Metagenome Family F076402

Basic Information
Family ID	F076402
Family Type	Metagenome
Number of Sequences	118
Average Sequence Length	45 residues
Representative Sequence	PRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF
Number of Associated Samples	99
Number of Associated Scaffolds	118

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.85 %
% of genes near scaffold ends (potentially truncated)	97.46 %
% of genes from short scaffolds (< 2000 bps)	96.61 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Bacteria (91.525 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (14.407 % of family members)
Environment Ontology (ENVO)	Unclassified (50.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (69.492 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 30.43% Coil/Unstructured: 69.57%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF01406	tRNA-synt_1e	82.20
PF09190	DALR_2	5.93
PF07589	PEP-CTERM	2.54
PF00186	DHFR_1	0.85
PF01532	Glyco_hydro_47	0.85
PF02769	AIRS_C	0.85
PF14534	DUF4440	0.85
PF00410	Ribosomal_S8	0.85
PF03734	YkuD	0.85

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG0215	Cysteinyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	88.14
COG0018	Arginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	82.20
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	82.20
COG0096	Ribosomal protein S8	Translation, ribosomal structure and biogenesis [J]	0.85
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.85
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.85
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.85

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	11.02 %
Unclassified	root	N/A	8.47 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.69 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	3.39 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.69 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.69 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.85 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	3.39 %
unclassified Firmicutes sensu stricto	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto	1.69 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.85 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	3.39 %
Firmicutes bacterium ADurb.Bin506	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506	1.69 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.85 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	2.54 %
Firmicutes bacterium ADurb.Bin506	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506	1.69 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.85 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	0.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.85 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	2.54 %
Firmicutes bacterium ADurb.Bin506	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506	1.69 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	0.85 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.85 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908027\|MRS2a_Contig_25711	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
2162886007\|SwRhRL2b_contig_41164	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
2162886007\|SwRhRL2b_contig_79886	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
2170459009\|GA8DASG02HQSUW	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300000955\|JGI1027J12803_108611769	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300000956\|JGI10216J12902_115701257	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300002568\|C688J35102_118114442	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300003999\|Ga0055469_10322491	Not Available	502	Open in IMG/M
3300004114\|Ga0062593_102781534	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300004156\|Ga0062589_100419367	All Organisms → cellular organisms → Bacteria → Acidobacteria	1095	Open in IMG/M
3300004156\|Ga0062589_101762667	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300004156\|Ga0062589_101996394	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300004157\|Ga0062590_100706988	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300004157\|Ga0062590_100938944	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300004157\|Ga0062590_102679677	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300004479\|Ga0062595_101734536	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300005294\|Ga0065705_10795426	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300005331\|Ga0070670_101515226	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300005334\|Ga0068869_100354334	All Organisms → cellular organisms → Bacteria → Acidobacteria	1197	Open in IMG/M
3300005336\|Ga0070680_101163183	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300005338\|Ga0068868_101944448	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300005345\|Ga0070692_10083826	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1722	Open in IMG/M
3300005345\|Ga0070692_10413362	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300005355\|Ga0070671_100042968	All Organisms → cellular organisms → Bacteria	3758	Open in IMG/M
3300005367\|Ga0070667_100670605	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300005440\|Ga0070705_100102296	All Organisms → cellular organisms → Bacteria	1812	Open in IMG/M
3300005440\|Ga0070705_100777192	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	760	Open in IMG/M
3300005444\|Ga0070694_101313332	All Organisms → cellular organisms → Bacteria → Acidobacteria	609	Open in IMG/M
3300005455\|Ga0070663_100722420	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300005466\|Ga0070685_10588364	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300005468\|Ga0070707_100230715	Not Available	1802	Open in IMG/M
3300005545\|Ga0070695_101046292	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300005547\|Ga0070693_100787951	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300005577\|Ga0068857_100213677	Not Available	1760	Open in IMG/M
3300005578\|Ga0068854_100202030	All Organisms → cellular organisms → Bacteria	1563	Open in IMG/M
3300005615\|Ga0070702_100478410	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300005618\|Ga0068864_100626839	Not Available	1045	Open in IMG/M
3300005618\|Ga0068864_102391743	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300005719\|Ga0068861_101124064	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300005841\|Ga0068863_101070300	All Organisms → cellular organisms → Bacteria → Acidobacteria	810	Open in IMG/M
3300005843\|Ga0068860_101626213	Not Available	668	Open in IMG/M
3300005843\|Ga0068860_102636114	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300005844\|Ga0068862_101590908	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005844\|Ga0068862_101685104	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	642	Open in IMG/M
3300005884\|Ga0075291_1009076	Not Available	1097	Open in IMG/M
3300005985\|Ga0081539_10088580	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300006173\|Ga0070716_101146914	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300006755\|Ga0079222_10501617	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300006844\|Ga0075428_100106966	All Organisms → cellular organisms → Bacteria	3049	Open in IMG/M
3300006844\|Ga0075428_102174012	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300006852\|Ga0075433_10805517	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300006854\|Ga0075425_100030853	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5945	Open in IMG/M
3300006880\|Ga0075429_100897386	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300006904\|Ga0075424_101469455	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300006954\|Ga0079219_10413008	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300009098\|Ga0105245_10935943	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300009148\|Ga0105243_10064766	All Organisms → cellular organisms → Bacteria	2934	Open in IMG/M
3300009176\|Ga0105242_11642003	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300009553\|Ga0105249_13117203	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300010397\|Ga0134124_11087988	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	815	Open in IMG/M
3300010399\|Ga0134127_13703241	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300010401\|Ga0134121_13103647	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300010403\|Ga0134123_11213259	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300013100\|Ga0157373_11204534	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300013296\|Ga0157374_11039589	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300013297\|Ga0157378_11081793	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300013307\|Ga0157372_10770066	Not Available	1119	Open in IMG/M
3300013308\|Ga0157375_11884362	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300013308\|Ga0157375_11956739	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300013308\|Ga0157375_12823631	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300013500\|Ga0120195_1002537	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300013760\|Ga0120188_1057169	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300014326\|Ga0157380_12880563	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300015371\|Ga0132258_13799413	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300015374\|Ga0132255_100916124	All Organisms → cellular organisms → Bacteria	1311	Open in IMG/M
3300018072\|Ga0184635_10078613	Not Available	1292	Open in IMG/M
3300018073\|Ga0184624_10088173	All Organisms → cellular organisms → Bacteria → Acidobacteria	1314	Open in IMG/M
3300018466\|Ga0190268_12317475	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300019361\|Ga0173482_10502180	All Organisms → cellular organisms → Bacteria → Acidobacteria	589	Open in IMG/M
3300021445\|Ga0182009_10653887	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300025315\|Ga0207697_10561050	Not Available	502	Open in IMG/M
3300025735\|Ga0207713_1238315	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300025792\|Ga0210143_1106291	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300025900\|Ga0207710_10516579	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300025911\|Ga0207654_10778025	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300025918\|Ga0207662_10339162	Not Available	1007	Open in IMG/M
3300025920\|Ga0207649_10720689	All Organisms → cellular organisms → Bacteria	774	Open in IMG/M
3300025932\|Ga0207690_10605508	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300025933\|Ga0207706_11272815	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300025934\|Ga0207686_10678030	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	818	Open in IMG/M
3300025934\|Ga0207686_11420226	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300025939\|Ga0207665_11332421	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300025972\|Ga0207668_11165208	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300025981\|Ga0207640_11946170	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300025986\|Ga0207658_11128940	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300026023\|Ga0207677_10300761	All Organisms → cellular organisms → Bacteria	1325	Open in IMG/M
3300026041\|Ga0207639_11999003	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300026067\|Ga0207678_10767658	All Organisms → cellular organisms → Bacteria	850	Open in IMG/M
3300026088\|Ga0207641_10727707	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300026088\|Ga0207641_10887207	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300026095\|Ga0207676_11413290	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300026095\|Ga0207676_11745989	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300026095\|Ga0207676_12026983	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300026116\|Ga0207674_11412651	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300026118\|Ga0207675_100977971	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300027775\|Ga0209177_10334553	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300028380\|Ga0268265_11377420	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300028380\|Ga0268265_11556676	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300028381\|Ga0268264_12625755	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300030499\|Ga0268259_10156614	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300031547\|Ga0310887_10164447	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	1176	Open in IMG/M
3300031548\|Ga0307408_100534326	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300031548\|Ga0307408_101704583	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300031911\|Ga0307412_10250514	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506	1375	Open in IMG/M
3300031939\|Ga0308174_10855714	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300032002\|Ga0307416_103626567	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300032005\|Ga0307411_10411273	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506	1121	Open in IMG/M
3300032122\|Ga0310895_10424170	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	656	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	60.17%
Environmental	Environmental	39.83%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	60.17%
Terrestrial	Environmental → Terrestrial	36.44%
Aquatic	Environmental → Aquatic	3.39%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	36.44%
Rhizosphere	Host-Associated → Plants → Rhizosphere	32.20%
Rhizoplane	Host-Associated → Plants → Rhizoplane	27.12%
Marine	Environmental → Aquatic → Marine	1.69%
Sediment	Environmental → Aquatic → Sediment	1.69%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.73%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	22.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	22.88%
Loam	Environmental → Terrestrial → Soil → Loam	12.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.47%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.24%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.69%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.85%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	22.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.86%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.32%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	8.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.47%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.24%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.54%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.54%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.69%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.85%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	14.41%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	6.78%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.24%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.39%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.54%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.69%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.69%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.69%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	1.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.85%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.85%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated	Open in IMG/M
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
2170459009	Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003999	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005884	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013500	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2	Environmental	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300030499	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)	Host-Associated	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MRS2a_00569220	2124908027	Miscanthus Rhizosphere	VDGVEVKRIGTIRSASEGVKISEGARTWELKPGGWMHF
SwRhRL2b_0106.00000020	2162886007	Switchgrass Rhizosphere	VKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF
SwRhRL2b_0040.00005650	2162886007	Switchgrass Rhizosphere	GFKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF
F47_12086140	2170459009	Grass Soil	LFTVRPDAVAKLPRRVDGVGITHIGEIRDASEGVKISEGTRVWELQPGGWKHF
JGI1027J12803_1086117692	3300000955	Soil	AVPKLPRRVDGVPITRIGKILELSEGVKISEGARVWELAPGGWKHF*
JGI10216J12902_1157012573	3300000956	Soil	EVAAQLPRRVDGVAITLVGEIRERSHGVKISEGTRIWELRPGGWEHFA*
C688J35102_1181144421	3300002568	Soil	NAARLPKRVDGVEIKRIGEITAASENVKISEGTRTWDLKPGGWKHF*
Ga0055469_103224912	3300003999	Natural And Restored Wetlands	LPKRVDGVGLTRIGEIRTAQQTVKISEGSRVWDLAPGGWKHF*
Ga0062593_1027815341	3300004114	Soil	SVGRLPRKVDGVGITRIGEVTKETDGVKISEGSRIWELNPGGWKHF*
Ga0062589_1004193672	3300004156	Soil	DFELLFTVKLGGALPRKVDRTQITRIGEIRDLDDGVRISEGTRIWELNPGGWKHF*
Ga0062589_1017626672	3300004156	Soil	RPDAVSRLPRRVDGVGVTHIGEVLELTDGVKISEGSRTWELTPGGWKHF*
Ga0062589_1019963941	3300004156	Soil	AAKLPRRVDGVEIKRIGTIQNASDGVKICEGPRTWELKPGGWKHF*
Ga0062590_1007069882	3300004157	Soil	RVDGVEIRRIGEVRNREDGVQISEGSRVWELHPGGWKHF*
Ga0062590_1009389441	3300004157	Soil	KPADLARLPRRVDGVEIKRIGEVTKSIEGVKISEGSRIWDLKPGGWKHF*
Ga0062590_1026796771	3300004157	Soil	RRVDGVELTRIGKVKEEVDGVKISEGSRVWELNPGGWKHF*
Ga0062595_1017345361	3300004479	Soil	LLFTVKPNDVPRLPKRVDGVGITPIGEVRPVSEGVKISEGTRVWELTPKGWKHF*
Ga0065705_107954262	3300005294	Switchgrass Rhizosphere	LPRRVDGVEIKRIGTIQSASEGVMISEGSRSWELAPGGWKHF*
Ga0070670_1015152261	3300005331	Switchgrass Rhizosphere	RRVDGVELKRIGEITDLAHGVKISEGSRIWELKPGGWKHF*
Ga0068869_1003543342	3300005334	Miscanthus Rhizosphere	PRRVDGTPITRIGEIRTQHEGVKISERSRTWELNPGGWKHF*
Ga0070680_1011631832	3300005336	Corn Rhizosphere	ANNVSRLPRRVDGFSITRVGEIRNAADGIKISEGSRVWELSAGGWRHF*
Ga0068868_1019444482	3300005338	Miscanthus Rhizosphere	TVRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0070692_100838261	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	LPRKVDGVGIKRIGQITAAFEGVKISEGARIWELQPGGWKHF*
Ga0070692_104133622	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	VKPEHVARLPRRVDGVEITRIGQITDASQGIKISEGTRTWDLKPAGWKHF*
Ga0070671_1000429681	3300005355	Switchgrass Rhizosphere	AVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0070667_1006706051	3300005367	Switchgrass Rhizosphere	FTVSPDAISKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF*
Ga0070705_1001022961	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	DAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0070705_1007771921	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	PGDANRLPRKVDGVGIKRIGQITAAFEGVKISEGARIWELQPGGWKHF*
Ga0070694_1013133322	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	TVTPENAARLPRRVDGVEIKRIGEVTSANDGVKISEGTRIWDLKPGGWKHF*
Ga0070663_1007224201	3300005455	Corn Rhizosphere	TVKPENVRRLPRRVDGVGITFIGEIRPAAEGINLREGSRVWELKPEGWEHF*
Ga0070685_105883641	3300005466	Switchgrass Rhizosphere	RRVDGIGLTHIGEIRETAEGVKISEGTRIWNLEPQGWKHF*
Ga0070707_1002307152	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	VRLPRLVDGVTITRIGEVRSASEGVKISEGTRVWELTPKGWKHF*
Ga0070695_1010462922	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	EHVGRLPRRVDGVEITRIGEVTKKEDGVKISEGSRVWELNPGGWKHF*
Ga0070693_1007879512	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	LPRRVDGVELKRIGEVMSGNYGVKISEGSRIWDLKPGGWKHF*
Ga0068857_1002136771	3300005577	Corn Rhizosphere	NATRLPRRVDGVEIKRIGEITPTSDGVKISEGTRTWDLRPGGWKHF*
Ga0068854_1002020302	3300005578	Corn Rhizosphere	FTVRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0070702_1004784101	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	ARLPRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF*
Ga0068864_1006268392	3300005618	Switchgrass Rhizosphere	DAVSRLPRRVDGVGVTHIGEVLELTDGVKISEGSRTWELTPGGWKHF*
Ga0068864_1023917432	3300005618	Switchgrass Rhizosphere	ARLPRRVDGVEIKRIGEVSHASDGVKISEGTRIWDLRPGGWKHF*
Ga0068861_1011240641	3300005719	Switchgrass Rhizosphere	QITRIGEVRSHAEGVKISEGSRIWELNPGGWKHF*
Ga0068863_1010703002	3300005841	Switchgrass Rhizosphere	VARLPKRVDGVEIKRIGEITDSRDGVRVSEGTRVWELKPGGWVHF*
Ga0068860_1016262131	3300005843	Switchgrass Rhizosphere	ADVPRLPRRVDGVGIKCIGTIQSASEGVKISEGPRTWELKPSGWKHF*
Ga0068860_1026361141	3300005843	Switchgrass Rhizosphere	PRRVDGVEITRIGQITAASEGIKISEGTRTWDLKPAGWKHF*
Ga0068862_1015909082	3300005844	Switchgrass Rhizosphere	SKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF*
Ga0068862_1016851041	3300005844	Switchgrass Rhizosphere	KPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF*
Ga0075291_10090761	3300005884	Rice Paddy Soil	NLARLPRRVDGVEIKRIGEITHAADGVKISEGTRVWDLKPGGWKHF*
Ga0081539_100885802	3300005985	Tabebuia Heterophylla Rhizosphere	VDSVEIKRIGEITDSHDGVRVSEGTRVWELKPGGWVHF*
Ga0070716_1011469141	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GTQITRIGEMRPASEGVKISEGSRIWELNPGGWKHF*
Ga0079222_105016171	3300006755	Agricultural Soil	RVDGVEIKRIGEVTDAGKGVKISEGLRIWDLKPGGWKHF*
Ga0075428_1001069661	3300006844	Populus Rhizosphere	VGITHIGEILDQSQGVKISEGSRVWDLVPGGWKHF*
Ga0075428_1021740122	3300006844	Populus Rhizosphere	AHLPRKVDGTSITRIGEIRSHEEGVKISEGARVWELNPGGWKHF*
Ga0075433_108055172	3300006852	Populus Rhizosphere	GVELTRIGEVKEEVNGVKISEGSRVWELNPGGWKHF*
Ga0075425_1000308531	3300006854	Populus Rhizosphere	RLPRRVDGVEIKRIGEITGAPEVEVLEGARVWKLKPGGWKHF*
Ga0075429_1008973861	3300006880	Populus Rhizosphere	VGIKSIGQITAAFEGVKISEGSRIWELKSGGWKHF*
Ga0075424_1014694552	3300006904	Populus Rhizosphere	RVDGVEIKRIGTIQSASEGVMISEGARTWELKPGGWKHF*
Ga0079219_104130082	3300006954	Agricultural Soil	GFTRIGEVRKEGEGVKISEGSRVWELNPGGWKHF*
Ga0105245_109359431	3300009098	Miscanthus Rhizosphere	RVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF*
Ga0105243_100647664	3300009148	Miscanthus Rhizosphere	VRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0105242_116420031	3300009176	Miscanthus Rhizosphere	EIKRIGEVTSANDGVKISEASRTWELKPGGWKHF*
Ga0105249_131172032	3300009553	Switchgrass Rhizosphere	LFTVKPENVARLPRRVDGVEIKRIGEITAASENVRISEGTRTWDLKPGGWKHF*
Ga0134124_110879882	3300010397	Terrestrial Soil	RLPRKVDGVGIKRIGQIKAAFEGVKISEGARIWELQPGGWKHF*
Ga0134127_137032412	3300010399	Terrestrial Soil	PRLPRRVDGIEIKRIGEITAVHEGVKITEGTRVWELRPGGWKHF*
Ga0134121_131036472	3300010401	Terrestrial Soil	DNVARLPRRVDGVEIKRIGEITDSVHGVKVSEGTRIWELKPGGWVHF*
Ga0134123_112132591	3300010403	Terrestrial Soil	RVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF*
Ga0157373_112045341	3300013100	Corn Rhizosphere	KPEDVPRLPRRVDGVEIKRIGEITAVHEGVKITEGTRVWELRPGGWKHF*
Ga0157374_110395892	3300013296	Miscanthus Rhizosphere	PRRVDGVEIKRIGEITDSVHGVKVSEGTRIWELKPGGWVHF*
Ga0157378_110817931	3300013297	Miscanthus Rhizosphere	RVDGVEIKRIGEITPTSDGVKISEGTRTWDLRPGGWKHF*
Ga0157372_107700662	3300013307	Corn Rhizosphere	VARLPRRVDGVEITRVGEVTKEMDGVKISEGSRVWELNPGGWKHF*
Ga0157375_118843622	3300013308	Miscanthus Rhizosphere	RRVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF*
Ga0157375_119567391	3300013308	Miscanthus Rhizosphere	RVDGVEIKRIGEITAAREGVKISEGTRIWDLKPGGWKHF*
Ga0157375_128236312	3300013308	Miscanthus Rhizosphere	LFTVKPVDVARLPKRVDGVEIKRIGEVKEAVKGIEIAEGSRVWELKPGGWLHF*
Ga0120195_10025373	3300013500	Terrestrial	DVAKLPRRVDGVEITHIGAITSASEGVKIAEGARTWELKPGGWKHF*
Ga0120188_10571691	3300013760	Terrestrial	VLELRFTVKPGDVSRLPRRVDGVAIKRIGEITTAFEGVKISESSRIWDLEPGGWTHF*
Ga0157380_128805631	3300014326	Switchgrass Rhizosphere	GVGLTHIGEIRDTSEGVKISEGTRVWELQPEGWKHF*
Ga0132258_137994131	3300015371	Arabidopsis Rhizosphere	LLFTVKPNDAPRLPRRVDGVDIKRIGEITAASEGIKISEGTRTWDLKPAGWKHF*
Ga0132255_1009161241	3300015374	Arabidopsis Rhizosphere	EVPRLPKRVDGVGITRIGEVRPASDGVKISEGSRVWELAPEGWKHF*
Ga0184635_100786133	3300018072	Groundwater Sediment	ELLFTVKPDAVGKLPRRVDGIGITQIGEIRELDHGVKISEGSRVWDLTSGGWKHF
Ga0184624_100881733	3300018073	Groundwater Sediment	RVDGIGITQIGEIRELDHGVKISEGSRVWDLTSEGWRHF
Ga0190268_123174752	3300018466	Soil	RVDGTHVTRIGEVRILTDGVKISEGPRVWELNPGGWKLF
Ga0173482_105021801	3300019361	Soil	VKPENVARLPRRVDGVELKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF
Ga0182009_106538872	3300021445	Soil	DGVELTRIGKVKEEVDGVKISEGSRVWELNPGGWKHF
Ga0207697_105610501	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MGVDVARLPRKVDGVELTRIGEVRSAADGVKISEGARIWELNPGGWKHF
Ga0207713_12383151	3300025735	Switchgrass Rhizosphere	PKRVDGVEIKRIGEITDSRDGVRVSEGTRVWELKPGGWVHF
Ga0210143_11062911	3300025792	Natural And Restored Wetlands	KPNDVARLPRRVDGVEIKCIGAIRDASEGIKISEGNRTWELRAAGWRHF
Ga0207710_105165792	3300025900	Switchgrass Rhizosphere	TVKPGDVARLPKRVDGVEIKRIGEVKEAVKGIEIAEGSRVWELKPGGWLHF
Ga0207654_107780252	3300025911	Corn Rhizosphere	PRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF
Ga0207662_103391621	3300025918	Switchgrass Rhizosphere	GVEITRIGQITDASQGIKISEGTRTWDLKPAGWKHF
Ga0207649_107206892	3300025920	Corn Rhizosphere	PRRVDGAPITRIGEIRTNDEGVRISEGARVWELNPGGWKHF
Ga0207690_106055082	3300025932	Corn Rhizosphere	VGITRIGEVRPASEGVKISEGTRVWELTPKGWKHF
Ga0207706_112728152	3300025933	Corn Rhizosphere	VKAWTPITRIGEIRTQHEGVKILERSRTWELNPGGWKHF
Ga0207686_106780303	3300025934	Miscanthus Rhizosphere	LFTVKPADVPRLPRRVDGVEIKQIGEITSATHGVRISEGARIWDLQPGGWKHF
Ga0207686_114202261	3300025934	Miscanthus Rhizosphere	DGVEIKRIGEVTSANDGVKISEASRTWELKPGGWKHF
Ga0207665_113324212	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	GTQITRIGEMRPASEGVKISEGSRIWELNPGGWKHF
Ga0207668_111652081	3300025972	Switchgrass Rhizosphere	PRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF
Ga0207640_119461702	3300025981	Corn Rhizosphere	LLFTVKPVDVARLPRRVDGTEITRIGEVRIETEGVKISEGPRVWELNPGGWKHF
Ga0207658_111289402	3300025986	Switchgrass Rhizosphere	SKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF
Ga0207677_103007611	3300026023	Miscanthus Rhizosphere	DGVGLTHIGEIRDTSEGVKISEGTRVWELQPEGWKHF
Ga0207639_119990031	3300026041	Corn Rhizosphere	LPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF
Ga0207678_107676582	3300026067	Corn Rhizosphere	TVKPENVRRLPRRVDGVGITFIGEIRPAAEGINLREGSRVWELKPEGWEHF
Ga0207641_107277072	3300026088	Switchgrass Rhizosphere	VEIKRIGEITDSRDGVRISEGARVWELKPGGWVHF
Ga0207641_108872072	3300026088	Switchgrass Rhizosphere	LLFTVKPENVARLPRRVDGVELKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF
Ga0207676_114132902	3300026095	Switchgrass Rhizosphere	PRRVDGAQITRIGEVRASDEGVRISEGTRIWELNPGGWKHF
Ga0207676_117459891	3300026095	Switchgrass Rhizosphere	LFTVKPENVPRLPKRVDGVEIKRIGEITRPDDGVKISEGTRTWDLKPGGWKHF
Ga0207676_120269832	3300026095	Switchgrass Rhizosphere	RVDGTGLTKIGEVVGASEGIKISEGSRIWDLTPGGWKHF
Ga0207674_114126511	3300026116	Corn Rhizosphere	DGVEIKRIGEVTQANAGVKISEGTRTWDLKPGGWKHF
Ga0207675_1009779712	3300026118	Switchgrass Rhizosphere	ARLPRRVDGVELKRIGEVMSGNYGVKISEGSRTWDLKPGGWKHF
Ga0209177_103345531	3300027775	Agricultural Soil	FTVKSTNIARLPRRVDGVEIKRIGAITNAVEGVKISEGPRIWDLKPGGWKHF
Ga0268265_113774201	3300028380	Switchgrass Rhizosphere	VSPDAISKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF
Ga0268265_115566761	3300028380	Switchgrass Rhizosphere	TVKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF
Ga0268264_126257551	3300028381	Switchgrass Rhizosphere	LFTVKPNDVPRLPKRVDGVGITRIGEVRPALEGVKISEGTRVWELTPKGWKHF
Ga0268259_101566141	3300030499	Agave	TVKLGDVAKLPRRVDGVEIKRIGEITNASEGVKISEGARVWELRPGGWKHF
Ga0310887_101644471	3300031547	Soil	LFTVSPDDVARLPRRVDGTPITRIGEIRTQHEGVKILERSRTWELNPGGWKHF
Ga0307408_1005343262	3300031548	Rhizosphere	KVARLPRKVDGTGLTQIGEIRPESEGVRVSEGSRLWDLKPEGWKHF
Ga0307408_1017045832	3300031548	Rhizosphere	LFTVKPGDVARLPRRVDGTQITRIGEVRVHPDGVKISEGSRVWELNPGGWKHF
Ga0307412_102505141	3300031911	Rhizosphere	VAKLPRRVDRVAIKHIGEITTASEGVKISEGARIWELKPGGWKHF
Ga0308174_108557142	3300031939	Soil	FTVKPENAARLPKRVDGVEIKRIGEITAASENVRISEGSRMWDLKPGGWKHF
Ga0307416_1036265671	3300032002	Rhizosphere	DGAPITRIGEIRNHDEGVKISERARTWDLNPGGWKHF
Ga0307411_104112732	3300032005	Rhizosphere	GVEIKRIGEITTASEGVKISEGSRTWELKAGGWMHFSA
Ga0310895_104241702	3300032122	Soil	VAHLPRRVDGTQVTRIGEVKAASEGVKISEGSRIWELNPGGWKHF

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F076402

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign