Basic Information | |
---|---|
Family ID | F076422 |
Family Type | Metagenome |
Number of Sequences | 118 |
Average Sequence Length | 41 residues |
Representative Sequence | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAAT |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.27 % |
% of genes near scaffold ends (potentially truncated) | 93.22 % |
% of genes from short scaffolds (< 2000 bps) | 88.14 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (71.186 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.424 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.729 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.831 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF02899 | Phage_int_SAM_1 | 21.19 |
PF13649 | Methyltransf_25 | 4.24 |
PF00296 | Bac_luciferase | 2.54 |
PF00196 | GerE | 1.69 |
PF08281 | Sigma70_r4_2 | 1.69 |
PF00440 | TetR_N | 1.69 |
PF00436 | SSB | 1.69 |
PF16859 | TetR_C_11 | 1.69 |
PF08044 | DUF1707 | 1.69 |
PF13231 | PMT_2 | 0.85 |
PF12697 | Abhydrolase_6 | 0.85 |
PF02518 | HATPase_c | 0.85 |
PF11716 | MDMPI_N | 0.85 |
PF13424 | TPR_12 | 0.85 |
PF13520 | AA_permease_2 | 0.85 |
PF00355 | Rieske | 0.85 |
PF00005 | ABC_tran | 0.85 |
PF00589 | Phage_integrase | 0.85 |
PF13397 | RbpA | 0.85 |
PF08751 | TrwC | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 21.19 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 21.19 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.54 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.69 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 71.19 % |
All Organisms | root | All Organisms | 28.81 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.32% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.47% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.39% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
NODE_03146482 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MLQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHA |
JGI20235J16296_10103472 | 3300001632 | Forest Soil | MPQPVLRRAAHRVAQFAILAAAILVVLLVFSRQAHAATPPATA |
Ga0062384_1000772701 | 3300004082 | Bog Forest Soil | VSQPMVHHLARRAVQVALLAAGIVTILLVFSRQAQAATSPLPV |
Ga0066702_108210621 | 3300005575 | Soil | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHAATSPTSPPAPSAPAPS |
Ga0068856_1006017192 | 3300005614 | Corn Rhizosphere | MPQPILRYIARRAMQVAIAAAGILVVLLVFSRQAHAATSAPSATP |
Ga0068864_1014180991 | 3300005618 | Switchgrass Rhizosphere | MPQPILRYIARRAMQVAIAAAGILVVLLVFSRQAH |
Ga0070766_102231823 | 3300005921 | Soil | VPQLILRRIAYRAVQVAILAAGILTVLLVFSRQADAATS |
Ga0070766_110916851 | 3300005921 | Soil | VPQLIARRIAHRAMQFALLAAGILTILLVFSRQADAATATPAAASPA |
Ga0070717_100206829 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHA |
Ga0070717_102104222 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPIARHIARRAIQVAILAAGILAVLLVFSRQAHAATIPDPSTVT |
Ga0070717_109108331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPIARRIARRAIQVAILAAGILAVLLVFSRQAHAATIPDP |
Ga0070717_114871152 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILAVLLVFSRQAHAATLSPSAAP |
Ga0070716_1005185771 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAATSPTSPPAPSAP |
Ga0070716_1016342692 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPIARHIARRAIQVAILAAGILAVLLVFSRQAHAA |
Ga0070712_1000925673 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAATS |
Ga0070712_1005786331 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPIVRLVARRAMQVAIAAAGILVVLLVFSRHANAATKPTTRPA |
Ga0070712_1009498701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRYIARRAMQVAIAAAGILVVLLVFSRQAHAA |
Ga0070712_1013763122 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHA |
Ga0079221_115386621 | 3300006804 | Agricultural Soil | MPPIARLVARRAMQVAIAAAGILVVLLVFSRHANAATKP |
Ga0079220_106428991 | 3300006806 | Agricultural Soil | MPQPILRHIARRAVQVAIAAAGILIVLLVFSRQAHAATLA |
Ga0079220_112718001 | 3300006806 | Agricultural Soil | MPQPILRHVARRAVQVAIVAAGILVVLLVFSRQAHAAT |
Ga0105245_109141171 | 3300009098 | Miscanthus Rhizosphere | MPQPILRHIARRAVQVAIAAAGILAVLLVFSRQAHAATLSPSAAPAPS |
Ga0099792_105182062 | 3300009143 | Vadose Zone Soil | MPQPILRHIARRAMQVAIVAAGILVVLLVFSRQAHAATSP |
Ga0116220_102718712 | 3300009525 | Peatlands Soil | MPQPILRHIARRAVQVAIAAAGILIVLLVFSRQANAATSTPSDSA |
Ga0126373_131501521 | 3300010048 | Tropical Forest Soil | MMRELLMLQPIVRHVARRAVQVAIVAAGILVILLVFSRQA |
Ga0134084_104184211 | 3300010322 | Grasslands Soil | MPQPILRHIARRAVQVAIVAAGIMLALLVFSRQAHAATSPASPPAPSAPAPA |
Ga0074044_110212111 | 3300010343 | Bog Forest Soil | MPQLMLRRIAHRAVQVAILAAGIMFVLLVFSQQAHAATLPPPTVPS |
Ga0126381_1045442741 | 3300010376 | Tropical Forest Soil | MPQPIARRIAHRAVQLAIVAAGIFVIMLVFSHQAHAATDPPANSAAL |
Ga0137365_106324031 | 3300012201 | Vadose Zone Soil | MTQPIARRIALRAVQLAIVAAGIFVIMLLFSRQAHAATT |
Ga0137399_116845242 | 3300012203 | Vadose Zone Soil | MPQPILRHIACRAVQVAILAAGILTILLVFSRQAHAATSAPA |
Ga0137370_106413771 | 3300012285 | Vadose Zone Soil | MPQPILRHIARRAVQVAIVAAGIMVALLVFSRQAHAAI |
Ga0137384_106683013 | 3300012357 | Vadose Zone Soil | VSQPMLRHIARRAAQVAILTVGIVAVLLGLSRQAHAADSPT |
Ga0137413_101037191 | 3300012924 | Vadose Zone Soil | MLVSQPMLRHIARRAVQVVILAAGILMLFLVFSKQARAATSPSAVTSAPASAPA |
Ga0164308_122262612 | 3300012985 | Soil | MPQPIMRLIARRAMQVAIAAAGILVVLLVFSRQAHAATKPPASLASSGSS |
Ga0157374_110833731 | 3300013296 | Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHASTLAPSATPTPSA |
Ga0157374_118605182 | 3300013296 | Miscanthus Rhizosphere | MPQPIVRRIARRAMQVAIAAAGILIVFLVFSRQAHADTKPATSLAGSGS |
Ga0157375_128746262 | 3300013308 | Miscanthus Rhizosphere | MSQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHASTLAP |
Ga0163163_103054103 | 3300014325 | Switchgrass Rhizosphere | MPQPIMRLIARRAMQVAIAAAGILVVLLVFSRQAHA |
Ga0157380_116168261 | 3300014326 | Switchgrass Rhizosphere | MPQPILRHIARRAVQVAIAAAGILAVLLVFSRQAHAATL |
Ga0157379_103595412 | 3300014968 | Switchgrass Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAH |
Ga0137403_113645142 | 3300015264 | Vadose Zone Soil | MPQPILRHIARRAMQVAIVAAGILVVLLVFSRQAHAATSPTSPPAPS |
Ga0182032_115628842 | 3300016357 | Soil | MPQPILRCIALRAVQLAIAAAGIFVIMLLFSRQAHAATSDTL |
Ga0182039_116825991 | 3300016422 | Soil | MPQPMMVRRIALRAVQVAIVAAGLFFVFLVFSRQANAATL |
Ga0187818_100773883 | 3300017823 | Freshwater Sediment | MTAQPIVRRIALRAVQLAIVAAGIFFIMLVFSRQAHAATT |
Ga0187814_103523512 | 3300017932 | Freshwater Sediment | MPQPIARRTAHRAVQLAILAAGIFVIMLVFSRQAHAAT |
Ga0187783_107551211 | 3300017970 | Tropical Peatland | VPQPVLRRIARRAVQVAILAVGILAVLLSFSRQAHAASLPTST |
Ga0187783_111844951 | 3300017970 | Tropical Peatland | MSQPILRHITRRAMQVAILAFGILAVLLVFSRQAHAATPAPSTATLT |
Ga0066669_108929332 | 3300018482 | Grasslands Soil | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHAATSPTSPPAPSAP |
Ga0193729_10955921 | 3300019887 | Soil | MPQPILRHIARRAVQGAILAAGILIILLAFSRQADA |
Ga0179594_103132192 | 3300020170 | Vadose Zone Soil | MPQPVLRHIARRAVQGAILAAGILIVLLVFSRQANA |
Ga0210405_103701881 | 3300021171 | Soil | MPQPILRHIARRAVQVAIVAAGILAVLLVFSRQAHAA |
Ga0210397_109528621 | 3300021403 | Soil | MPQPIVRRIAHRAVQLAILAAGIFFVMLVFSRQAH |
Ga0210386_100328055 | 3300021406 | Soil | MPQPIVRLIARRAVQVAIVAAGIMVALLAFSRQAHAATAPPAATGPLTPATGP |
Ga0210384_102491222 | 3300021432 | Soil | MPQPILRHIARRAVQVAIVAAGILAVLLVFSRQAHAATSPTSPPAP |
Ga0210390_103827362 | 3300021474 | Soil | VPQLILRRIAYRAVQVAILAAGILTVLLVFSRQADAATSAP |
Ga0207663_113241972 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQPILRYIARRAMQVAIAAAGILVVLLVFSRQAHAAT |
Ga0207664_118605993 | 3300025929 | Agricultural Soil | MPQPIARRIAQRAVQLAILAAGIFFIMLVFSRQAHAA |
Ga0207691_104450012 | 3300025940 | Miscanthus Rhizosphere | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAST |
Ga0209267_13153091 | 3300026331 | Soil | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHAATSPTS |
Ga0209057_11222482 | 3300026342 | Soil | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHAATSPTSPPAPSAPA |
Ga0209161_103239762 | 3300026548 | Soil | MPQPILRHIARRAVQVAIVAAGILVVLLVFSRQAHAATSPTSPP |
Ga0208238_10000254 | 3300027072 | Forest Soil | MPQPVLRRAAHRMAQFAILAAAILVVLLVFSRQAHAATPPA |
Ga0208099_10014351 | 3300027096 | Forest Soil | MAQPIVRLIARRAVQVAIVAAGIMVALLVFSRQAHAA |
Ga0207948_10377812 | 3300027174 | Forest Soil | VPQLILRRIAYRAVQVAILAAGILTILLVFSRQADAATSAPV |
Ga0209115_10763282 | 3300027567 | Forest Soil | MPQLALRRAARRAAQCAMLAAGILVVLLVFSRQAHASTAPTTATTSGSA |
Ga0209038_101765272 | 3300027737 | Bog Forest Soil | MPQPILRHIARRAVQVAITAAGILIVLLAFSRQARAATLPAIGS |
Ga0209073_104511731 | 3300027765 | Agricultural Soil | MPQPILRHIARRAVQGVILAAGILIILLAFSRQADAATSAPSGSVPSAAAS |
Ga0209655_102458382 | 3300027767 | Bog Forest Soil | MPQPILRHIARRAVQVAITAAGILVVLLAFSRQARAATVPAI |
Ga0209274_105929031 | 3300027853 | Soil | MPQPILRHIARRAVQVAITAAGILIVLLAFSRQARAATLPAI |
Ga0209579_107348282 | 3300027869 | Surface Soil | MPQPIARRIARRAIQVAILAAGILAVLLVFSRQAHA |
Ga0209275_103481132 | 3300027884 | Soil | MPQLILRRIARRAVQVAILAAGILAILLVFSRQAHAATSA |
Ga0209624_106925092 | 3300027895 | Forest Soil | MPQLALRRAARRAAQCAMLAAGILVVLLVFSRQAH |
Ga0302225_101897231 | 3300028780 | Palsa | VPQSILRPIAHRAVQAAILAAGILTILLVFSRQAD |
Ga0302223_102126121 | 3300028781 | Palsa | MPQLIARRIAHRAMQTAILAAGILAILLVSSRQAHAATSPPAAAPPG |
Ga0302232_105487692 | 3300028789 | Palsa | VSQATLRHIARRAVQVAIVAAGILAVLLVFSRQAHAAALPS |
Ga0302226_101154412 | 3300028801 | Palsa | VSQAILRHIARRAVQVAILAAGILALLLVFSRQAHAA |
Ga0302226_102347941 | 3300028801 | Palsa | MPQLIARIARRAMQTAILAAGILAILLVSSRQAHAA |
Ga0302235_103558491 | 3300028877 | Palsa | MEWELLVSQAILRHIARRAVQVAILAAGILAVLLV |
Ga0311340_110962751 | 3300029943 | Palsa | MEWELLVSQAILRHIARRAVQVAILAAGILAVLLVFSRQAH |
Ga0302178_102175081 | 3300030013 | Palsa | MPQSILRRIAHRAVQVAILAAGILTIFLVFSRQADAATSAPVVAPLVS |
Ga0311356_100454391 | 3300030617 | Palsa | MPQLIARRIAHRAMQTAILAAGILAILLVSSRQAHAATS |
Ga0302311_110624271 | 3300030739 | Palsa | MPQLIARRIAHRAMQTAILAAGILAILLVSSRQAHAATSPPAAA |
Ga0318573_103494731 | 3300031564 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAP |
Ga0318574_104052251 | 3300031680 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAPS |
Ga0318572_106773641 | 3300031681 | Soil | MLQPVLRHVARRAVQVAILAAGILVILLVFSRQAHAATSPGTS |
Ga0318572_107706702 | 3300031681 | Soil | MPQPILRCIALRAVQLAIAAAGIFVIMLLFSRQAH |
Ga0310686_1188559901 | 3300031708 | Soil | MPQPVLRLIARRAVQVAIVAAGIMVVLLVSSRQAHA |
Ga0318492_107478711 | 3300031748 | Soil | MLQPVLRHVARRAVQVAILAAGILVILLVFSRQAHAATSPGTSPVASVA |
Ga0318494_105849741 | 3300031751 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLA |
Ga0318494_107179641 | 3300031751 | Soil | MPQPILGHIARRAVQLGIVAAGILVLLLVFARQAHAATSGTATPGTP |
Ga0307477_103090631 | 3300031753 | Hardwood Forest Soil | MPQPILRHIARRAVQVAIAAAGILVVLLVFSRQAHAATSPTT |
Ga0318554_104540362 | 3300031765 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAPSAAPAPSV |
Ga0318529_103236012 | 3300031792 | Soil | MSQPIVRRVALRAVQLAILAAGIFVIMLLFSRQAHAATSDTP |
Ga0318503_101302002 | 3300031794 | Soil | MSQPIVRRIALRAVQLAIAAAGIFVIMLLFSRQAHAATSDTLP |
Ga0318557_100856823 | 3300031795 | Soil | VFQLRLRHIARRAMQVAILAVGILAVLLGLSRQAHAA |
Ga0318523_103550752 | 3300031798 | Soil | VPQPRLRHIARRAVQVAILAVGVLAVLLGLSRQAHAA |
Ga0318523_105586052 | 3300031798 | Soil | MLQPVLRYVARRAVQVAILAAGILVILLVFSRQAHAATSPGTSPVASVA |
Ga0318568_103005382 | 3300031819 | Soil | MPQPILRCIALRAVQLAIAAAGIFVIMLLFSRQAHAATSD |
Ga0318567_103423452 | 3300031821 | Soil | MSQPIVRRIALRAVQLAIAAAGIFVIMLLFSRQAHAATSD |
Ga0318551_107531511 | 3300031896 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAPSAAP |
Ga0318520_106803762 | 3300031897 | Soil | MPQLISRRIARRAVQVAMLAVGILIILLAFTRQAHAAISATPSP |
Ga0308174_112880952 | 3300031939 | Soil | MPQPIMRLIARRAMQVAIAAAGILIVMLVFSRHANAATK |
Ga0306926_129983152 | 3300031954 | Soil | MPQPILRRIALRAVQLAIVAAGIFVLMLLFSRQAHAAT |
Ga0318530_101239612 | 3300031959 | Soil | MPQPILRCIALRAVQLAIAAAGIFVIMLLFSRQAHAATSDTLPS |
Ga0318562_107917192 | 3300032008 | Soil | MPQSILRHIARRAMQVAIAAAGILVILLVFSRQAQAA |
Ga0318556_101632322 | 3300032043 | Soil | VLQPRLRHIARRAVQAAILAVGILVVLLGLSRQAHAAS |
Ga0318558_100592833 | 3300032044 | Soil | MPQPILRCIALRAVQLAIAAAGIFVIMLLFSRQAHAA |
Ga0318504_101895041 | 3300032063 | Soil | MSQPIVRRIALRAVQLAIVAAGMFVIMLLFSRQAHAA |
Ga0318524_106098101 | 3300032067 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAPSADPPTTSTTA |
Ga0318553_103936102 | 3300032068 | Soil | MPQPIMRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAPSAAPA |
Ga0318553_105698091 | 3300032068 | Soil | MLQPVLRHVARRAVQVAILAAGILVILLVFSRQAHAA |
Ga0307472_1026930792 | 3300032205 | Hardwood Forest Soil | MPQPILRHVARRAVQVAIVAAGILIVLLAFSRQAHAATSPTSPPAPSAPAPS |
Ga0335080_106995112 | 3300032828 | Soil | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAATLAP |
Ga0335074_100159459 | 3300032895 | Soil | MPQTIAGRIALRAVQLAVVAAGIFLVMLVFSRQAHAA |
Ga0335074_114926131 | 3300032895 | Soil | MPQPIARRIALRAMQLAIVAAGIFFVMMLFSRQAH |
Ga0335074_115493261 | 3300032895 | Soil | MPQLALRRAARRAAQCAMLAAGILVVLLVFSRQAHASTA |
Ga0335072_114737422 | 3300032898 | Soil | MPQPIVRRIAHRAVQLAIAAAGIFVIMLVFSHQARAATDPPPPSGPADS |
Ga0335077_109149102 | 3300033158 | Soil | MPQPILRHIARRAMQVAIAAAGILVVLLVFSRQAHAAT |
⦗Top⦘ |