| Basic Information | |
|---|---|
| Family ID | F076768 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS |
| Number of Associated Samples | 39 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 89.74 % |
| % of genes near scaffold ends (potentially truncated) | 9.40 % |
| % of genes from short scaffolds (< 2000 bps) | 62.39 % |
| Associated GOLD sequencing projects | 38 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (58.120 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (66.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.376 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (48.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 22.54% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04883 | HK97-gp10_like | 7.69 |
| PF04860 | Phage_portal | 3.42 |
| PF09956 | DUF2190 | 2.56 |
| PF00005 | ABC_tran | 1.71 |
| PF08378 | NERD | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF12706 | Lactamase_B_2 | 0.85 |
| PF05065 | Phage_capsid | 0.85 |
| PF00583 | Acetyltransf_1 | 0.85 |
| PF00227 | Proteasome | 0.85 |
| PF00266 | Aminotran_5 | 0.85 |
| PF03237 | Terminase_6N | 0.85 |
| PF00382 | TFIIB | 0.85 |
| PF13091 | PLDc_2 | 0.85 |
| PF14947 | HTH_45 | 0.85 |
| PF00752 | XPG_N | 0.85 |
| PF04266 | ASCH | 0.85 |
| PF01978 | TrmB | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.85 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.85 |
| COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.85 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.85 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.85 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.12 % |
| Unclassified | root | N/A | 41.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003218|JGI26339J46600_10127999 | Not Available | 603 | Open in IMG/M |
| 3300005800|Ga0079639_1004600 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4224 | Open in IMG/M |
| 3300005800|Ga0079639_1016328 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1944 | Open in IMG/M |
| 3300005800|Ga0079639_1020992 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1652 | Open in IMG/M |
| 3300009518|Ga0116128_1040332 | Not Available | 1507 | Open in IMG/M |
| 3300009519|Ga0116108_1000543 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 21324 | Open in IMG/M |
| 3300009549|Ga0116137_1048418 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1391 | Open in IMG/M |
| 3300009614|Ga0116104_1000034 | All Organisms → cellular organisms → Archaea | 146857 | Open in IMG/M |
| 3300009629|Ga0116119_1009634 | Not Available | 2921 | Open in IMG/M |
| 3300009643|Ga0116110_1184895 | All Organisms → cellular organisms → Archaea → TACK group | 680 | Open in IMG/M |
| 3300010324|Ga0129297_10000677 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 16755 | Open in IMG/M |
| 3300010328|Ga0129298_10439196 | Not Available | 597 | Open in IMG/M |
| 3300012964|Ga0153916_10876816 | Not Available | 978 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10023462 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4356 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10058745 | Not Available | 2529 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10094625 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1912 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10134371 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1554 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10147706 | Not Available | 1468 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10190011 | Not Available | 1261 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10203022 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1212 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10211070 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1184 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10214304 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1173 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10357604 | Not Available | 860 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10655145 | Not Available | 597 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10069104 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2415 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10160074 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1465 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10194775 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1301 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10235511 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1159 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10459754 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 767 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10629964 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 633 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10663582 | Not Available | 614 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10144991 | Not Available | 1624 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10428891 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 845 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10432451 | Not Available | 841 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10682766 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 638 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10909507 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 539 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10392338 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 902 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10763689 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 603 | Open in IMG/M |
| 3300014153|Ga0181527_1134930 | Not Available | 1101 | Open in IMG/M |
| 3300017929|Ga0187849_1000801 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 39364 | Open in IMG/M |
| 3300017929|Ga0187849_1090110 | Not Available | 1320 | Open in IMG/M |
| 3300017941|Ga0187850_10000830 | All Organisms → cellular organisms → Archaea | 37599 | Open in IMG/M |
| 3300017973|Ga0187780_10138979 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1682 | Open in IMG/M |
| 3300017996|Ga0187891_1259653 | Not Available | 575 | Open in IMG/M |
| 3300018004|Ga0187865_1190427 | Not Available | 702 | Open in IMG/M |
| 3300018005|Ga0187878_1004011 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 11642 | Open in IMG/M |
| 3300018016|Ga0187880_1000429 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 35829 | Open in IMG/M |
| 3300018018|Ga0187886_1003434 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 11842 | Open in IMG/M |
| 3300018018|Ga0187886_1075301 | Not Available | 1468 | Open in IMG/M |
| 3300018024|Ga0187881_10034798 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2574 | Open in IMG/M |
| 3300018024|Ga0187881_10250310 | Not Available | 742 | Open in IMG/M |
| 3300018088|Ga0187771_10502332 | Not Available | 1026 | Open in IMG/M |
| 3300018088|Ga0187771_10553163 | Not Available | 975 | Open in IMG/M |
| 3300018088|Ga0187771_11454186 | Not Available | 581 | Open in IMG/M |
| 3300018088|Ga0187771_11868013 | Not Available | 510 | Open in IMG/M |
| 3300018089|Ga0187774_10585321 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 719 | Open in IMG/M |
| 3300022221|Ga0224506_10003845 | Not Available | 9838 | Open in IMG/M |
| 3300022551|Ga0212089_10001009 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 21083 | Open in IMG/M |
| 3300027825|Ga0209039_10141195 | Not Available | 1008 | Open in IMG/M |
| 3300027825|Ga0209039_10141196 | Not Available | 1008 | Open in IMG/M |
| 3300031463|Ga0272448_1200850 | Not Available | 1007 | Open in IMG/M |
| 3300031463|Ga0272448_1247149 | Not Available | 832 | Open in IMG/M |
| 3300031862|Ga0315280_10002462 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 29958 | Open in IMG/M |
| 3300031862|Ga0315280_10002965 | All Organisms → cellular organisms → Archaea | 26707 | Open in IMG/M |
| 3300031862|Ga0315280_10004810 | All Organisms → cellular organisms → Archaea → TACK group | 19643 | Open in IMG/M |
| 3300031862|Ga0315280_10008065 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 13917 | Open in IMG/M |
| 3300031862|Ga0315280_10008804 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 13142 | Open in IMG/M |
| 3300031862|Ga0315280_10010177 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 11854 | Open in IMG/M |
| 3300031862|Ga0315280_10018228 | Not Available | 7769 | Open in IMG/M |
| 3300031862|Ga0315280_10019437 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 7397 | Open in IMG/M |
| 3300031862|Ga0315280_10039389 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 4323 | Open in IMG/M |
| 3300031862|Ga0315280_10049076 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3643 | Open in IMG/M |
| 3300031862|Ga0315280_10051240 | Not Available | 3521 | Open in IMG/M |
| 3300031862|Ga0315280_10089176 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2256 | Open in IMG/M |
| 3300031862|Ga0315280_10090300 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2232 | Open in IMG/M |
| 3300031862|Ga0315280_10091471 | Not Available | 2209 | Open in IMG/M |
| 3300031862|Ga0315280_10142043 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1527 | Open in IMG/M |
| 3300031862|Ga0315280_10159166 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1384 | Open in IMG/M |
| 3300031862|Ga0315280_10164112 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1348 | Open in IMG/M |
| 3300031862|Ga0315280_10176215 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1269 | Open in IMG/M |
| 3300031862|Ga0315280_10187543 | Not Available | 1203 | Open in IMG/M |
| 3300031862|Ga0315280_10208813 | Not Available | 1098 | Open in IMG/M |
| 3300031862|Ga0315280_10220049 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1050 | Open in IMG/M |
| 3300031862|Ga0315280_10348558 | Not Available | 709 | Open in IMG/M |
| 3300031862|Ga0315280_10376012 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 666 | Open in IMG/M |
| 3300031862|Ga0315280_10387837 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 649 | Open in IMG/M |
| 3300031862|Ga0315280_10419235 | Not Available | 610 | Open in IMG/M |
| 3300031862|Ga0315280_10419474 | Not Available | 609 | Open in IMG/M |
| 3300032020|Ga0315296_10000238 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 50876 | Open in IMG/M |
| 3300032020|Ga0315296_10217542 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1131 | Open in IMG/M |
| 3300032020|Ga0315296_10328951 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 857 | Open in IMG/M |
| 3300032020|Ga0315296_10349962 | Not Available | 821 | Open in IMG/M |
| 3300032069|Ga0315282_10018642 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 9884 | Open in IMG/M |
| 3300032069|Ga0315282_10044749 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 5008 | Open in IMG/M |
| 3300032069|Ga0315282_10071546 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3410 | Open in IMG/M |
| 3300032069|Ga0315282_10077338 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3196 | Open in IMG/M |
| 3300032069|Ga0315282_10121187 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2197 | Open in IMG/M |
| 3300032069|Ga0315282_10134182 | Not Available | 2019 | Open in IMG/M |
| 3300032069|Ga0315282_10150854 | Not Available | 1835 | Open in IMG/M |
| 3300032069|Ga0315282_10152715 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1817 | Open in IMG/M |
| 3300032069|Ga0315282_10154405 | Not Available | 1801 | Open in IMG/M |
| 3300032069|Ga0315282_10354078 | Not Available | 915 | Open in IMG/M |
| 3300032069|Ga0315282_10424314 | Not Available | 789 | Open in IMG/M |
| 3300032069|Ga0315282_10580136 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 612 | Open in IMG/M |
| 3300032070|Ga0315279_10000739 | All Organisms → cellular organisms → Archaea | 60277 | Open in IMG/M |
| 3300032070|Ga0315279_10001952 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 32544 | Open in IMG/M |
| 3300032070|Ga0315279_10004166 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 19574 | Open in IMG/M |
| 3300032118|Ga0315277_10025321 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 7143 | Open in IMG/M |
| 3300032118|Ga0315277_10031345 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 6331 | Open in IMG/M |
| 3300032173|Ga0315268_10129167 | Not Available | 2390 | Open in IMG/M |
| 3300032173|Ga0315268_10562253 | Not Available | 1129 | Open in IMG/M |
| 3300032173|Ga0315268_10768427 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 963 | Open in IMG/M |
| 3300032173|Ga0315268_10848279 | Not Available | 916 | Open in IMG/M |
| 3300032173|Ga0315268_11020824 | Not Available | 834 | Open in IMG/M |
| 3300032829|Ga0335070_10044082 | Not Available | 4957 | Open in IMG/M |
| 3300032829|Ga0335070_11884750 | Not Available | 540 | Open in IMG/M |
| 3300033991|Ga0334965_0064820 | Not Available | 1691 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 66.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.13% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.13% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.56% |
| Thermal Hot Spring | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring | 2.56% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005800 | Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031463 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26339J46600_101279992 | 3300003218 | Bog Forest Soil | VSRVLTKGNYILAKVNGSKKVLTSTEMQQLINDGYDVEVVTAA* |
| Ga0079639_10046004 | 3300005800 | Thermal Hot Spring | MSYWGKVIGKGNYIVAKVNGVKMVLTSAELKWLLDNGYDVEVVG* |
| Ga0079639_10163283 | 3300005800 | Thermal Hot Spring | MSYWGKIIGKGNYIVAKVNGVRMTLTSAELKWFLDNGYDVEVVG* |
| Ga0079639_10209922 | 3300005800 | Thermal Hot Spring | MSYWGKIIGKGNYIVAKVNGVKMVLTSSELRWFLDNGYDVEVVG* |
| Ga0116128_10403322 | 3300009518 | Peatland | VLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG* |
| Ga0116108_100054329 | 3300009519 | Peatland | MSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG* |
| Ga0116137_10484183 | 3300009549 | Peatland | MSYPDKVLGRGNYIVAKVNGVKMTLTSVELQRLLCDGYDVEVTSS* |
| Ga0116104_100003484 | 3300009614 | Peatland | VSKVLGKGNYILAKVNGTKMVLTSTEMQQLINNGYDVEVVTPT* |
| Ga0116119_10096341 | 3300009629 | Peatland | PMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG* |
| Ga0116110_11848952 | 3300009643 | Peatland | MSYGKVLTKGNYILAKVNGVKMVLSSGELGQLICDGYDVEVVTST* |
| Ga0129297_1000067714 | 3300010324 | Lake Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIVG* |
| Ga0129298_104391961 | 3300010328 | Lake Sediment | VSQSMSKVLGKGNFIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS* |
| Ga0153916_108768162 | 3300012964 | Freshwater Wetlands | LSKVLGKGNYIVAKVNGTKTVLTGAEFQQLLDNGYDVEVISSF* |
| (restricted) Ga0172365_100234622 | 3300013127 | Sediment | MSYWGHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS* |
| (restricted) Ga0172365_100587451 | 3300013127 | Sediment | MSKVLGKGNYIVAKVNAVKMVLTSAELKQLMDNGYDVEVVTSS* |
| (restricted) Ga0172365_100946252 | 3300013127 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF* |
| (restricted) Ga0172365_101343713 | 3300013127 | Sediment | MSKVLGKGNYIIAKVNNVKMVLTSAELKQLMDNGYDVEIVG* |
| (restricted) Ga0172365_101477062 | 3300013127 | Sediment | MSHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF* |
| (restricted) Ga0172365_101900113 | 3300013127 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPT* |
| (restricted) Ga0172365_102030223 | 3300013127 | Sediment | MSYWGHVLGKGNYVVAKVNGVKMVLTSAELQQMLDNGYDVEICTPS* |
| (restricted) Ga0172365_102110702 | 3300013127 | Sediment | MNKVLGKGNYIVAKVNGVKMVLTSTELQQLLDNGYDVEVVTAS* |
| (restricted) Ga0172365_102143041 | 3300013127 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEVLSAS* |
| (restricted) Ga0172365_103576043 | 3300013127 | Sediment | MSNVLGKGNYIIAKVNGVKMVLTSAELKQLMDNGYDVEIVG* |
| (restricted) Ga0172365_106551452 | 3300013127 | Sediment | MSYWGHVLGRGNYIVAKVNGVKMVLTSAEMQRLINAGYDIEVMG* |
| (restricted) Ga0172366_100691044 | 3300013128 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSTELQQLLDNGYDVEVVTAS* |
| (restricted) Ga0172366_101600744 | 3300013128 | Sediment | MSYWGHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVE |
| (restricted) Ga0172366_101947752 | 3300013128 | Sediment | MSYWGHVLGKGNYIVAKVNGAKMALTSAELQQLLDNGYDVEIITSP* |
| (restricted) Ga0172366_102355112 | 3300013128 | Sediment | MSNVLGKGNYIVAKVNGVKMVLTSAELKQLMDHGYDVEIITSF* |
| (restricted) Ga0172366_104597543 | 3300013128 | Sediment | MSYWGHVLGKGNYIVAKVNGVKMVLTSAEMQRLINAGYDIEVMS* |
| (restricted) Ga0172366_106299642 | 3300013128 | Sediment | MSKVLGKGNYIVAKVNNVKQVLTSAELKQLIDNGYDVEIVTLS* |
| (restricted) Ga0172366_106635822 | 3300013128 | Sediment | MSYWGHVLGRGNYIVAKVNGVKMVLTSAEMQQLINAGYDVEVITVS* |
| (restricted) Ga0172364_101449912 | 3300013129 | Sediment | MSYWGHVLGRGNYIVAKVNGVTMVLTSAEMQRLINAGYDIEVMG* |
| (restricted) Ga0172364_104288912 | 3300013129 | Sediment | MSYWGHVLGKGNYVVAKVNGVKMVLTSAELQQLLDNGYDVGICTPS* |
| (restricted) Ga0172364_104324511 | 3300013129 | Sediment | MSNVLGKGNYIIAKVNNVKMVLTSAELKQLMDNGYDVEIVG* |
| (restricted) Ga0172364_106827661 | 3300013129 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAELKQLMDNGYDVEIITSF* |
| (restricted) Ga0172364_109095071 | 3300013129 | Sediment | MSKVLGKGNYIVAKVNSVKMVLTSAELKQLLDNGYDVEVVVSS* |
| (restricted) Ga0172363_103923382 | 3300013130 | Sediment | MSYWDHVLGKGNYIVTKVNGVKMVLTSAELQQLLDNGYDVEICTPS* |
| (restricted) Ga0172363_107636892 | 3300013130 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS* |
| Ga0181527_11349302 | 3300014153 | Bog | MSYGKVLGKGGNYILAKVNGVKTVVSSSELQHLICDGYDVEVVTPF* |
| Ga0187849_100080141 | 3300017929 | Peatland | MSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG |
| Ga0187849_10901103 | 3300017929 | Peatland | MSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCDGYDVEVVSPT |
| Ga0187850_1000083026 | 3300017941 | Peatland | VSKVLGKGNYILAKVNGTKMVLTSTEMQQLINNGYDVEVVTPT |
| Ga0187780_101389792 | 3300017973 | Tropical Peatland | MSYGKSLLRGNFILAKVNGVKTVLSSGEMQRLICEGYDVEVVAPA |
| Ga0187891_12596531 | 3300017996 | Peatland | GNYILAKVNGVKTVLSSTELQNLIREGYDLEVVTPV |
| Ga0187865_11904272 | 3300018004 | Peatland | MSYPDKVLGRGNYIVAKVNGVKMTLTSVELQRLLCDGYDVEVTSS |
| Ga0187878_10040112 | 3300018005 | Peatland | MSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCHGYDAEVVLPT |
| Ga0187880_100042923 | 3300018016 | Peatland | MSYGKVLTKGNYILAKVNGVKMVLSSGELGQLICDGYDVEVVTST |
| Ga0187886_10034345 | 3300018018 | Peatland | MSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCHGYDVEVVSST |
| Ga0187886_10753011 | 3300018018 | Peatland | SPNLQRRPHEPMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG |
| Ga0187881_100347982 | 3300018024 | Peatland | MSYPDKVLGKGNYIVAKVNGAKMVLTSGEFQRLIDDGYDVEVVTSS |
| Ga0187881_102503102 | 3300018024 | Peatland | VSKVLGKGNFIVAKVGGVKQVLSSAELQRFQDAGYDVEVVTF |
| Ga0187771_105023323 | 3300018088 | Tropical Peatland | MSKVLTKGNYILAKVNGTKMVLSSAEMQQLIRDGYDVEVVTAT |
| Ga0187771_105531632 | 3300018088 | Tropical Peatland | MSKVLTKGNFILAKVNGIKMVLSSAEMQQLIRDGYDVEVVTAS |
| Ga0187771_114541861 | 3300018088 | Tropical Peatland | MSQVLGKGNYIVAKVNGFRQVLTSGEVKRLLHAGYDVEIIRAR |
| Ga0187771_118680131 | 3300018088 | Tropical Peatland | VSKVLTKGNYILAKVNGSKMVLSSAEMQQLIRDGYDVEV |
| Ga0187774_105853211 | 3300018089 | Tropical Peatland | MSKVLGKGNYILAKVNGTKMVLTSAEMQQLINNGYDVEVLTPT |
| Ga0224506_100038454 | 3300022221 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT |
| Ga0212089_1000100919 | 3300022551 | Lake Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIVG |
| Ga0209039_101411952 | 3300027825 | Bog Forest Soil | VSRVLTKGNYILAKVNGSKKVLTSTEIQQLINDGYDVEVVTAT |
| Ga0209039_101411962 | 3300027825 | Bog Forest Soil | VSRVLTKGNYILAKVNGSKKVLTSTEMQQLINDGYDVEVVTAA |
| Ga0272448_12008501 | 3300031463 | Sediment | VSKVLGKGNFIVARVNGVKTVLSSRELQMLLDNGEDVEVVSST |
| Ga0272448_12471492 | 3300031463 | Sediment | VSKVLGKGNYVVARVNGVKTVLSSAELQRLFDSGEDVEVVSPS |
| Ga0315280_1000246214 | 3300031862 | Sediment | MSYWGHVLGKGNYIVARVNSVKMVLTSAELQQLLDNGYDVEIVTPS |
| Ga0315280_1000296510 | 3300031862 | Sediment | MSKVVGKGNYIVARVNGTRMVLTSTELQKLIDDGYDVEVVG |
| Ga0315280_100048106 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVTST |
| Ga0315280_1000806517 | 3300031862 | Sediment | MSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT |
| Ga0315280_100088049 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQQLINDGYDVEVVTPS |
| Ga0315280_1001017710 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS |
| Ga0315280_100182284 | 3300031862 | Sediment | MSKVLVKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS |
| Ga0315280_100194376 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS |
| Ga0315280_100393893 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNCVKMVLTSAELKQLMDNGYDVEVVG |
| Ga0315280_100490764 | 3300031862 | Sediment | MSHVLGKGNYIVAKVNGVKMVLTSAELQQLINNGYDVEVVTPS |
| Ga0315280_100512404 | 3300031862 | Sediment | MSYWGHVLGKGNYIVARVNGVKMVLTSAELQQLLDNGYDVEMVTPS |
| Ga0315280_100891763 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNNVKMVLTSAELKQLMDNGYDVEVVTSS |
| Ga0315280_100903004 | 3300031862 | Sediment | MSKVLGKGNYIIAKVNNVKMVLTSTELKQLMDNGYDVEIVG |
| Ga0315280_100914714 | 3300031862 | Sediment | MSKVLTKGNYILAKVNGSKKVLTSTEMQQLINNGYDVEVLTPT |
| Ga0315280_101420431 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGCDVEVVTPS |
| Ga0315280_101591662 | 3300031862 | Sediment | MSYWGHVLGKGNFIVARVNSVKMVLTSAELKQLLDNGYDVEVVVSS |
| Ga0315280_101641122 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNGAKMVLTSAELKQLMDNGYDVEIVG |
| Ga0315280_101762152 | 3300031862 | Sediment | MSYWGHVLGKGNYIVAKVNGAKMVLTSAELQQLLDNGYDVEVLTSS |
| Ga0315280_101875433 | 3300031862 | Sediment | LGKGNYIVAKVNGVKQVLTSAEMQRLVNDGCDVEVVTPS |
| Ga0315280_102088132 | 3300031862 | Sediment | MSHVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPT |
| Ga0315280_102200492 | 3300031862 | Sediment | MSKVLGKGNYIVAKVNSTKMVLTNAELKQLMDNGYDVEIVSS |
| Ga0315280_103485581 | 3300031862 | Sediment | MSRVLGKGNYIVARVNATRMVLTSTELQKLIDDGYDVEVVG |
| Ga0315280_103760122 | 3300031862 | Sediment | MSKVLGKGNYIVARVNGTKMVLTSAELKQLMDNGYDVEVIASS |
| Ga0315280_103878372 | 3300031862 | Sediment | MSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLDNGYDVEILTSS |
| Ga0315280_104192351 | 3300031862 | Sediment | MSKVLGKGNYVVAKVNSVKMVLTSAELQKLIDDGYDVEVVG |
| Ga0315280_104194741 | 3300031862 | Sediment | QSMSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT |
| Ga0315296_1000023827 | 3300032020 | Sediment | MSKVLGKGNYIVAKVNNVKMVLTSAELKQLMDNGYDVEVVG |
| Ga0315296_102175424 | 3300032020 | Sediment | MSKVLGKGNYIVAKVNNVKMVLTSAEFKQLMDNGYDVEVVTSS |
| Ga0315296_103289513 | 3300032020 | Sediment | MSYWGHVLGKGNYIVAKVNGAKMVLTSAELKQLLDNGYDVEVLTSS |
| Ga0315296_103499622 | 3300032020 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVTPS |
| Ga0315282_100186426 | 3300032069 | Sediment | MSKVLGEGNYIVARVNGTRMILTSTELQKLIDDGYDVEVVG |
| Ga0315282_100447495 | 3300032069 | Sediment | MSKVLGKGNYVVAKVNSVKQVLTSTELQKLIDDGYDVEVVG |
| Ga0315282_100715462 | 3300032069 | Sediment | MSKVVGKGNYIVAKVNSVKMVLTSAELQKLIDDGYDVEVVTSS |
| Ga0315282_100773383 | 3300032069 | Sediment | MSHVLGKGNYIVAKVNNVKMVLTSAELQQLMDNGYDVEIVASS |
| Ga0315282_101211872 | 3300032069 | Sediment | MSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLDNGYDVEIITSS |
| Ga0315282_101341822 | 3300032069 | Sediment | MSKVLGKGNFVVARVNGTRTVLSSSELQRLLDDGEDVEVVSPS |
| Ga0315282_101508544 | 3300032069 | Sediment | MSKVLGKGNFVVARVNGVKTVLSSAELQRLLDDGEDVEVVSPS |
| Ga0315282_101527153 | 3300032069 | Sediment | VSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT |
| Ga0315282_101544052 | 3300032069 | Sediment | MSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVMST |
| Ga0315282_103540781 | 3300032069 | Sediment | VSKVLGKGNFVVARVNGVKTVLSSAELQRLFDSGEDVEVVSPS |
| Ga0315282_104243143 | 3300032069 | Sediment | QSLSKGNYIVAKVNSTKMVLTSAELKQLMDNGYDVEIVSS |
| Ga0315282_105801362 | 3300032069 | Sediment | MSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLD |
| Ga0315279_1000073972 | 3300032070 | Sediment | LSKVLGKGNYIVAKVNGAKTVLTSAEFQQLLDNGYDVEVISSF |
| Ga0315279_1000195227 | 3300032070 | Sediment | MSKVLGKGNYIVAKVNNVKQVLTSAELKQLLDNGYDVEVITPS |
| Ga0315279_1000416626 | 3300032070 | Sediment | MSKVLGKGNYIVARVNGARQVLTSAELQRLIDAGYDVEIVTAF |
| Ga0315277_100253213 | 3300032118 | Sediment | VSKVLGKGNYILAKVNGTKMVLTSAEMQQLINNGYDVEVLTPT |
| Ga0315277_100313454 | 3300032118 | Sediment | VSKVLGKGNYILAKVNGVKMVLKSTEMQQLINDGYDVEVITPT |
| Ga0315268_101291674 | 3300032173 | Sediment | MSKVLGEGNYIVAKVNSVRMVLTSAELQKLIDDGYDVEVVTSS |
| Ga0315268_105622532 | 3300032173 | Sediment | VSKVLGKGNFVVARVYGVKTVLSSAELQRLFDSGEDVEVVSPS |
| Ga0315268_107684272 | 3300032173 | Sediment | MSYPDKVLGRGNYIVAKVNGAKMTLTSAELQRLLDCGCDVEVVTSS |
| Ga0315268_108482791 | 3300032173 | Sediment | MSYPDKVMGKGNYIVAKVNGVKMTLTSAELGRLLCDGYDVEVVSPT |
| Ga0315268_110208242 | 3300032173 | Sediment | MSKIVGKGNYIVAKVNSVKQVLTSAELQKLIDDGYDVEVVG |
| Ga0335070_100440822 | 3300032829 | Soil | MSKNLNDGNYLLAKVNGTKKVLTSTEMQQLINDGYDVEVVTAS |
| Ga0335070_118847501 | 3300032829 | Soil | MSRILGKGNYVLAKVNGTKMILTDRELQQLINNGYDVEVVTAT |
| Ga0334965_0064820_48_179 | 3300033991 | Sediment | MSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF |
| ⦗Top⦘ |