335071_10284303 | Not Available | 1607 | Open in IMG/M |
| 3300032897|Ga0335071_11342791 | Not Available | 660 | Open in IMG/M |
| 3300033004|Ga0335084_11054438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300033233|Ga0334722_10845327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 647 | Open in IMG/M |
| 3300033412|Ga0310810_10180139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2416 | Open in IMG/M |
| 3300033433|Ga0326726_11409137 | Not Available | 678 | Open in IMG/M |
| 3300033487|Ga0316630_10320406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
| 3300033887|Ga0334790_003712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10625 | Open in IMG/M |
| 3300033888|Ga0334792_109412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 751 | Open in IMG/M |
| 3300034090|Ga0326723_0053140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
| 3300034090|Ga0326723_0200304 | Not Available | 884 | Open in IMG/M |
| 3300034125|Ga0370484_0092878 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300034125|Ga0370484_0191957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 30.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 6.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.98% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.42% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.71% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.71% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.71% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.71% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.85% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.85% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.85% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001423 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_00046640 | 2088090004 | Soil | MPTETAIIVAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK |
| Bog_all_C_02399000 | 2140918008 | Soil | MPTETAIIIAGIVLPVAVLAVAMAWADFYTRNYRAPGSTYFHEPDSKK |
| Bog_all_C_03111070 | 2140918008 | Soil | MPTETAIIIAGIVLVFAVFIVVLAWADFYTRNYRAPGAAYFDKPK |
| FD1_03818670 | 2170459024 | Grass Soil | MPTQTAIIIAGVVLAFAAFAISLAWADFYSRNFRGPGNAK |
| WSSedB1CaDRAFT_100902281 | 3300000313 | Wetland | MPAETVIVVAAIVAAFAFLAVPLAWADFYSRNVRTPGASYFDKRK* |
| JGI20191J14862_10295331 | 3300001394 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVFVVSLAWADFYTRNVRTPGAPYFNKSDSKE* |
| JGI20177J14857_10181101 | 3300001397 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVFVVSLAWADFYTRNVRTPGATY |
| JGI20199J14953_10169593 | 3300001423 | Arctic Peat Soil | MPAETAIVVAGIAVVFAAFPIAPGWAAFYTRNVRTPGASYFDK* |
| JGI24130J36418_100517051 | 3300002549 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK* |
| JGI24140J50213_100103882 | 3300003369 | Arctic Peat Soil | MPTETIVIVAGIVLAFAVFAVSLAWADFYTRGVRTPGATYFHEPSKE* |
| JGI24140J50213_100622431 | 3300003369 | Arctic Peat Soil | MPTETAIIIAGIVLAFAVLAVSLAWASFYSRNYRAPGATYFNKPDSKE* |
| Ga0031654_101052552 | 3300003861 | Freshwater Lake Sediment | MPTETAIAIVGIVLMFTVFAATLAWANYYTRNVRVPDAKYFHAPRAKE* |
| Ga0055432_101689421 | 3300004022 | Natural And Restored Wetlands | MPTQTAIIIAGVVLAFAAFAISLARADFYSRNFRGPGSTK* |
| Ga0068999_100737631 | 3300005205 | Natural And Restored Wetlands | MPTQTAIIIAAVVLAFAAFAISLARADFYSRNFRGPGTTK* |
| Ga0068998_101053581 | 3300005213 | Natural And Restored Wetlands | MPTQTAIIIAGVVLAFAAFAISLAWADFYSRNFRGPGSTK* |
| Ga0066795_101371871 | 3300005938 | Soil | MPTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK* |
| Ga0066794_100871521 | 3300005947 | Soil | VAGIVLAFAVLAVSLAWASFYSRNYRAPGAPYFNKSDSKE* |
| Ga0066791_100740222 | 3300005949 | Soil | MSTETAIIVAGIVLAVAVLAVSMAWAQYYTRNVRVPGATYFYKPK* |
| Ga0066798_100350233 | 3300005980 | Soil | MLTETAIIIAGIVLMFAAFVVTLAWAVYYTRNFRAPGPTDFRAPSAKE* |
| Ga0066798_101673872 | 3300005980 | Soil | AIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFQKPK* |
| Ga0075029_1003151472 | 3300006052 | Watersheds | MPAETIITIAAIVLAFLVFAVSLAWADYYTRNVRTPGASYFDKPK* |
| Ga0075029_1003236222 | 3300006052 | Watersheds | MPAETVIVVAAIIAAFALFAVPLAWADFYTRNVRTPGASYFRNPK* |
| Ga0097691_10190464 | 3300006055 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVLAVSLAWASFYSRNYRAPGAPYFNKSDSKE* |
| Ga0097691_10235043 | 3300006055 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFIVVLAWADFYTRNYRAPGAAYFDKPK* |
| Ga0075021_109100322 | 3300006354 | Watersheds | MPTETAIIVAGIVLMFTVFVVTMAWADYYARNFRAPGATYFHESDAKK* |
| Ga0075522_101892783 | 3300006638 | Arctic Peat Soil | MPTETAIIVAGIVLAFAALAVPLAWASYYTRNVRTPGAVYFPEPDSKK* |
| Ga0075522_102138252 | 3300006638 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVLAVSLAWAQYYTRNVRVPGATYFDEPNS* |
| Ga0075527_100205232 | 3300006640 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGATYFHKPK* |
| Ga0075527_100870661 | 3300006640 | Arctic Peat Soil | MPTETAIIIAGIVLPVAVLAVAMAWADFYTRNYRAPGST |
| Ga0075521_104604482 | 3300006642 | Arctic Peat Soil | MPTETAIIISGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK* |
| Ga0075520_11150571 | 3300006795 | Arctic Peat Soil | MPTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRT |
| Ga0075520_11314072 | 3300006795 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGAAYFHEPDSKK* |
| Ga0075520_11342311 | 3300006795 | Arctic Peat Soil | MPTETAIIVACIVLAFAVLAVCMAWAQYYTRNVRVPGATYFDTPK* |
| Ga0075520_11367963 | 3300006795 | Arctic Peat Soil | MPTETAIIVACIVLAFAVLAVSMAWAQYYTRNVRVPGATYFDTPK* |
| Ga0075528_101309112 | 3300006949 | Arctic Peat Soil | MPTETAIIVAGIVLLFAVLAVLAVALAWASYYTRNVRTPGATYY* |
| Ga0075528_102155071 | 3300006949 | Arctic Peat Soil | MPTETAIVIAGTVLMFAVFLGALGWAVFYTRNVRVPGA |
| Ga0075524_102981772 | 3300006950 | Arctic Peat Soil | MPTEVAIIVAGIVLAFAVPLAWASYYTRNVRTPGATYY* |
| Ga0104751_10768342 | 3300007351 | Deep Subsurface Aquifer | MPIETAIIVAGVVLIFAAFAVSLAWAAFYTRNVRVPGATYFDTPDSAK* |
| Ga0104326_1126373 | 3300007740 | Soil | MPTETIVVVAGIVLAFAVFAASLAWADFYTRGVHTPGATYFHEPSKQ* |
| Ga0066793_104864592 | 3300009029 | Prmafrost Soil | MPTETAIIVAGIVLAFAALAVSPAWASYYTRNVRTPGATYY* |
| Ga0102851_101106046 | 3300009091 | Freshwater Wetlands | MPTETAIIVAGIVVIFAAFPIALGWAAFYTRNVRTPGATYFDATDSRK* |
| Ga0118657_113572262 | 3300009506 | Mangrove Sediment | VPTETAIVIAGIVLVFAAFAIVLAWADFYTRNIRAPGAAQFQGSESKK* |
| Ga0105855_13096411 | 3300009649 | Permafrost Soil | MPTETAIIVAGIVLVFAAFIVALAWVDYYTRNYRAPGAVYFQKPNSK* |
| Ga0105854_13157052 | 3300009660 | Permafrost Soil | VSALIFSRLNKGGLAMPTETVIVIAGIVLMFAVFAVTLVWADYYSRNFRAPGARYFHGPGAGD* |
| Ga0126379_116912962 | 3300010366 | Tropical Forest Soil | MPTDTALIVAGVVLMFVVFAAALGWAAFYTRGVRVPGATYFDSK* |
| Ga0136449_1017909742 | 3300010379 | Peatlands Soil | MPTETAVIIAGIVLMFAVFAVTLAWADYYTRNARVPGALYFHEPDSKQ* |
| Ga0134124_100058096 | 3300010397 | Terrestrial Soil | MPTETAIIVGGIVVVFAIFPAILMWASAYTRDVRVPGATYFDEAKK* |
| Ga0120146_10220191 | 3300011992 | Permafrost | MPTETAIIIAGIVLAFAVLAVSLAWASFYSRNYRALGATYFNKPDSKE* |
| Ga0153916_114822543 | 3300012964 | Freshwater Wetlands | AIIVAGIVLAFVVFAASLAWADYYTSSVRRPGAGD* |
| Ga0120127_100076932 | 3300013503 | Permafrost | MPTETIVVVAGIVLAFAVFAVSLAWADFYTRGVHTPGATYFHEPSKQ* |
| Ga0182018_101668781 | 3300014489 | Palsa | VPTETVIIIAGIVLAFAVLAVPLAWADYYTRNVRVPGATYFNKPDSKQ* |
| Ga0182010_102776171 | 3300014490 | Fen | MPTETAIMIAGIVLVFAVFAISLAWVDFFTRGFRAPGATYFDKKAE* |
| Ga0182024_101815573 | 3300014501 | Permafrost | MPTETAIIVAGIVLAFAVLAVPLAWASFYSRNYRAPGATYFNKSDSKE* |
| Ga0187824_102976492 | 3300017927 | Freshwater Sediment | MPTETAIIVAGIVLAFAVLAAAMAWAQYYTRNVRVPGATYFDTPK |
| Ga0187786_102193462 | 3300017944 | Tropical Peatland | MPTQTAIIIAGVVLAFAAFAISLAWADFYTRNFRGPGSAK |
| Ga0187779_100017894 | 3300017959 | Tropical Peatland | MPTETAVIVIGIALIFTVFAVSLAAADFYTRNVRTPEALYFRTPK |
| Ga0187779_108713302 | 3300017959 | Tropical Peatland | MPTQTALIVAGILLVFAAFAVSLAWADFYSRNSRAHSAE |
| Ga0187787_101303752 | 3300018029 | Tropical Peatland | MPTQTAIIIAGVVLAFAAFAISLAWADFYSRNFRGPGSAK |
| Ga0187766_102370231 | 3300018058 | Tropical Peatland | TMPTETAVIVIGIALIFTVFAVSLAAADFYTRNVRTPEALYFRTPK |
| Ga0187766_106793281 | 3300018058 | Tropical Peatland | MPTQTALIVAGILLVFAAFAVSLAWADFYSRNSRA |
| Ga0187773_104908462 | 3300018064 | Tropical Peatland | MPTETAIVIAGIVVVFGIFALALAWASYYTRDYRAPGAAYQFPPSSRGAE |
| Ga0182025_11365913 | 3300019786 | Permafrost | VPTETVIIIAGIVLAFAVLAVPLAWADYYTRNVRVPGATYFNKPDSKQ |
| Ga0224548_10428391 | 3300022518 | Soil | KERRIAMPTETAIIVAGIVLAFAVLAVSLAWAQYYTRNVRVPGATYFDEPNS |
| Ga0209322_102323921 | 3300025146 | Soil | MPTETVIIVAGIVLMFAAFAASLGWAAFYTRNVRVPGATYFDTSDTGK |
| Ga0209431_103616301 | 3300025313 | Soil | MPTETVIIVAGIVLMFAVFAVSLGWAAFYTRNVRVPGATYFDTSDSGK |
| Ga0209431_108840091 | 3300025313 | Soil | TVIIVAGIVLMFAVFAVSLGWAAFYTRNVRVPGATYFDTSDTGK |
| Ga0209323_100515051 | 3300025314 | Soil | MPTETAIVITGIVLVFVVFAAALGWAAFYTRNVRTPGATYFDAADSRK |
| Ga0209341_103848164 | 3300025325 | Soil | ITGIVLVFVVFAAALGWAAFYTRNVRTPGATYFDAADSRK |
| Ga0209751_102127841 | 3300025327 | Soil | ETVIIVAGIVLMFAAFAASLGWAAFYTRNVRVPGATYFDTSDTGK |
| Ga0208850_10058301 | 3300025457 | Arctic Peat Soil | MLTETAIIIAGIVLMFAAFVVTLAWAVYYTRNFRAPGPTDFRAPSAKE |
| Ga0208079_10216803 | 3300025481 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGATYFHKPK |
| Ga0208715_10106481 | 3300025482 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGATYFHK |
| Ga0208715_10177901 | 3300025482 | Arctic Peat Soil | AGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK |
| Ga0207932_10061354 | 3300025495 | Arctic Peat Soil | MPAETAIVVAGIAVVFAAFPIAPGWAAFYTRNVRTPGASYFDK |
| Ga0207932_10140242 | 3300025495 | Arctic Peat Soil | MPTETAIIVAGIVLLFAVLAVALAWASYYTRNVRTPGATYY |
| Ga0208356_10497301 | 3300025504 | Arctic Peat Soil | MPTETIVIVAGIVLAFAVFAVSLAWADFYTRSVRTPGATYFDEPSKQ |
| Ga0207929_10124614 | 3300025505 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVLAVSLAWAQYYTRNVRVPGATYFNKPDSKQ |
| Ga0208848_10011324 | 3300025509 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFYTRNVRTPGAAYFHEPDSKK |
| Ga0207423_10732722 | 3300025535 | Natural And Restored Wetlands | MPTQTAIIIAGVVLAFAAFAISLARADFYSRNFRGPGSTK |
| Ga0208078_10454231 | 3300025544 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFIVALAWADFYTRNYRAPGAVYFDKPK |
| Ga0207927_11004121 | 3300025579 | Arctic Peat Soil | MPTETAIIIAGIVLVFAVFAVSLAWADFCTRNVRTPGATYFH |
| Ga0207930_10072791 | 3300025604 | Arctic Peat Soil | MPTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYF |
| Ga0208219_10379773 | 3300025625 | Arctic Peat Soil | MPTETIVIVAGIVLAFAVFAVSLAWADFYTRGVRTPGATYFHEPSKQ |
| Ga0208219_10508602 | 3300025625 | Arctic Peat Soil | MPTETAIIVAGIVLAFAVLAVSLAWAQYYTRNVRVPGATYFDEPNS |
| Ga0209385_10158856 | 3300025650 | Arctic Peat Soil | MPTETAIIISGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK |
| Ga0209484_101977143 | 3300025829 | Arctic Peat Soil | MPTETAIIISGIVLAFAVFVVSLAWADFYTRNVRTPG |
| Ga0209913_10228504 | 3300026272 | Soil | PTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK |
| Ga0209913_10289151 | 3300026272 | Soil | MPTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFQKPK |
| Ga0209890_100077852 | 3300026291 | Soil | MPTETAIIVAGIVLVFAAFIVALAWVDYYTRNYRAPGAVYFQKPNSK |
| Ga0209904_10040663 | 3300027394 | Thawing Permafrost | MPTETAIIIAGIVLAFAVFVVSLAWADFYTRNVRTPGATYFHKPK |
| Ga0209726_101020494 | 3300027815 | Groundwater | MPTDTAIIVSGVVVMFVIFVAAMGWAAFYTRGVRTPGATYFDK |
| Ga0209514_101468571 | 3300027819 | Groundwater | MPTETAIIVAGIVLMFAAFAVSLGWAAFYTRNVRVPGATYFDPPDSAK |
| Ga0209514_102081252 | 3300027819 | Groundwater | MPTETAIVITGIVLVFVVFAAALGWAAFYTRNVRTPGANYFDAADSRK |
| Ga0209048_100287005 | 3300027902 | Freshwater Lake Sediment | MPTETAIVIAGIVLMFIVFAAALAWADYYTRNVRVPDAKYFHAPRPKE |
| Ga0209048_100404893 | 3300027902 | Freshwater Lake Sediment | MPTETAIAIVGIVLMFTVFAATLAWANYYTRNVRVPDAKYFHAPRAKE |
| Ga0209048_105465282 | 3300027902 | Freshwater Lake Sediment | MPTETAIVITGIVLLFSVFVIVLAWADYYTRHVRTPGAQYFGASDPAE |
| Ga0265338_108504711 | 3300028800 | Rhizosphere | VAGIILFFAVFAIALAWVDFYTRNVRAPGATYFHGSDSKK |
| Ga0170819_122667291 | 3300031469 | Forest Soil | MPTETVIILAGIVVVFAVFGATLVWADYYTRNVRTPGATYFRDPAFNAPDR |
| Ga0335085_116525922 | 3300032770 | Soil | MPTDTAVIVAGVVLIFVVFAAALSWAAFYTRGVRAPG |
| Ga0335082_101954952 | 3300032782 | Soil | MPTETALIVAGVVLMFVVFAGAIGWAAFYSRGVRVPGATYFDGK |
| Ga0335082_111456622 | 3300032782 | Soil | MPTETAIIVAGIVLMFAAFAVALASIDYYARDFRAPGATYFHEPDAKE |
| Ga0335080_105068672 | 3300032828 | Soil | MPTEAAIIVIGIVLIFTVFAVSLATADFYTRNVRAPKAMYFRASK |
| Ga0335081_108902453 | 3300032892 | Soil | MPTDVAIIVVGVVAVFAVFAGGLGWAAFYTRGVRTPGAAYFDGK |
| Ga0335069_115428701 | 3300032893 | Soil | NRGRLAMPTETAIIVAGIVLMFAAFAVALASIDYYARDFRAPGATYFHEPDAKE |
| Ga0335071_102843033 | 3300032897 | Soil | MPTETAIIVAGIVVVFIVFAVVLAWADYQTRNVRVPNATYFDNSKE |
| Ga0335071_113427912 | 3300032897 | Soil | MPTETAIIVAGIVLMFAAFAVALASIDYYARDFRAPGATYFHEPDARE |
| Ga0335084_110544381 | 3300033004 | Soil | RGEPMPTEIAVIVTGIVLVFVVFAAALGWAAFYTRGVRTPGATYFDNVK |
| Ga0334722_108453272 | 3300033233 | Sediment | MPTETVIFIASVVLMFAVFAISLGWATFYTRNVRTPGASYFDK |
| Ga0310810_101801393 | 3300033412 | Soil | MPTQTAIIVAGVVLTFSAFAISLAWADFYTRGIRAPGSGE |
| Ga0326726_114091371 | 3300033433 | Peat Soil | MPTETAIIVAGIVLAFGSFAVVLAWADYYTWNSRIPGATYFKESNAKE |
| Ga0316630_103204063 | 3300033487 | Soil | MPTETAIIVAGIVVIFAAFPIALGWAAFYTRNVRTPGATYFDATDSRK |
| Ga0334790_003712_942_1088 | 3300033887 | Soil | MPTETAIIVAGIVLAFAVLAVSLAWASFYSRNYRAPGATYFNKSDSKE |
| Ga0334792_109412_1_135 | 3300033888 | Soil | VPTETVIIIAGIVLAFAVLAVPLAWADYYTRNVRVPGATYFNKPD |
| Ga0326723_0053140_1389_1511 | 3300034090 | Peat Soil | MPTQTAIIIAGVVLAFAAFAISLAWADFYSRNFRGPGSTK |
| Ga0326723_0200304_428_574 | 3300034090 | Peat Soil | MPTETAIIVAGIVLVFTVFAVTLAWTDYYARNFRAPGGTYFQESDARE |
| Ga0370484_0092878_2_121 | 3300034125 | Untreated Peat Soil | MPTETAIIVAGIVLAFAVFVVSLAGADFYTRNVRTPGATY |
| Ga0370484_0191957_291_437 | 3300034125 | Untreated Peat Soil | MPTETPIIVAGIAVIFAAFPIAPGWAAFYTRNVRTPGASYFDAADSGK |
| ⦗Top⦘ |