| Basic Information | |
|---|---|
| Family ID | F076402 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 97.46 % |
| % of genes from short scaffolds (< 2000 bps) | 96.61 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (14.407 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.492 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.43% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01406 | tRNA-synt_1e | 82.20 |
| PF09190 | DALR_2 | 5.93 |
| PF07589 | PEP-CTERM | 2.54 |
| PF00186 | DHFR_1 | 0.85 |
| PF01532 | Glyco_hydro_47 | 0.85 |
| PF02769 | AIRS_C | 0.85 |
| PF14534 | DUF4440 | 0.85 |
| PF00410 | Ribosomal_S8 | 0.85 |
| PF03734 | YkuD | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 88.14 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 82.20 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 82.20 |
| COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.85 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.53 % |
| Unclassified | root | N/A | 8.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908027|MRS2a_Contig_25711 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_41164 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_79886 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 2170459009|GA8DASG02HQSUW | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300000955|JGI1027J12803_108611769 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300000956|JGI10216J12902_115701257 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300002568|C688J35102_118114442 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300003999|Ga0055469_10322491 | Not Available | 502 | Open in IMG/M |
| 3300004114|Ga0062593_102781534 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004156|Ga0062589_100419367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300004156|Ga0062589_101762667 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300004156|Ga0062589_101996394 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004157|Ga0062590_100706988 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300004157|Ga0062590_100938944 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300004157|Ga0062590_102679677 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300004479|Ga0062595_101734536 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005294|Ga0065705_10795426 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005331|Ga0070670_101515226 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005334|Ga0068869_100354334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300005336|Ga0070680_101163183 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005338|Ga0068868_101944448 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005345|Ga0070692_10083826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1722 | Open in IMG/M |
| 3300005345|Ga0070692_10413362 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005355|Ga0070671_100042968 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300005367|Ga0070667_100670605 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005440|Ga0070705_100102296 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300005440|Ga0070705_100777192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 760 | Open in IMG/M |
| 3300005444|Ga0070694_101313332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300005455|Ga0070663_100722420 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005466|Ga0070685_10588364 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005468|Ga0070707_100230715 | Not Available | 1802 | Open in IMG/M |
| 3300005545|Ga0070695_101046292 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005547|Ga0070693_100787951 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005577|Ga0068857_100213677 | Not Available | 1760 | Open in IMG/M |
| 3300005578|Ga0068854_100202030 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005615|Ga0070702_100478410 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005618|Ga0068864_100626839 | Not Available | 1045 | Open in IMG/M |
| 3300005618|Ga0068864_102391743 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005719|Ga0068861_101124064 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005841|Ga0068863_101070300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300005843|Ga0068860_101626213 | Not Available | 668 | Open in IMG/M |
| 3300005843|Ga0068860_102636114 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005844|Ga0068862_101590908 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005844|Ga0068862_101685104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 642 | Open in IMG/M |
| 3300005884|Ga0075291_1009076 | Not Available | 1097 | Open in IMG/M |
| 3300005985|Ga0081539_10088580 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300006173|Ga0070716_101146914 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006755|Ga0079222_10501617 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300006844|Ga0075428_100106966 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
| 3300006844|Ga0075428_102174012 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006852|Ga0075433_10805517 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300006854|Ga0075425_100030853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5945 | Open in IMG/M |
| 3300006880|Ga0075429_100897386 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006904|Ga0075424_101469455 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006954|Ga0079219_10413008 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009098|Ga0105245_10935943 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009148|Ga0105243_10064766 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300009176|Ga0105242_11642003 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009553|Ga0105249_13117203 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010397|Ga0134124_11087988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 815 | Open in IMG/M |
| 3300010399|Ga0134127_13703241 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010401|Ga0134121_13103647 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010403|Ga0134123_11213259 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300013100|Ga0157373_11204534 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300013296|Ga0157374_11039589 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300013297|Ga0157378_11081793 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300013307|Ga0157372_10770066 | Not Available | 1119 | Open in IMG/M |
| 3300013308|Ga0157375_11884362 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300013308|Ga0157375_11956739 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300013308|Ga0157375_12823631 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300013500|Ga0120195_1002537 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300013760|Ga0120188_1057169 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300014326|Ga0157380_12880563 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300015371|Ga0132258_13799413 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300015374|Ga0132255_100916124 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300018072|Ga0184635_10078613 | Not Available | 1292 | Open in IMG/M |
| 3300018073|Ga0184624_10088173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300018466|Ga0190268_12317475 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300019361|Ga0173482_10502180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021445|Ga0182009_10653887 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025315|Ga0207697_10561050 | Not Available | 502 | Open in IMG/M |
| 3300025735|Ga0207713_1238315 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025792|Ga0210143_1106291 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025900|Ga0207710_10516579 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025911|Ga0207654_10778025 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025918|Ga0207662_10339162 | Not Available | 1007 | Open in IMG/M |
| 3300025920|Ga0207649_10720689 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300025932|Ga0207690_10605508 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025933|Ga0207706_11272815 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300025934|Ga0207686_10678030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 818 | Open in IMG/M |
| 3300025934|Ga0207686_11420226 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025939|Ga0207665_11332421 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025972|Ga0207668_11165208 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025981|Ga0207640_11946170 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025986|Ga0207658_11128940 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026023|Ga0207677_10300761 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300026041|Ga0207639_11999003 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300026067|Ga0207678_10767658 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300026088|Ga0207641_10727707 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300026088|Ga0207641_10887207 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300026095|Ga0207676_11413290 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300026095|Ga0207676_11745989 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026095|Ga0207676_12026983 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026116|Ga0207674_11412651 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026118|Ga0207675_100977971 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300027775|Ga0209177_10334553 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028380|Ga0268265_11377420 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300028380|Ga0268265_11556676 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300028381|Ga0268264_12625755 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030499|Ga0268259_10156614 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031547|Ga0310887_10164447 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1176 | Open in IMG/M |
| 3300031548|Ga0307408_100534326 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031548|Ga0307408_101704583 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031911|Ga0307412_10250514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506 | 1375 | Open in IMG/M |
| 3300031939|Ga0308174_10855714 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300032002|Ga0307416_103626567 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032005|Ga0307411_10411273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin506 | 1121 | Open in IMG/M |
| 3300032122|Ga0310895_10424170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 14.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS2a_00569220 | 2124908027 | Miscanthus Rhizosphere | VDGVEVKRIGTIRSASEGVKISEGARTWELKPGGWMHF |
| SwRhRL2b_0106.00000020 | 2162886007 | Switchgrass Rhizosphere | VKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF |
| SwRhRL2b_0040.00005650 | 2162886007 | Switchgrass Rhizosphere | GFKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF |
| F47_12086140 | 2170459009 | Grass Soil | LFTVRPDAVAKLPRRVDGVGITHIGEIRDASEGVKISEGTRVWELQPGGWKHF |
| JGI1027J12803_1086117692 | 3300000955 | Soil | AVPKLPRRVDGVPITRIGKILELSEGVKISEGARVWELAPGGWKHF* |
| JGI10216J12902_1157012573 | 3300000956 | Soil | EVAAQLPRRVDGVAITLVGEIRERSHGVKISEGTRIWELRPGGWEHFA* |
| C688J35102_1181144421 | 3300002568 | Soil | NAARLPKRVDGVEIKRIGEITAASENVKISEGTRTWDLKPGGWKHF* |
| Ga0055469_103224912 | 3300003999 | Natural And Restored Wetlands | LPKRVDGVGLTRIGEIRTAQQTVKISEGSRVWDLAPGGWKHF* |
| Ga0062593_1027815341 | 3300004114 | Soil | SVGRLPRKVDGVGITRIGEVTKETDGVKISEGSRIWELNPGGWKHF* |
| Ga0062589_1004193672 | 3300004156 | Soil | DFELLFTVKLGGALPRKVDRTQITRIGEIRDLDDGVRISEGTRIWELNPGGWKHF* |
| Ga0062589_1017626672 | 3300004156 | Soil | RPDAVSRLPRRVDGVGVTHIGEVLELTDGVKISEGSRTWELTPGGWKHF* |
| Ga0062589_1019963941 | 3300004156 | Soil | AAKLPRRVDGVEIKRIGTIQNASDGVKICEGPRTWELKPGGWKHF* |
| Ga0062590_1007069882 | 3300004157 | Soil | RVDGVEIRRIGEVRNREDGVQISEGSRVWELHPGGWKHF* |
| Ga0062590_1009389441 | 3300004157 | Soil | KPADLARLPRRVDGVEIKRIGEVTKSIEGVKISEGSRIWDLKPGGWKHF* |
| Ga0062590_1026796771 | 3300004157 | Soil | RRVDGVELTRIGKVKEEVDGVKISEGSRVWELNPGGWKHF* |
| Ga0062595_1017345361 | 3300004479 | Soil | LLFTVKPNDVPRLPKRVDGVGITPIGEVRPVSEGVKISEGTRVWELTPKGWKHF* |
| Ga0065705_107954262 | 3300005294 | Switchgrass Rhizosphere | LPRRVDGVEIKRIGTIQSASEGVMISEGSRSWELAPGGWKHF* |
| Ga0070670_1015152261 | 3300005331 | Switchgrass Rhizosphere | RRVDGVELKRIGEITDLAHGVKISEGSRIWELKPGGWKHF* |
| Ga0068869_1003543342 | 3300005334 | Miscanthus Rhizosphere | PRRVDGTPITRIGEIRTQHEGVKISERSRTWELNPGGWKHF* |
| Ga0070680_1011631832 | 3300005336 | Corn Rhizosphere | ANNVSRLPRRVDGFSITRVGEIRNAADGIKISEGSRVWELSAGGWRHF* |
| Ga0068868_1019444482 | 3300005338 | Miscanthus Rhizosphere | TVRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0070692_100838261 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRKVDGVGIKRIGQITAAFEGVKISEGARIWELQPGGWKHF* |
| Ga0070692_104133622 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VKPEHVARLPRRVDGVEITRIGQITDASQGIKISEGTRTWDLKPAGWKHF* |
| Ga0070671_1000429681 | 3300005355 | Switchgrass Rhizosphere | AVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0070667_1006706051 | 3300005367 | Switchgrass Rhizosphere | FTVSPDAISKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF* |
| Ga0070705_1001022961 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0070705_1007771921 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDANRLPRKVDGVGIKRIGQITAAFEGVKISEGARIWELQPGGWKHF* |
| Ga0070694_1013133322 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TVTPENAARLPRRVDGVEIKRIGEVTSANDGVKISEGTRIWDLKPGGWKHF* |
| Ga0070663_1007224201 | 3300005455 | Corn Rhizosphere | TVKPENVRRLPRRVDGVGITFIGEIRPAAEGINLREGSRVWELKPEGWEHF* |
| Ga0070685_105883641 | 3300005466 | Switchgrass Rhizosphere | RRVDGIGLTHIGEIRETAEGVKISEGTRIWNLEPQGWKHF* |
| Ga0070707_1002307152 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLPRLVDGVTITRIGEVRSASEGVKISEGTRVWELTPKGWKHF* |
| Ga0070695_1010462922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EHVGRLPRRVDGVEITRIGEVTKKEDGVKISEGSRVWELNPGGWKHF* |
| Ga0070693_1007879512 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRRVDGVELKRIGEVMSGNYGVKISEGSRIWDLKPGGWKHF* |
| Ga0068857_1002136771 | 3300005577 | Corn Rhizosphere | NATRLPRRVDGVEIKRIGEITPTSDGVKISEGTRTWDLRPGGWKHF* |
| Ga0068854_1002020302 | 3300005578 | Corn Rhizosphere | FTVRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0070702_1004784101 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLPRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF* |
| Ga0068864_1006268392 | 3300005618 | Switchgrass Rhizosphere | DAVSRLPRRVDGVGVTHIGEVLELTDGVKISEGSRTWELTPGGWKHF* |
| Ga0068864_1023917432 | 3300005618 | Switchgrass Rhizosphere | ARLPRRVDGVEIKRIGEVSHASDGVKISEGTRIWDLRPGGWKHF* |
| Ga0068861_1011240641 | 3300005719 | Switchgrass Rhizosphere | QITRIGEVRSHAEGVKISEGSRIWELNPGGWKHF* |
| Ga0068863_1010703002 | 3300005841 | Switchgrass Rhizosphere | VARLPKRVDGVEIKRIGEITDSRDGVRVSEGTRVWELKPGGWVHF* |
| Ga0068860_1016262131 | 3300005843 | Switchgrass Rhizosphere | ADVPRLPRRVDGVGIKCIGTIQSASEGVKISEGPRTWELKPSGWKHF* |
| Ga0068860_1026361141 | 3300005843 | Switchgrass Rhizosphere | PRRVDGVEITRIGQITAASEGIKISEGTRTWDLKPAGWKHF* |
| Ga0068862_1015909082 | 3300005844 | Switchgrass Rhizosphere | SKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF* |
| Ga0068862_1016851041 | 3300005844 | Switchgrass Rhizosphere | KPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF* |
| Ga0075291_10090761 | 3300005884 | Rice Paddy Soil | NLARLPRRVDGVEIKRIGEITHAADGVKISEGTRVWDLKPGGWKHF* |
| Ga0081539_100885802 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VDSVEIKRIGEITDSHDGVRVSEGTRVWELKPGGWVHF* |
| Ga0070716_1011469141 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GTQITRIGEMRPASEGVKISEGSRIWELNPGGWKHF* |
| Ga0079222_105016171 | 3300006755 | Agricultural Soil | RVDGVEIKRIGEVTDAGKGVKISEGLRIWDLKPGGWKHF* |
| Ga0075428_1001069661 | 3300006844 | Populus Rhizosphere | VGITHIGEILDQSQGVKISEGSRVWDLVPGGWKHF* |
| Ga0075428_1021740122 | 3300006844 | Populus Rhizosphere | AHLPRKVDGTSITRIGEIRSHEEGVKISEGARVWELNPGGWKHF* |
| Ga0075433_108055172 | 3300006852 | Populus Rhizosphere | GVELTRIGEVKEEVNGVKISEGSRVWELNPGGWKHF* |
| Ga0075425_1000308531 | 3300006854 | Populus Rhizosphere | RLPRRVDGVEIKRIGEITGAPEVEVLEGARVWKLKPGGWKHF* |
| Ga0075429_1008973861 | 3300006880 | Populus Rhizosphere | VGIKSIGQITAAFEGVKISEGSRIWELKSGGWKHF* |
| Ga0075424_1014694552 | 3300006904 | Populus Rhizosphere | RVDGVEIKRIGTIQSASEGVMISEGARTWELKPGGWKHF* |
| Ga0079219_104130082 | 3300006954 | Agricultural Soil | GFTRIGEVRKEGEGVKISEGSRVWELNPGGWKHF* |
| Ga0105245_109359431 | 3300009098 | Miscanthus Rhizosphere | RVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF* |
| Ga0105243_100647664 | 3300009148 | Miscanthus Rhizosphere | VRPDAVSRLPRRVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0105242_116420031 | 3300009176 | Miscanthus Rhizosphere | EIKRIGEVTSANDGVKISEASRTWELKPGGWKHF* |
| Ga0105249_131172032 | 3300009553 | Switchgrass Rhizosphere | LFTVKPENVARLPRRVDGVEIKRIGEITAASENVRISEGTRTWDLKPGGWKHF* |
| Ga0134124_110879882 | 3300010397 | Terrestrial Soil | RLPRKVDGVGIKRIGQIKAAFEGVKISEGARIWELQPGGWKHF* |
| Ga0134127_137032412 | 3300010399 | Terrestrial Soil | PRLPRRVDGIEIKRIGEITAVHEGVKITEGTRVWELRPGGWKHF* |
| Ga0134121_131036472 | 3300010401 | Terrestrial Soil | DNVARLPRRVDGVEIKRIGEITDSVHGVKVSEGTRIWELKPGGWVHF* |
| Ga0134123_112132591 | 3300010403 | Terrestrial Soil | RVDGVGVTHIGEVLELTEGVKISEGSRTWELTPGGWKHF* |
| Ga0157373_112045341 | 3300013100 | Corn Rhizosphere | KPEDVPRLPRRVDGVEIKRIGEITAVHEGVKITEGTRVWELRPGGWKHF* |
| Ga0157374_110395892 | 3300013296 | Miscanthus Rhizosphere | PRRVDGVEIKRIGEITDSVHGVKVSEGTRIWELKPGGWVHF* |
| Ga0157378_110817931 | 3300013297 | Miscanthus Rhizosphere | RVDGVEIKRIGEITPTSDGVKISEGTRTWDLRPGGWKHF* |
| Ga0157372_107700662 | 3300013307 | Corn Rhizosphere | VARLPRRVDGVEITRVGEVTKEMDGVKISEGSRVWELNPGGWKHF* |
| Ga0157375_118843622 | 3300013308 | Miscanthus Rhizosphere | RRVDGVEIKRIGEVMSANYGVKISEGSRIWDLRPGGWKHF* |
| Ga0157375_119567391 | 3300013308 | Miscanthus Rhizosphere | RVDGVEIKRIGEITAAREGVKISEGTRIWDLKPGGWKHF* |
| Ga0157375_128236312 | 3300013308 | Miscanthus Rhizosphere | LFTVKPVDVARLPKRVDGVEIKRIGEVKEAVKGIEIAEGSRVWELKPGGWLHF* |
| Ga0120195_10025373 | 3300013500 | Terrestrial | DVAKLPRRVDGVEITHIGAITSASEGVKIAEGARTWELKPGGWKHF* |
| Ga0120188_10571691 | 3300013760 | Terrestrial | VLELRFTVKPGDVSRLPRRVDGVAIKRIGEITTAFEGVKISESSRIWDLEPGGWTHF* |
| Ga0157380_128805631 | 3300014326 | Switchgrass Rhizosphere | GVGLTHIGEIRDTSEGVKISEGTRVWELQPEGWKHF* |
| Ga0132258_137994131 | 3300015371 | Arabidopsis Rhizosphere | LLFTVKPNDAPRLPRRVDGVDIKRIGEITAASEGIKISEGTRTWDLKPAGWKHF* |
| Ga0132255_1009161241 | 3300015374 | Arabidopsis Rhizosphere | EVPRLPKRVDGVGITRIGEVRPASDGVKISEGSRVWELAPEGWKHF* |
| Ga0184635_100786133 | 3300018072 | Groundwater Sediment | ELLFTVKPDAVGKLPRRVDGIGITQIGEIRELDHGVKISEGSRVWDLTSGGWKHF |
| Ga0184624_100881733 | 3300018073 | Groundwater Sediment | RVDGIGITQIGEIRELDHGVKISEGSRVWDLTSEGWRHF |
| Ga0190268_123174752 | 3300018466 | Soil | RVDGTHVTRIGEVRILTDGVKISEGPRVWELNPGGWKLF |
| Ga0173482_105021801 | 3300019361 | Soil | VKPENVARLPRRVDGVELKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF |
| Ga0182009_106538872 | 3300021445 | Soil | DGVELTRIGKVKEEVDGVKISEGSRVWELNPGGWKHF |
| Ga0207697_105610501 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVDVARLPRKVDGVELTRIGEVRSAADGVKISEGARIWELNPGGWKHF |
| Ga0207713_12383151 | 3300025735 | Switchgrass Rhizosphere | PKRVDGVEIKRIGEITDSRDGVRVSEGTRVWELKPGGWVHF |
| Ga0210143_11062911 | 3300025792 | Natural And Restored Wetlands | KPNDVARLPRRVDGVEIKCIGAIRDASEGIKISEGNRTWELRAAGWRHF |
| Ga0207710_105165792 | 3300025900 | Switchgrass Rhizosphere | TVKPGDVARLPKRVDGVEIKRIGEVKEAVKGIEIAEGSRVWELKPGGWLHF |
| Ga0207654_107780252 | 3300025911 | Corn Rhizosphere | PRRVDGVEIKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF |
| Ga0207662_103391621 | 3300025918 | Switchgrass Rhizosphere | GVEITRIGQITDASQGIKISEGTRTWDLKPAGWKHF |
| Ga0207649_107206892 | 3300025920 | Corn Rhizosphere | PRRVDGAPITRIGEIRTNDEGVRISEGARVWELNPGGWKHF |
| Ga0207690_106055082 | 3300025932 | Corn Rhizosphere | VGITRIGEVRPASEGVKISEGTRVWELTPKGWKHF |
| Ga0207706_112728152 | 3300025933 | Corn Rhizosphere | VKAWTPITRIGEIRTQHEGVKILERSRTWELNPGGWKHF |
| Ga0207686_106780303 | 3300025934 | Miscanthus Rhizosphere | LFTVKPADVPRLPRRVDGVEIKQIGEITSATHGVRISEGARIWDLQPGGWKHF |
| Ga0207686_114202261 | 3300025934 | Miscanthus Rhizosphere | DGVEIKRIGEVTSANDGVKISEASRTWELKPGGWKHF |
| Ga0207665_113324212 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GTQITRIGEMRPASEGVKISEGSRIWELNPGGWKHF |
| Ga0207668_111652081 | 3300025972 | Switchgrass Rhizosphere | PRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF |
| Ga0207640_119461702 | 3300025981 | Corn Rhizosphere | LLFTVKPVDVARLPRRVDGTEITRIGEVRIETEGVKISEGPRVWELNPGGWKHF |
| Ga0207658_111289402 | 3300025986 | Switchgrass Rhizosphere | SKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF |
| Ga0207677_103007611 | 3300026023 | Miscanthus Rhizosphere | DGVGLTHIGEIRDTSEGVKISEGTRVWELQPEGWKHF |
| Ga0207639_119990031 | 3300026041 | Corn Rhizosphere | LPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF |
| Ga0207678_107676582 | 3300026067 | Corn Rhizosphere | TVKPENVRRLPRRVDGVGITFIGEIRPAAEGINLREGSRVWELKPEGWEHF |
| Ga0207641_107277072 | 3300026088 | Switchgrass Rhizosphere | VEIKRIGEITDSRDGVRISEGARVWELKPGGWVHF |
| Ga0207641_108872072 | 3300026088 | Switchgrass Rhizosphere | LLFTVKPENVARLPRRVDGVELKRIGEVMSANYGVKISEGSRIWDLKPGGWKHF |
| Ga0207676_114132902 | 3300026095 | Switchgrass Rhizosphere | PRRVDGAQITRIGEVRASDEGVRISEGTRIWELNPGGWKHF |
| Ga0207676_117459891 | 3300026095 | Switchgrass Rhizosphere | LFTVKPENVPRLPKRVDGVEIKRIGEITRPDDGVKISEGTRTWDLKPGGWKHF |
| Ga0207676_120269832 | 3300026095 | Switchgrass Rhizosphere | RVDGTGLTKIGEVVGASEGIKISEGSRIWDLTPGGWKHF |
| Ga0207674_114126511 | 3300026116 | Corn Rhizosphere | DGVEIKRIGEVTQANAGVKISEGTRTWDLKPGGWKHF |
| Ga0207675_1009779712 | 3300026118 | Switchgrass Rhizosphere | ARLPRRVDGVELKRIGEVMSGNYGVKISEGSRTWDLKPGGWKHF |
| Ga0209177_103345531 | 3300027775 | Agricultural Soil | FTVKSTNIARLPRRVDGVEIKRIGAITNAVEGVKISEGPRIWDLKPGGWKHF |
| Ga0268265_113774201 | 3300028380 | Switchgrass Rhizosphere | VSPDAISKLPRRVDGIGITHIGEIREVGEGVKISEGSRIWDLEPEGWKHF |
| Ga0268265_115566761 | 3300028380 | Switchgrass Rhizosphere | TVKPGDVARLPKRVDGVEIKRIGEITDSSQGVRISEGARIWELKPGGWVHF |
| Ga0268264_126257551 | 3300028381 | Switchgrass Rhizosphere | LFTVKPNDVPRLPKRVDGVGITRIGEVRPALEGVKISEGTRVWELTPKGWKHF |
| Ga0268259_101566141 | 3300030499 | Agave | TVKLGDVAKLPRRVDGVEIKRIGEITNASEGVKISEGARVWELRPGGWKHF |
| Ga0310887_101644471 | 3300031547 | Soil | LFTVSPDDVARLPRRVDGTPITRIGEIRTQHEGVKILERSRTWELNPGGWKHF |
| Ga0307408_1005343262 | 3300031548 | Rhizosphere | KVARLPRKVDGTGLTQIGEIRPESEGVRVSEGSRLWDLKPEGWKHF |
| Ga0307408_1017045832 | 3300031548 | Rhizosphere | LFTVKPGDVARLPRRVDGTQITRIGEVRVHPDGVKISEGSRVWELNPGGWKHF |
| Ga0307412_102505141 | 3300031911 | Rhizosphere | VAKLPRRVDRVAIKHIGEITTASEGVKISEGARIWELKPGGWKHF |
| Ga0308174_108557142 | 3300031939 | Soil | FTVKPENAARLPKRVDGVEIKRIGEITAASENVRISEGSRMWDLKPGGWKHF |
| Ga0307416_1036265671 | 3300032002 | Rhizosphere | DGAPITRIGEIRNHDEGVKISERARTWDLNPGGWKHF |
| Ga0307411_104112732 | 3300032005 | Rhizosphere | GVEIKRIGEITTASEGVKISEGSRTWELKAGGWMHFSA |
| Ga0310895_104241702 | 3300032122 | Soil | VAHLPRRVDGTQVTRIGEVKAASEGVKISEGSRIWELNPGGWKHF |
| ⦗Top⦘ |