| Basic Information | |
|---|---|
| Family ID | F077375 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVGKIARGAYVLVVGTMFVAWVITFNKEAPAKPQTGPQVWYIHS |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.65 % |
| % of genes near scaffold ends (potentially truncated) | 38.46 % |
| % of genes from short scaffolds (< 2000 bps) | 82.91 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (13.675 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.060 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 20.51 |
| PF00389 | 2-Hacid_dh | 18.80 |
| PF12697 | Abhydrolase_6 | 14.53 |
| PF12146 | Hydrolase_4 | 2.56 |
| PF13414 | TPR_11 | 1.71 |
| PF00486 | Trans_reg_C | 1.71 |
| PF08386 | Abhydrolase_4 | 1.71 |
| PF13279 | 4HBT_2 | 1.71 |
| PF00561 | Abhydrolase_1 | 1.71 |
| PF13361 | UvrD_C | 1.71 |
| PF03401 | TctC | 0.85 |
| PF05170 | AsmA | 0.85 |
| PF07043 | DUF1328 | 0.85 |
| PF13561 | adh_short_C2 | 0.85 |
| PF00884 | Sulfatase | 0.85 |
| PF13181 | TPR_8 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.85 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.99 % |
| Unclassified | root | N/A | 47.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0687740 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
| 3300000787|JGI11643J11755_11637377 | Not Available | 544 | Open in IMG/M |
| 3300000890|JGI11643J12802_11015647 | Not Available | 987 | Open in IMG/M |
| 3300000953|JGI11615J12901_10889881 | Not Available | 845 | Open in IMG/M |
| 3300001431|F14TB_100062845 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300003324|soilH2_10160894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1454 | Open in IMG/M |
| 3300004020|Ga0055440_10010130 | Not Available | 1681 | Open in IMG/M |
| 3300004058|Ga0055498_10005789 | Not Available | 1443 | Open in IMG/M |
| 3300004114|Ga0062593_100062889 | Not Available | 2401 | Open in IMG/M |
| 3300004114|Ga0062593_103002755 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300004157|Ga0062590_100159300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1562 | Open in IMG/M |
| 3300004463|Ga0063356_103769450 | Not Available | 653 | Open in IMG/M |
| 3300004479|Ga0062595_100073271 | Not Available | 1694 | Open in IMG/M |
| 3300004479|Ga0062595_101477941 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300004479|Ga0062595_101520932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 618 | Open in IMG/M |
| 3300004480|Ga0062592_100399159 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300004643|Ga0062591_100626295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 957 | Open in IMG/M |
| 3300004643|Ga0062591_101149564 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005146|Ga0066817_1022796 | Not Available | 586 | Open in IMG/M |
| 3300005161|Ga0066807_1006027 | Not Available | 1043 | Open in IMG/M |
| 3300005183|Ga0068993_10091054 | Not Available | 962 | Open in IMG/M |
| 3300005185|Ga0066811_1021381 | Not Available | 556 | Open in IMG/M |
| 3300005331|Ga0070670_100017245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6193 | Open in IMG/M |
| 3300005332|Ga0066388_100776509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1554 | Open in IMG/M |
| 3300005332|Ga0066388_102127327 | Not Available | 1010 | Open in IMG/M |
| 3300005332|Ga0066388_103938641 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005332|Ga0066388_105710967 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005367|Ga0070667_101359849 | Not Available | 666 | Open in IMG/M |
| 3300005441|Ga0070700_100187315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1444 | Open in IMG/M |
| 3300005518|Ga0070699_102041391 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005529|Ga0070741_10002895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 44368 | Open in IMG/M |
| 3300005543|Ga0070672_100488690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1064 | Open in IMG/M |
| 3300005937|Ga0081455_10000185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 78750 | Open in IMG/M |
| 3300006058|Ga0075432_10064511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1308 | Open in IMG/M |
| 3300006353|Ga0075370_10168241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1288 | Open in IMG/M |
| 3300006581|Ga0074048_13300813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1359 | Open in IMG/M |
| 3300006852|Ga0075433_10697501 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300006904|Ga0075424_100379329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1507 | Open in IMG/M |
| 3300006954|Ga0079219_10271570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1026 | Open in IMG/M |
| 3300009011|Ga0105251_10290875 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009092|Ga0105250_10107306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300009156|Ga0111538_10302882 | Not Available | 2023 | Open in IMG/M |
| 3300010046|Ga0126384_10953791 | Not Available | 778 | Open in IMG/M |
| 3300010047|Ga0126382_10005375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5766 | Open in IMG/M |
| 3300010362|Ga0126377_10002409 | All Organisms → cellular organisms → Bacteria | 12869 | Open in IMG/M |
| 3300010362|Ga0126377_10374325 | Not Available | 1428 | Open in IMG/M |
| 3300010362|Ga0126377_10873175 | Not Available | 961 | Open in IMG/M |
| 3300010371|Ga0134125_10074528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3775 | Open in IMG/M |
| 3300010371|Ga0134125_10133805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2760 | Open in IMG/M |
| 3300010373|Ga0134128_10279351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1871 | Open in IMG/M |
| 3300010373|Ga0134128_10761753 | Not Available | 1074 | Open in IMG/M |
| 3300012488|Ga0157343_1022118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 584 | Open in IMG/M |
| 3300012499|Ga0157350_1026094 | Not Available | 620 | Open in IMG/M |
| 3300012501|Ga0157351_1000798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1827 | Open in IMG/M |
| 3300012507|Ga0157342_1000244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2998 | Open in IMG/M |
| 3300012892|Ga0157294_10042645 | Not Available | 999 | Open in IMG/M |
| 3300012898|Ga0157293_10035883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1029 | Open in IMG/M |
| 3300012899|Ga0157299_10062607 | Not Available | 869 | Open in IMG/M |
| 3300012907|Ga0157283_10019556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1264 | Open in IMG/M |
| 3300012916|Ga0157310_10451673 | Not Available | 547 | Open in IMG/M |
| 3300012960|Ga0164301_10910186 | Not Available | 683 | Open in IMG/M |
| 3300014308|Ga0075354_1016038 | Not Available | 1150 | Open in IMG/M |
| 3300014318|Ga0075351_1011414 | Not Available | 1271 | Open in IMG/M |
| 3300014321|Ga0075353_1077252 | Not Available | 741 | Open in IMG/M |
| 3300015372|Ga0132256_100166320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2228 | Open in IMG/M |
| 3300015372|Ga0132256_103160371 | Not Available | 554 | Open in IMG/M |
| 3300015374|Ga0132255_102183889 | Not Available | 844 | Open in IMG/M |
| 3300017927|Ga0187824_10076481 | Not Available | 1057 | Open in IMG/M |
| 3300017993|Ga0187823_10061515 | Not Available | 1054 | Open in IMG/M |
| 3300017994|Ga0187822_10110390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 849 | Open in IMG/M |
| 3300019356|Ga0173481_10001527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5621 | Open in IMG/M |
| 3300019356|Ga0173481_10002864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4403 | Open in IMG/M |
| 3300019362|Ga0173479_10405575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 659 | Open in IMG/M |
| 3300021445|Ga0182009_10055365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1693 | Open in IMG/M |
| 3300022883|Ga0247786_1089520 | Not Available | 657 | Open in IMG/M |
| 3300023072|Ga0247799_1097421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 527 | Open in IMG/M |
| 3300023073|Ga0247744_1032037 | Not Available | 806 | Open in IMG/M |
| 3300025271|Ga0207666_1007247 | Not Available | 1456 | Open in IMG/M |
| 3300025549|Ga0210094_1025408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 972 | Open in IMG/M |
| 3300025912|Ga0207707_10794955 | Not Available | 788 | Open in IMG/M |
| 3300025914|Ga0207671_10134051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1903 | Open in IMG/M |
| 3300025917|Ga0207660_10819604 | Not Available | 759 | Open in IMG/M |
| 3300025919|Ga0207657_10945606 | Not Available | 663 | Open in IMG/M |
| 3300025921|Ga0207652_10175346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1925 | Open in IMG/M |
| 3300025922|Ga0207646_10685896 | Not Available | 916 | Open in IMG/M |
| 3300025933|Ga0207706_11613649 | Not Available | 525 | Open in IMG/M |
| 3300025935|Ga0207709_11389509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300025940|Ga0207691_10453299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1091 | Open in IMG/M |
| 3300025941|Ga0207711_10286792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1517 | Open in IMG/M |
| 3300025945|Ga0207679_10180706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300025955|Ga0210071_1016446 | Not Available | 895 | Open in IMG/M |
| 3300026067|Ga0207678_10652488 | Not Available | 925 | Open in IMG/M |
| 3300026088|Ga0207641_10658066 | Not Available | 1029 | Open in IMG/M |
| 3300026089|Ga0207648_10091937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 2653 | Open in IMG/M |
| 3300026452|Ga0256821_1004594 | Not Available | 1271 | Open in IMG/M |
| 3300026718|Ga0207501_102619 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026754|Ga0207631_102790 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026759|Ga0207527_101098 | Not Available | 860 | Open in IMG/M |
| 3300026770|Ga0207537_102722 | Not Available | 641 | Open in IMG/M |
| 3300026828|Ga0207502_102710 | Not Available | 817 | Open in IMG/M |
| 3300026960|Ga0207582_1007753 | Not Available | 933 | Open in IMG/M |
| 3300027252|Ga0209973_1022313 | Not Available | 849 | Open in IMG/M |
| 3300027360|Ga0209969_1075922 | Not Available | 536 | Open in IMG/M |
| 3300027400|Ga0207560_100689 | Not Available | 1021 | Open in IMG/M |
| 3300027614|Ga0209970_1015336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1275 | Open in IMG/M |
| 3300031538|Ga0310888_10006227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4264 | Open in IMG/M |
| 3300031716|Ga0310813_10002239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11772 | Open in IMG/M |
| 3300031716|Ga0310813_11353139 | Not Available | 659 | Open in IMG/M |
| 3300031720|Ga0307469_10033633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3015 | Open in IMG/M |
| 3300031740|Ga0307468_100351824 | Not Available | 1099 | Open in IMG/M |
| 3300032000|Ga0310903_10100767 | Not Available | 1228 | Open in IMG/M |
| 3300032017|Ga0310899_10305393 | Not Available | 739 | Open in IMG/M |
| 3300032174|Ga0307470_11850766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 512 | Open in IMG/M |
| 3300033004|Ga0335084_10081088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3365 | Open in IMG/M |
| 3300033412|Ga0310810_10008013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12118 | Open in IMG/M |
| 3300033475|Ga0310811_10671989 | Not Available | 1012 | Open in IMG/M |
| 3300033513|Ga0316628_100329377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1912 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 13.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026718 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026754 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026770 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026828 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027400 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06877403 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MVGKIARGAYVFVVGTMIVAWVIAFNKEAPASPQTGPQVWYIHS* |
| JGI11643J11755_116373772 | 3300000787 | Soil | MVGKIARGAYVLVVGTMFVAWVITFNKEAPAKPQTGPQVWYIHS* |
| JGI11643J12802_110156472 | 3300000890 | Soil | MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKPGPQIWYLHS* |
| JGI11615J12901_108898812 | 3300000953 | Soil | MVEKIARGAYVFVVGTMIIAWVVSFNKETPPGPQTGPQVWYIHS* |
| F14TB_1000628451 | 3300001431 | Soil | MIGKIARGAYVLVVGTMVVAWAISFNQEAPAKPQPQTGPQIWYI |
| soilH2_101608942 | 3300003324 | Sugarcane Root And Bulk Soil | MIGKVARGTYVLVVATMFVAWIISFNKEAPAKPQRPGPQVWHIYS* |
| Ga0055440_100101302 | 3300004020 | Natural And Restored Wetlands | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPQTGLQVWYIYS* |
| Ga0055498_100057893 | 3300004058 | Natural And Restored Wetlands | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPLTGPQVWYIHS* |
| Ga0062593_1000628892 | 3300004114 | Soil | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQTGPQIWYIHS* |
| Ga0062593_1030027551 | 3300004114 | Soil | AMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0062590_1001593002 | 3300004157 | Soil | MIGKIARGAYVLVVGTMVVAWVISFNKEAPAKPQPQTGPQIWYIHS* |
| Ga0063356_1037694502 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAAPKPQTTGPQVWYIHS* |
| Ga0062595_1000732714 | 3300004479 | Soil | ARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQTGPQIWYIHS* |
| Ga0062595_1014779413 | 3300004479 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0062595_1015209321 | 3300004479 | Soil | MAGKVARGTYLLVVATMIVVWLVTFNKEAPAAPQPEPQVWQIYS* |
| Ga0062592_1003991593 | 3300004480 | Soil | MIGKIARGAYVFVVGTMIAAWVVSFNKEVPARPQAGPQVWYIHS* |
| Ga0062591_1006262953 | 3300004643 | Soil | MVGKIARGAYVLVVGTMFVAWVLTFNKEAPAKPQTGPQVWYIHS* |
| Ga0062591_1011495642 | 3300004643 | Soil | MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKPGPQVWYIHS* |
| Ga0066817_10227962 | 3300005146 | Soil | MVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0066807_10060271 | 3300005161 | Soil | MVGKIARGAYVFVVATMFVAWIISFNKEASATPQTTGPQVWYIH |
| Ga0068993_100910542 | 3300005183 | Natural And Restored Wetlands | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPQTGLQVRYIYS* |
| Ga0066811_10213811 | 3300005185 | Soil | AAMVGKIARGAYVFVVATMFVAWIISFNKEAPATPQTAGPQVWYIHS* |
| Ga0070670_1000172457 | 3300005331 | Switchgrass Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQTGAQIWYIHS* |
| Ga0066388_1007765093 | 3300005332 | Tropical Forest Soil | MIGKIARGAYVLVVGTMVVTWVVSFNKEVPAKPQTSPQVWYIYS* |
| Ga0066388_1021273271 | 3300005332 | Tropical Forest Soil | LTKKSGSVAMIGKIARGAYVLAVGTMVVAWVVSFNKEVPAKPQTGPQIWYIYS* |
| Ga0066388_1039386413 | 3300005332 | Tropical Forest Soil | MIGKIARGAYVLVVGTMVVAWAISFNQEAPAEPQPQTSPQVWYIYS* |
| Ga0066388_1057109671 | 3300005332 | Tropical Forest Soil | MIGKIARGAYVLVVGTMVVAWAISFNQKAPAEPQPQTSPQVWYIYS* |
| Ga0070667_1013598492 | 3300005367 | Switchgrass Rhizosphere | KKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0070700_1001873153 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGKIARGAYVFVVGMMIVGWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0070699_1020413912 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKPGPQVWYIHP* |
| Ga0070741_100028958 | 3300005529 | Surface Soil | MIGKIARGAYVLIVGTMIVAWVISLQKQVPPEKPKPGPHVWRMYS* |
| Ga0070672_1004886903 | 3300005543 | Miscanthus Rhizosphere | AAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0081455_1000018560 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIGKIARGAYVLAVGTMVVAWVVSFNKEVPAKPQTGPQIWYIYS* |
| Ga0075432_100645111 | 3300006058 | Populus Rhizosphere | KKYGSAAMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0075370_101682411 | 3300006353 | Populus Endosphere | VVGTMVVAWVVSFNKEAPAKPQPQTGPQIWYIHS* |
| Ga0074048_133008133 | 3300006581 | Soil | MVGKIARGAYVFVVATMFVAWIISFNKEAPATPQTAGPQV |
| Ga0075433_106975012 | 3300006852 | Populus Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEVPAKPQTGPQVWYIHS* |
| Ga0075424_1003793293 | 3300006904 | Populus Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQRGAQIWYIHS* |
| Ga0079219_102715703 | 3300006954 | Agricultural Soil | QVVGKIARGAYVFVVGTMIVAWVIAFNKEAPASPQTGPQVWYIHS* |
| Ga0105251_102908753 | 3300009011 | Switchgrass Rhizosphere | AAMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0105250_101073063 | 3300009092 | Switchgrass Rhizosphere | VLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0111538_103028823 | 3300009156 | Populus Rhizosphere | MAGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPRPSPQIWYIHS* |
| Ga0126384_109537911 | 3300010046 | Tropical Forest Soil | MVGKIARGAYVFVVGTMIVAWVIAFNKEVPASPQTGPQIWYIHS* |
| Ga0126382_100053756 | 3300010047 | Tropical Forest Soil | MIGKIARGAYVLVVGTMVVTWVVSFNKEVPAKPQTGPQVWYIYS* |
| Ga0126377_100024097 | 3300010362 | Tropical Forest Soil | MIGKIARGAYVLFVGTMVVAWAISFNKEAPAKPQPQTTPQIWYIYS* |
| Ga0126377_103743252 | 3300010362 | Tropical Forest Soil | MVGKIARGAYVLVVGTMVVAWAISFNQEAPVEPQPQTSPQVWYIYS* |
| Ga0126377_108731753 | 3300010362 | Tropical Forest Soil | AMIGKIARGAYVLVVGTMVVTWVVSFNKEVPAKPQTSPQVWYIYS* |
| Ga0134125_100745284 | 3300010371 | Terrestrial Soil | MIGKIARGAYVLAVSTMVVGWVISFNKEAPAKPQPQTGPQVWYIHS* |
| Ga0134125_101338051 | 3300010371 | Terrestrial Soil | MAGKVARGTYLLVVATMIVVWLVTFNKEAPAAAPQPEPQVWQIYS* |
| Ga0134128_102793512 | 3300010373 | Terrestrial Soil | MVGKIARGAYVFVVGMMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0134128_107617531 | 3300010373 | Terrestrial Soil | MVGTVARGTYLLIVATMIVVWLVTFNKEAPAAPQPEPQVWQIYS* |
| Ga0157343_10221181 | 3300012488 | Arabidopsis Rhizosphere | MVGKIARGAYVFVVGTMIVAWVIAFNKEVPARPQTGPQVWYI |
| Ga0157350_10260943 | 3300012499 | Unplanted Soil | GSAAMVGKIARGAYVFVVGTMIAAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0157351_10007981 | 3300012501 | Unplanted Soil | PHKKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0157342_10002443 | 3300012507 | Arabidopsis Rhizosphere | MVGKIARGAYIFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0157294_100426451 | 3300012892 | Soil | SKKDGSAAMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS* |
| Ga0157293_100358833 | 3300012898 | Soil | RGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0157299_100626072 | 3300012899 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQPGPQVSYMYS* |
| Ga0157283_100195561 | 3300012907 | Soil | KKYGSAAMVGKIARGAYVFVVGMMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0157310_104516731 | 3300012916 | Soil | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPPKPKTTSPQVWYVYS* |
| Ga0164301_109101861 | 3300012960 | Soil | VFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS* |
| Ga0075354_10160383 | 3300014308 | Natural And Restored Wetlands | MVGKIARGAYVLVVGPMFVVWAITFNKEAPAKPLTGPQVWYIHS* |
| Ga0075351_10114142 | 3300014318 | Natural And Restored Wetlands | MIGKIARGAYVLVVGTMFVTWVVTFNKEAPAKPQTGPQVWYIHS* |
| Ga0075353_10772522 | 3300014321 | Natural And Restored Wetlands | MVGKIARGSYVLVVGTMFVVWAITFNKEAPAKPLTGPQVWYIHS* |
| Ga0132256_1001663203 | 3300015372 | Arabidopsis Rhizosphere | MVGKIARGAYVLVVGTMVVAWVISVNKEAPANPQQTGPQVSYMYS* |
| Ga0132256_1031603713 | 3300015372 | Arabidopsis Rhizosphere | MVGKIARGAYVFVVATMFVAWIISFNKEASATPQTTGPQVWYIHS* |
| Ga0132255_1021838892 | 3300015374 | Arabidopsis Rhizosphere | MIGKIARGAYVLVVGTMFVTWVITFNKEAPAKPQTGPQVWYIHS* |
| Ga0187824_100764812 | 3300017927 | Freshwater Sediment | MVGKVARGTYLLVVATMIVVWLVTFNKEAPAAAPQPEPQVWQIYS |
| Ga0187823_100615151 | 3300017993 | Freshwater Sediment | MVGKVARGTYLLVVATMIVVWLVTFNKEAPAAPQPEPQVWQIYS |
| Ga0187822_101103903 | 3300017994 | Freshwater Sediment | MAGKVARGTYLLVVATMIVVWLVTFNKEAPAAPQPEPQVWQIYS |
| Ga0173481_100015272 | 3300019356 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS |
| Ga0173481_100028643 | 3300019356 | Soil | MVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0173479_104055752 | 3300019362 | Soil | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQTGPQIWYIHS |
| Ga0182009_100553653 | 3300021445 | Soil | MIGKIARGAYVLVVGTMVVAWVVSFNKEVPAKPQPQTGPQIWYIHS |
| Ga0247786_10895202 | 3300022883 | Soil | MIGKIARGAYVLVVGTMVVAWVVSFNKEAAPKPQTTGPQVWYIHS |
| Ga0247799_10974213 | 3300023072 | Soil | AYVLVVGTMVVAWVVSFNKEAAPKPQTTGPQVWYIHS |
| Ga0247744_10320373 | 3300023073 | Soil | YPHKKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207666_10072472 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQIGPQVWYIYS |
| Ga0210094_10254081 | 3300025549 | Natural And Restored Wetlands | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPQTGLQVWYIYS |
| Ga0207707_107949552 | 3300025912 | Corn Rhizosphere | MIGKIARGAYVAVVATMFVAWVVSFNKEVPAQPKPGPQVWYIHS |
| Ga0207671_101340511 | 3300025914 | Corn Rhizosphere | LTKKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207660_108196041 | 3300025917 | Corn Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAAPKPQTTGPQV |
| Ga0207657_109456062 | 3300025919 | Corn Rhizosphere | MVGKIARGAYVLVVGTMFVAWVLTFNKEAPAKPQPQTGPQIWYIHS |
| Ga0207652_101753464 | 3300025921 | Corn Rhizosphere | YGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207646_106858962 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQ |
| Ga0207706_116136492 | 3300025933 | Corn Rhizosphere | MVGKIARGAYVLVVGTMFVAWVLTFNKEAPAKPQTGPQVWYIHS |
| Ga0207709_113895091 | 3300025935 | Miscanthus Rhizosphere | AYVLVVGTMFVAWVLTFNKEAPAKPQTGPQVWYIHS |
| Ga0207691_104532993 | 3300025940 | Miscanthus Rhizosphere | DYPHKKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207711_102867921 | 3300025941 | Switchgrass Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQ |
| Ga0207679_101807063 | 3300025945 | Corn Rhizosphere | MVGKIARGAYVFVVGTMIVAWVIAFNKEAPASPQTGPQVWYIHS |
| Ga0210071_10164462 | 3300025955 | Natural And Restored Wetlands | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPLTGPQVWYIHS |
| Ga0207678_106524882 | 3300026067 | Corn Rhizosphere | MVGKIARGAYVLVVGTMFVAWVLTFNKEAPAKPQTG |
| Ga0207641_106580661 | 3300026088 | Switchgrass Rhizosphere | MIGKIARGAYVLVVGTMVVAWVVSFNKEAPAKPQPQTGPQ |
| Ga0207648_100919374 | 3300026089 | Miscanthus Rhizosphere | AYVFVVGMMIVGWVISFNKEVPARPQTGPQVWYIYS |
| Ga0256821_10045942 | 3300026452 | Sediment | MVGKIARGAYVLVVGTMFVVWAITFNKEAPAKPQTGLQVWYIHS |
| Ga0207501_1026191 | 3300026718 | Soil | VGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS |
| Ga0207631_1027903 | 3300026754 | Soil | YGSAAMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS |
| Ga0207527_1010982 | 3300026759 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYM |
| Ga0207537_1027222 | 3300026770 | Soil | MVGKIARGAYVFVVGMMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0207502_1027101 | 3300026828 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQ |
| Ga0207582_10077533 | 3300026960 | Soil | ARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0209973_10223131 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MVGKIARGAYVFVVGTMIVAWVVSFNKEAPARPQTGPQVWYVHS |
| Ga0209969_10759221 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MIGKIARGAYVAVVATMFVAWVVSFNKEGPAQPKSGPQIWYLHS |
| Ga0207560_1006891 | 3300027400 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSY |
| Ga0209970_10153362 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MVGKIARGAYVFVVGMMIVGWVISFNKEVPARPQTGPQVWYIYS |
| Ga0310888_100062276 | 3300031538 | Soil | AYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS |
| Ga0310813_100022396 | 3300031716 | Soil | MVEKIARGAYVFVVGTMIIAWVVSFNKETPPGPQTGPQVWYIHS |
| Ga0310813_113531392 | 3300031716 | Soil | MVGTVARGTYLLVVATMIVVWLVTFNKEAPAAPQPEPQVWQIYS |
| Ga0307469_100336332 | 3300031720 | Hardwood Forest Soil | MIGKIARGAYVLVVGTMVVAWAISFNQEAPAKPQPQTGPQIWYIHS |
| Ga0307468_1003518242 | 3300031740 | Hardwood Forest Soil | MIGKIARGAYVLVVGTMVVAWVISFNREVPAKPQPQTGPQIWYIHS |
| Ga0310903_101007672 | 3300032000 | Soil | MVGKIARGAYVFVVATMFVAWIISFNKEASATPQTTGPQVWYIHS |
| Ga0310899_103053931 | 3300032017 | Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMY |
| Ga0307470_118507662 | 3300032174 | Hardwood Forest Soil | MVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPHVSYMYS |
| Ga0335084_100810882 | 3300033004 | Soil | MVGKIARGAYVLVVGTMFVAWVITFNKEAPAKPQTGPQVWYIHS |
| Ga0310810_100080136 | 3300033412 | Soil | MIGKVARGAYVLVVGTMVVAWVVSFNKEVPAKPQPQTGPQIWYIHS |
| Ga0310811_106719893 | 3300033475 | Soil | KKYGSAAMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS |
| Ga0316628_1003293773 | 3300033513 | Soil | MIGKIARGAYVLVVTTMFVAWAISFNKPAPAAPEPAPQISYMYS |
| ⦗Top⦘ |