| Basic Information | |
|---|---|
| Family ID | F076979 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VGTWHDPDLGRPIAAPLERCAELLGVDLATIRAAAANVEPY |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 17.24 % |
| % of genes near scaffold ends (potentially truncated) | 87.18 % |
| % of genes from short scaffolds (< 2000 bps) | 82.05 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.282 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.316 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 2.90% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 5.13 |
| PF02796 | HTH_7 | 3.42 |
| PF12728 | HTH_17 | 2.56 |
| PF03091 | CutA1 | 1.71 |
| PF04075 | F420H2_quin_red | 1.71 |
| PF02371 | Transposase_20 | 1.71 |
| PF00872 | Transposase_mut | 1.71 |
| PF01161 | PBP | 1.71 |
| PF03704 | BTAD | 1.71 |
| PF00211 | Guanylate_cyc | 0.85 |
| PF13419 | HAD_2 | 0.85 |
| PF05988 | DUF899 | 0.85 |
| PF00239 | Resolvase | 0.85 |
| PF02517 | Rce1-like | 0.85 |
| PF13632 | Glyco_trans_2_3 | 0.85 |
| PF01839 | FG-GAP | 0.85 |
| PF08241 | Methyltransf_11 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF03928 | HbpS-like | 0.85 |
| PF01370 | Epimerase | 0.85 |
| PF10518 | TAT_signal | 0.85 |
| PF01180 | DHO_dh | 0.85 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF13701 | DDE_Tnp_1_4 | 0.85 |
| PF13602 | ADH_zinc_N_2 | 0.85 |
| PF09423 | PhoD | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF07498 | Rho_N | 0.85 |
| PF00583 | Acetyltransf_1 | 0.85 |
| PF00962 | A_deaminase | 0.85 |
| PF13432 | TPR_16 | 0.85 |
| PF14690 | zf-ISL3 | 0.85 |
| PF05368 | NmrA | 0.85 |
| PF02627 | CMD | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 1.71 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.71 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.71 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.71 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.71 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.71 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.85 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.85 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.85 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.85 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.85 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.85 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.28 % |
| All Organisms | root | All Organisms | 48.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301AJZHN | Not Available | 510 | Open in IMG/M |
| 3300003373|JGI25407J50210_10000503 | All Organisms → cellular organisms → Bacteria | 7851 | Open in IMG/M |
| 3300003373|JGI25407J50210_10056537 | Not Available | 989 | Open in IMG/M |
| 3300004463|Ga0063356_105707000 | Not Available | 534 | Open in IMG/M |
| 3300005562|Ga0058697_10187089 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005562|Ga0058697_10257919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300005981|Ga0081538_10009189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8285 | Open in IMG/M |
| 3300005981|Ga0081538_10021143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4764 | Open in IMG/M |
| 3300005981|Ga0081538_10351936 | Not Available | 533 | Open in IMG/M |
| 3300006058|Ga0075432_10606982 | Not Available | 501 | Open in IMG/M |
| 3300006847|Ga0075431_102164064 | Not Available | 511 | Open in IMG/M |
| 3300007790|Ga0105679_11011179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1850 | Open in IMG/M |
| 3300009100|Ga0075418_10565618 | Not Available | 1223 | Open in IMG/M |
| 3300009100|Ga0075418_12429666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300009147|Ga0114129_10278503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2235 | Open in IMG/M |
| 3300009147|Ga0114129_10894073 | Not Available | 1126 | Open in IMG/M |
| 3300009789|Ga0126307_10024837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4566 | Open in IMG/M |
| 3300009821|Ga0105064_1010030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1678 | Open in IMG/M |
| 3300009822|Ga0105066_1114089 | Not Available | 603 | Open in IMG/M |
| 3300009836|Ga0105068_1130112 | Not Available | 509 | Open in IMG/M |
| 3300009840|Ga0126313_10062409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2659 | Open in IMG/M |
| 3300009840|Ga0126313_10633090 | Not Available | 863 | Open in IMG/M |
| 3300010038|Ga0126315_10573158 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010041|Ga0126312_10075276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes auranticolor | 2280 | Open in IMG/M |
| 3300010041|Ga0126312_10340995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1061 | Open in IMG/M |
| 3300010041|Ga0126312_10496964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 873 | Open in IMG/M |
| 3300010042|Ga0126314_10057665 | Not Available | 2542 | Open in IMG/M |
| 3300010042|Ga0126314_10134781 | Not Available | 1710 | Open in IMG/M |
| 3300010042|Ga0126314_10151973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1613 | Open in IMG/M |
| 3300010042|Ga0126314_10250518 | Not Available | 1256 | Open in IMG/M |
| 3300010044|Ga0126310_10190005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1342 | Open in IMG/M |
| 3300010166|Ga0126306_10941431 | Not Available | 702 | Open in IMG/M |
| 3300010166|Ga0126306_11468356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 565 | Open in IMG/M |
| 3300010166|Ga0126306_11560315 | Not Available | 549 | Open in IMG/M |
| 3300010329|Ga0134111_10441470 | Not Available | 563 | Open in IMG/M |
| 3300012021|Ga0120192_10071751 | Not Available | 657 | Open in IMG/M |
| 3300012353|Ga0137367_10959200 | Not Available | 586 | Open in IMG/M |
| 3300012353|Ga0137367_11059411 | Not Available | 550 | Open in IMG/M |
| 3300012355|Ga0137369_10675984 | Not Available | 711 | Open in IMG/M |
| 3300012360|Ga0137375_10414609 | Not Available | 1172 | Open in IMG/M |
| 3300012360|Ga0137375_11144132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 600 | Open in IMG/M |
| 3300012941|Ga0162652_100054303 | Not Available | 657 | Open in IMG/M |
| 3300014487|Ga0182000_10260618 | Not Available | 701 | Open in IMG/M |
| 3300014487|Ga0182000_10349363 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300014488|Ga0182001_10305881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300015371|Ga0132258_10240635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4416 | Open in IMG/M |
| 3300015371|Ga0132258_12382031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1326 | Open in IMG/M |
| 3300015372|Ga0132256_100064424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3452 | Open in IMG/M |
| 3300015373|Ga0132257_100201415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2359 | Open in IMG/M |
| 3300017965|Ga0190266_10457171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
| 3300018028|Ga0184608_10012820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium | 2895 | Open in IMG/M |
| 3300018078|Ga0184612_10034308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2629 | Open in IMG/M |
| 3300018078|Ga0184612_10395789 | Not Available | 695 | Open in IMG/M |
| 3300018081|Ga0184625_10503598 | Not Available | 611 | Open in IMG/M |
| 3300018476|Ga0190274_11716693 | Not Available | 722 | Open in IMG/M |
| 3300021445|Ga0182009_10687761 | Not Available | 553 | Open in IMG/M |
| 3300022694|Ga0222623_10014867 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
| 3300022756|Ga0222622_10516107 | Not Available | 855 | Open in IMG/M |
| 3300026653|Ga0208846_102531 | Not Available | 517 | Open in IMG/M |
| 3300027209|Ga0209875_1015690 | Not Available | 891 | Open in IMG/M |
| 3300027880|Ga0209481_10730395 | Not Available | 515 | Open in IMG/M |
| 3300027907|Ga0207428_10268234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1270 | Open in IMG/M |
| 3300027907|Ga0207428_10317276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1151 | Open in IMG/M |
| 3300027957|Ga0209857_1066299 | Not Available | 622 | Open in IMG/M |
| 3300028708|Ga0307295_10016422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium | 1786 | Open in IMG/M |
| 3300028711|Ga0307293_10120950 | Not Available | 832 | Open in IMG/M |
| 3300028711|Ga0307293_10127958 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300028717|Ga0307298_10200570 | Not Available | 587 | Open in IMG/M |
| 3300028719|Ga0307301_10003766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4235 | Open in IMG/M |
| 3300028719|Ga0307301_10087684 | Not Available | 980 | Open in IMG/M |
| 3300028719|Ga0307301_10314330 | Not Available | 514 | Open in IMG/M |
| 3300028722|Ga0307319_10024915 | Not Available | 1838 | Open in IMG/M |
| 3300028722|Ga0307319_10077077 | Not Available | 1058 | Open in IMG/M |
| 3300028744|Ga0307318_10018341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2250 | Open in IMG/M |
| 3300028744|Ga0307318_10149054 | Not Available | 802 | Open in IMG/M |
| 3300028778|Ga0307288_10036592 | Not Available | 1647 | Open in IMG/M |
| 3300028778|Ga0307288_10052134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1411 | Open in IMG/M |
| 3300028796|Ga0307287_10293979 | Not Available | 614 | Open in IMG/M |
| 3300028810|Ga0307294_10022276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1681 | Open in IMG/M |
| 3300028811|Ga0307292_10118809 | Not Available | 1051 | Open in IMG/M |
| 3300028814|Ga0307302_10003536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6901 | Open in IMG/M |
| 3300028814|Ga0307302_10061956 | Not Available | 1750 | Open in IMG/M |
| 3300028814|Ga0307302_10398774 | Not Available | 680 | Open in IMG/M |
| 3300028814|Ga0307302_10410187 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300028876|Ga0307286_10044527 | Not Available | 1494 | Open in IMG/M |
| 3300028876|Ga0307286_10185583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300028878|Ga0307278_10015431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3548 | Open in IMG/M |
| 3300028878|Ga0307278_10042199 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300028878|Ga0307278_10165782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 988 | Open in IMG/M |
| 3300028881|Ga0307277_10289847 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300028881|Ga0307277_10442301 | Not Available | 582 | Open in IMG/M |
| 3300031548|Ga0307408_100196177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1630 | Open in IMG/M |
| 3300031548|Ga0307408_101204555 | Not Available | 706 | Open in IMG/M |
| 3300031731|Ga0307405_11309845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300031824|Ga0307413_10489252 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300031824|Ga0307413_12054627 | Not Available | 516 | Open in IMG/M |
| 3300031852|Ga0307410_10383532 | Not Available | 1131 | Open in IMG/M |
| 3300031901|Ga0307406_10737216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
| 3300031901|Ga0307406_11016490 | Not Available | 712 | Open in IMG/M |
| 3300031903|Ga0307407_10574936 | Not Available | 836 | Open in IMG/M |
| 3300031903|Ga0307407_11347221 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031995|Ga0307409_100658446 | Not Available | 1042 | Open in IMG/M |
| 3300031995|Ga0307409_101228006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 773 | Open in IMG/M |
| 3300031995|Ga0307409_101416469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium → Sphaerisporangium album | 721 | Open in IMG/M |
| 3300031995|Ga0307409_102029581 | Not Available | 605 | Open in IMG/M |
| 3300032002|Ga0307416_100046583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3423 | Open in IMG/M |
| 3300032002|Ga0307416_101596891 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032002|Ga0307416_102799336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300032004|Ga0307414_10695409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 920 | Open in IMG/M |
| 3300032004|Ga0307414_11807209 | Not Available | 570 | Open in IMG/M |
| 3300032005|Ga0307411_11675272 | Not Available | 588 | Open in IMG/M |
| 3300032126|Ga0307415_100188173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
| 3300032126|Ga0307415_100889385 | Not Available | 820 | Open in IMG/M |
| 3300032126|Ga0307415_102545010 | Not Available | 504 | Open in IMG/M |
| 3300032159|Ga0268251_10385918 | Not Available | 603 | Open in IMG/M |
| 3300032174|Ga0307470_10832992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora spinosa | 718 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 20.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 12.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.27% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.27% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.56% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026653 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1105 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_01856440 | 2067725001 | Soil | VGTWYDPELGRPIAAPLERCAELLGVDLATVASWPPTS |
| JGI25407J50210_1000050314 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VGTWHDPDVGRPIAAPLPRCAELLGVDLATIAAAAANVEPYLRADGA |
| JGI25407J50210_100565371 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VGTWHDLDVGRPIAAPLERCAELLGVDLATIAAAAANVEPYLRADGA |
| Ga0063356_1057070001 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGTWQDPELGQPLAAPLERCAELLGVDLATIRAAAANVEP |
| Ga0058697_101870891 | 3300005562 | Agave | VPDPDSGRPVAAPLDQCTQLLGIDLATVRELAAKVEP |
| Ga0058697_102579192 | 3300005562 | Agave | MVVGTWEADDPAYSRPIAAPLERCAELLGVDLATIQRA |
| Ga0081538_100091899 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LVGTWHDPALGRPIAAPLQRCAELLGVDLTTISEAAANVEPYIRADGTRI* |
| Ga0081538_100211431 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLATVGELAANVEPYVRADGTSI |
| Ga0081538_103519361 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGTWHDPALGRPIAAPLPRCADLLGVDLATIQQAAANIEPYVRADGTRIWS |
| Ga0075432_106069821 | 3300006058 | Populus Rhizosphere | MGSIPGRAGTWHDPDQGRPIAAPLERCAQLLGVELATVRTLAATVEP |
| Ga0075431_1021640641 | 3300006847 | Populus Rhizosphere | VGTWHDPDSGRPIAAPLERCAELLGVDVATIQKAVANVQPYLRADG |
| Ga0105679_110111791 | 3300007790 | Soil | VGTWYDLDLGRPIAAPLERCAELLGVDLTTIQEAAANVEPY |
| Ga0075418_105656182 | 3300009100 | Populus Rhizosphere | VGTWYDPELGRPIAAPLERCAELLGVDLATIRTLAADVEPYLRADGTKV* |
| Ga0075418_124296661 | 3300009100 | Populus Rhizosphere | VGTWEADDQAYSRPIAAPLETCAELLGVDLTTIQW |
| Ga0114129_102785035 | 3300009147 | Populus Rhizosphere | VGTWHDLDVGRPIAAPLERCAELLGIDLAAIRAAAANVEPYLRADGT |
| Ga0114129_108940731 | 3300009147 | Populus Rhizosphere | VGTWHDPELVRPIAAPLERCAELLGVDLATVSELA |
| Ga0126307_100248372 | 3300009789 | Serpentine Soil | VGTWHDLDLGRPIAAPLEQCAVLLGVDLATVRELAAEVEPYIRADGTGSGA* |
| Ga0105064_10100301 | 3300009821 | Groundwater Sand | VGTWHDPDVGRPIAAPLERCAELLGVDLATIRAAAANVEPYLRTDGTRIWSL |
| Ga0105066_11140891 | 3300009822 | Groundwater Sand | VGTWHDPEAGRPIAAPLERCAELFGVDLATVHGLAANVEPYLR |
| Ga0105068_11301122 | 3300009836 | Groundwater Sand | VGTWHDPDLGRPIAAPLERCAELLGVDLATVCEVA |
| Ga0126313_100624094 | 3300009840 | Serpentine Soil | VGSWHDPDLGRPIAAPLERCAELLGVDLATARELAANVQPYVRAD |
| Ga0126313_106330901 | 3300009840 | Serpentine Soil | VGRPIAAPLERCAELLGVDLATVCKLAAKVEPYIRADGTRSGA* |
| Ga0126315_105731582 | 3300010038 | Serpentine Soil | VGTWHDPGLGRPIAASLERCAELLGVDLVTIREAATTVEP |
| Ga0126312_100752761 | 3300010041 | Serpentine Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATARELAANVQPYV |
| Ga0126312_103409951 | 3300010041 | Serpentine Soil | VGTWHDPDLGRPIAAPLEQCAELLDVDLATVRELAAEVEPYIRADG |
| Ga0126312_104969641 | 3300010041 | Serpentine Soil | VGTWYDPELGRPIAAPLERCAELLGVDLTTVRKLAVNVEPYLRADGTKVW |
| Ga0126314_100576651 | 3300010042 | Serpentine Soil | VFDTLFRVGTWHDRDLGRPIAAPLERCAELLGVDLATI |
| Ga0126314_101347813 | 3300010042 | Serpentine Soil | VGTWHNPDLGRPIAAPLERCAELLGVDLATVCLLAAEVEPYVR |
| Ga0126314_101519733 | 3300010042 | Serpentine Soil | VETWHDPDLGRPIAAPLERCAELLGVDLATIHQAAANVEPYLRADGTRIWS |
| Ga0126314_102505185 | 3300010042 | Serpentine Soil | VGTWHDPVDRPVAAPLERCAELLGVDLATVCLLAAEVEP |
| Ga0126310_101900051 | 3300010044 | Serpentine Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATIHELAANVE |
| Ga0126306_109414311 | 3300010166 | Serpentine Soil | GSVGTWHDLDLGRPIAAPLEQCAVLLGVDLATVRELAAEVEPYIRADGTGSGA* |
| Ga0126306_114683562 | 3300010166 | Serpentine Soil | VGTWHDPGLGRPIAAPLERCAELLGVDLVTIRGAATNVEPYIRA |
| Ga0126306_115603151 | 3300010166 | Serpentine Soil | VGTWHDVDVGRPIAAPLEQCAQLLGVDLATVHELAAKVEPYLP |
| Ga0134111_104414701 | 3300010329 | Grasslands Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATVGELAAK |
| Ga0120192_100717512 | 3300012021 | Terrestrial | VGTWHDPDLGRPIAAPLERCAELLGVDLATVREPAAHVE |
| Ga0137367_109592001 | 3300012353 | Vadose Zone Soil | MRTWEARDPDFGRPLAAPLEHCAELLRVDLATVRKVAANVEPYVRADG |
| Ga0137367_110594111 | 3300012353 | Vadose Zone Soil | MRTWERHDPDLTRPIAAPLDRCAQLLGVELAIVRKA |
| Ga0137369_106759841 | 3300012355 | Vadose Zone Soil | MRTWEAHDPDLGRPITAPLEQCAELLGIDLATVRELAAGIEPYI |
| Ga0137375_104146092 | 3300012360 | Vadose Zone Soil | VGTWHDPEVGRPIAAPLERCAELLGLDLATVHELAAGI* |
| Ga0137375_111441322 | 3300012360 | Vadose Zone Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATVRELA |
| Ga0162652_1000543031 | 3300012941 | Soil | VGTWYDLNAGRPIAAPLERCAELLGVDLATIREAAANVEPYLR |
| Ga0182000_102606181 | 3300014487 | Soil | VGTWHDPDVGWPIAAPLEQCAELLDVDLAAIRAAA |
| Ga0182000_103493631 | 3300014487 | Soil | VGTWHDLDTGRPIAAPLERCAELLGVDLATVRELA |
| Ga0182001_103058812 | 3300014488 | Soil | VGTWHDLAVGRPIAAPLERCAELLGVDLATIREAAANVEPYLRA |
| Ga0132258_102406357 | 3300015371 | Arabidopsis Rhizosphere | MGSIPGRAGTWHDPDQGRPIAAPLERCAQLLGVELATVRALAA |
| Ga0132258_123820313 | 3300015371 | Arabidopsis Rhizosphere | VGTWHDPDQGRPIAAPLERCAQLLGVELATVRALA |
| Ga0132256_1000644241 | 3300015372 | Arabidopsis Rhizosphere | MGSIPGRAGTWHDPDQGRPIAAPLERCAQLLGVELATVRA |
| Ga0132257_1002014153 | 3300015373 | Arabidopsis Rhizosphere | VGTWHDPGLGRPIAAPLERCAELLGVELATVRALAATVEPYL |
| Ga0190266_104571712 | 3300017965 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATIGEAAANVAPYIRADGTRIWS |
| Ga0184608_100128203 | 3300018028 | Groundwater Sediment | VGIWYDLDVDRPIAAPLERCAELLGVDLAAIGAAAANVEPYLRPDGTRI |
| Ga0184612_100343083 | 3300018078 | Groundwater Sediment | VGTWHDPDLGRPIAAPLERCAELLGVDLATVGELAAKVEPYVRADDTRI |
| Ga0184612_103957891 | 3300018078 | Groundwater Sediment | VGTWHDPDLGRPIAAPLERCAELLGVDLAIVRGVAANVEPY |
| Ga0184625_105035981 | 3300018081 | Groundwater Sediment | VGTWHDPDLGRPIAAPLPRCAELLGVDLATVQEAAANVE |
| Ga0190274_117166931 | 3300018476 | Soil | VGTWHDPDLGRPIAAPLPQCAELLGVDLAIVRELAAGVEPYICAD |
| Ga0182009_106877611 | 3300021445 | Soil | VGNWHDPDLGRPIAGPLERCAQLLGIDLATIQDAAANVGPM |
| Ga0222623_100148675 | 3300022694 | Groundwater Sediment | VGTWHDPDLGRPIAAPLERCAQLLGVELATVRTLA |
| Ga0222622_105161071 | 3300022756 | Groundwater Sediment | VGTWEADDPAYSRPSAAPLERCAELLGVDLATIQRAAADVEPYIRVDGS |
| Ga0208846_1025312 | 3300026653 | Soil | VGTWHDLDVGRPITAPLERCAELLGIDLATVRELAAKVEPYIRADGTEV |
| Ga0209875_10156901 | 3300027209 | Groundwater Sand | VGTWHDPGLGRPIAAPLERCAELLGVELAAVREVAAKVEPYVRADGTRVWS |
| Ga0209481_107303951 | 3300027880 | Populus Rhizosphere | VGTWHDPDPGRPIAAPLERCAELLGVDLATIGEAAANVAPYIRADGTRIW |
| Ga0207428_102682341 | 3300027907 | Populus Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLATVRKLATQVEPYIRVDGTKVWS |
| Ga0207428_103172761 | 3300027907 | Populus Rhizosphere | VGTWHDLDVGRPIAAPLERCAELLGIDLAAIRAAAANVEPYL |
| Ga0209857_10662993 | 3300027957 | Groundwater Sand | VGTWHDPDLGRPIAAPLERCAELLGVDLATICELAANIE |
| Ga0307295_100164221 | 3300028708 | Soil | VGPWHDLDVDRPIAAPLQRCAELLGVDLATIGVAAGNVEPYLRPDG |
| Ga0307293_101209501 | 3300028711 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATIRAAAANVEPY |
| Ga0307293_101279581 | 3300028711 | Soil | VGTWHDLNVGRPIAAPLERCAELLGVDLATIREAAANVEPY |
| Ga0307298_102005701 | 3300028717 | Soil | VGIWYDLDVDRPIAAPLERCAELLGVDLAAIGAAAANVEPYLRPDGT |
| Ga0307301_100037661 | 3300028719 | Soil | VGTWHDPELGRPIAAPLERCAELLGVDLATICEAAATVEPYIRA |
| Ga0307301_100876841 | 3300028719 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATIGEAAANVEPYRRADATRVWSLM |
| Ga0307301_103143301 | 3300028719 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATVRELAAKVQRPP |
| Ga0307319_100249151 | 3300028722 | Soil | VGTWHDPDLGRPIAAPLERCAELLGIDLATIRELAAKVQPY |
| Ga0307319_100770772 | 3300028722 | Soil | VGTWHDPELGRPIAAPLERCAELLGVDLATICAAAANVEPY |
| Ga0307318_100183413 | 3300028744 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATIRAAAANVEPYLRT |
| Ga0307318_101490542 | 3300028744 | Soil | VGTWHDLNVGRPIAAPLERCAELLGVDLATIREAA |
| Ga0307288_100365922 | 3300028778 | Soil | VRTWQDPDLGRPIAAPLERCAELLGIDLATIRAAAAN |
| Ga0307288_100521343 | 3300028778 | Soil | VGTWHDLDLGRPIAAPLERCAELLDVDLATIGAAAANVEPYIRA |
| Ga0307287_102939791 | 3300028796 | Soil | VGTWHDPDLGPPIAAPLEQCAELLGVDLATVHALSAK |
| Ga0307294_100222764 | 3300028810 | Soil | VGTWHDLDLGRPIAAPLERCAELLDVDLATIGAAAAN |
| Ga0307292_101188092 | 3300028811 | Soil | VVGTWHDPDLGRPIAAPLERCAELLGVDLAAVTEMAFSSS |
| Ga0307302_100035366 | 3300028814 | Soil | VGRWHDLDVDRPIAAPLQRCAELLGVDLATIGVAAANVEPYLRPDGT |
| Ga0307302_100619562 | 3300028814 | Soil | VGTWHDPDLGRPIAAPLERCAELLGVDLATICEAAADVEPYIRADGTTIWSLM |
| Ga0307302_103987741 | 3300028814 | Soil | VGTWHDPDLGRPIAAPLKRCAELLGVDLVTIRKAATNVEPYLRADGT |
| Ga0307302_104101871 | 3300028814 | Soil | VGTWHDLNVGRPIAAPLERCAELLGVDLATIREAAAN |
| Ga0307286_100445272 | 3300028876 | Soil | VKSRIPDWQDPDLGRPIAAPLERCAQLLGVALPTVREL |
| Ga0307286_101855832 | 3300028876 | Soil | VGTWHDPDLGPPIAAPLEQCAELLGVDLATVHALAAKVDPYIR |
| Ga0307278_100154312 | 3300028878 | Soil | MRSISYRRGTWHDADLGRPIAAPLDQCAELLSVDLATIRELAANVEP |
| Ga0307278_100421993 | 3300028878 | Soil | VGTWHDPDLGRPIAAPLERCVELLGVDLATINELAAKVEPYIR |
| Ga0307278_101657822 | 3300028878 | Soil | VGTWHDLDVGRPIAAPLERCAELLGVDLATVCKLAAKVEPDR |
| Ga0307277_102898472 | 3300028881 | Soil | VGTWHDLNVGRPIAAPLERCAELLGVDLATIREVAATV |
| Ga0307277_104423011 | 3300028881 | Soil | MSAWDANDPTFGRPLAAPLEQCAQLLGVDLATLRTVAADVEPYLRVDG |
| Ga0307408_1001961771 | 3300031548 | Rhizosphere | VGTWHDLDLGRPIAAPLERCAELLGVDLATVRELAAK |
| Ga0307408_1012045551 | 3300031548 | Rhizosphere | VGTWEAEDPAYFRPIAAPLERCAELLGVDLATIQGAAADVEPYIR |
| Ga0307408_1012376802 | 3300031548 | Rhizosphere | VGTWEADDPAYSRPSAAPLERCAELLGVDLATIQRAATDVEPY |
| Ga0307405_113098452 | 3300031731 | Rhizosphere | VGTWHDLDLGRPIAAPLEQCAVLLSVDLATVRELAAEVEPYIRAD |
| Ga0307413_104892521 | 3300031824 | Rhizosphere | VGTWHDPDLGRPIAAPLEQCAELLGVDLATVCELATNV |
| Ga0307413_120546271 | 3300031824 | Rhizosphere | VGTWHDPDVDRPIAAPLQQCAELLGVALATVSELVANIEPYLRADGTRLWSLTRLE |
| Ga0307410_103835322 | 3300031852 | Rhizosphere | VGTWHDLNLGRPIAAPLERCAELLGVDLAMIREAATNVEP |
| Ga0307406_107372161 | 3300031901 | Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLATICAAAANVEPYLRADGTKI |
| Ga0307406_110164901 | 3300031901 | Rhizosphere | VGIWHDPDLGRPIAAPLERCADLLGVDLATIGEAAANVEPYLRADGTRI |
| Ga0307407_105749362 | 3300031903 | Rhizosphere | VGTWQDPDLGRPIAAPLHQCAELLGVDLATIREAAANIEPNQRAD |
| Ga0307407_113472212 | 3300031903 | Rhizosphere | VGTWEADDPAYARPIAAPLERCAELLGVDLVTITG |
| Ga0307409_1006584462 | 3300031995 | Rhizosphere | VGTWHDPDLGRPIAAPLERCAQLLGMDLATVRELAAWVEP |
| Ga0307409_1012280062 | 3300031995 | Rhizosphere | VGTWHDPDQGRPIAAPLERCAQLLGADLATVGELAAAVEPYLRADGTRI |
| Ga0307409_1014164692 | 3300031995 | Rhizosphere | VGTRHDDALGRPITAPLDQCAELLGVDLATIQKVAAGVEPCIRADSSKV |
| Ga0307409_1020295812 | 3300031995 | Rhizosphere | LHDLDLGRPIAAPLEECAELLGVDLATVCTLAAKVE |
| Ga0307416_1000465836 | 3300032002 | Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLATIDEAAANVEPYIRV |
| Ga0307416_1015968912 | 3300032002 | Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLATVCELAA |
| Ga0307416_1027993362 | 3300032002 | Rhizosphere | VGTWHDPDLGRPIAAPLDRCAELLGVDLATVQELAA |
| Ga0307414_106954091 | 3300032004 | Rhizosphere | VGTWHDLDLGRPIAAPLERCAELLGVDLATVRELAAKVEPYIRAD |
| Ga0307414_118072091 | 3300032004 | Rhizosphere | VGTWHDPEQGRPIAAPLERCAELLGVDLATIWVAAANVEPYLRADG |
| Ga0307411_116752721 | 3300032005 | Rhizosphere | VGTWHDPDLGRPIAAPLEQCAKLLGVDLVAVRKLAAKVQP |
| Ga0307415_1001881733 | 3300032126 | Rhizosphere | VGTWYDPELGRPIAAPLERCAELLGVDLATVRKLAADVEPY |
| Ga0307415_1008893851 | 3300032126 | Rhizosphere | VGTWHEASLGRPIAAPLERCAELLGVDLATARELAAKVEPYICADGTKV |
| Ga0307415_1025450101 | 3300032126 | Rhizosphere | VGTWHDPDLGRPIAAPLERCAELLGVDLDTVRTLATKVEPYLRA |
| Ga0268251_103859181 | 3300032159 | Agave | VGTWHDPDLGRPIAAPLERCAELLGVDLATVRELAAKVEPYIRADGTKCFGS |
| Ga0307470_108329921 | 3300032174 | Hardwood Forest Soil | VGTWHDPDQGRPIAAPLERCAQLLGVELATVRTLAATVEPYLRAD |
| ⦗Top⦘ |