| Basic Information | |
|---|---|
| Family ID | F076350 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILART |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.79 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 90.68 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (6.780 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (32.203 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 15.28% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01613 | Flavin_Reduct | 70.34 |
| PF01063 | Aminotran_4 | 16.10 |
| PF07943 | PBP5_C | 4.24 |
| PF08240 | ADH_N | 0.85 |
| PF01266 | DAO | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF01814 | Hemerythrin | 0.85 |
| PF02347 | GDC-P | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 70.34 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 32.20 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.24 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.85 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.53 % |
| Unclassified | root | N/A | 8.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908036|A5_v_NODE_5793_len_1478_cov_6_558187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1528 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig31580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6157 | Open in IMG/M |
| 3300000559|F14TC_102559314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 573 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1065954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1061131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1081401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 511 | Open in IMG/M |
| 3300004011|Ga0055460_10150865 | Not Available | 698 | Open in IMG/M |
| 3300004157|Ga0062590_101756156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300004633|Ga0066395_10958853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300005329|Ga0070683_102058828 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005354|Ga0070675_100030522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4352 | Open in IMG/M |
| 3300005355|Ga0070671_101185232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300005437|Ga0070710_10646718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 741 | Open in IMG/M |
| 3300005575|Ga0066702_10447638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
| 3300005719|Ga0068861_100377079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300005844|Ga0068862_100185362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1870 | Open in IMG/M |
| 3300005844|Ga0068862_102656362 | Not Available | 512 | Open in IMG/M |
| 3300005947|Ga0066794_10084120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300006032|Ga0066696_10625087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300006034|Ga0066656_11063299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300006046|Ga0066652_100286885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1456 | Open in IMG/M |
| 3300006057|Ga0075026_100236871 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300006175|Ga0070712_100230262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1471 | Open in IMG/M |
| 3300006224|Ga0079037_101871099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300006358|Ga0068871_100695531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 931 | Open in IMG/M |
| 3300006796|Ga0066665_10251779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1398 | Open in IMG/M |
| 3300006800|Ga0066660_11274517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300006953|Ga0074063_12460082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300007281|Ga0104349_1036418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1381 | Open in IMG/M |
| 3300009551|Ga0105238_10274600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1666 | Open in IMG/M |
| 3300010043|Ga0126380_10406572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1013 | Open in IMG/M |
| 3300010051|Ga0133939_1125915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1302 | Open in IMG/M |
| 3300010339|Ga0074046_10049333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2801 | Open in IMG/M |
| 3300010341|Ga0074045_10002836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15864 | Open in IMG/M |
| 3300010347|Ga0116238_10185040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi | 1471 | Open in IMG/M |
| 3300010373|Ga0134128_12169735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300010398|Ga0126383_13592218 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300011119|Ga0105246_11519904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 629 | Open in IMG/M |
| 3300012096|Ga0137389_10599498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 946 | Open in IMG/M |
| 3300012228|Ga0137459_1154464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300012361|Ga0137360_10527291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351 | 1007 | Open in IMG/M |
| 3300012987|Ga0164307_10663677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 812 | Open in IMG/M |
| 3300013296|Ga0157374_11502901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300013297|Ga0157378_10465463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1257 | Open in IMG/M |
| 3300013307|Ga0157372_12039760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
| 3300013503|Ga0120127_10171855 | Not Available | 527 | Open in IMG/M |
| 3300013831|Ga0120126_1000508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
| 3300014326|Ga0157380_10993776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300014969|Ga0157376_10819338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 944 | Open in IMG/M |
| 3300015080|Ga0167639_1019319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300015371|Ga0132258_10239433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4428 | Open in IMG/M |
| 3300015371|Ga0132258_11518229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1692 | Open in IMG/M |
| 3300015372|Ga0132256_101527008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 778 | Open in IMG/M |
| 3300015373|Ga0132257_102122244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
| 3300015374|Ga0132255_101030072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1235 | Open in IMG/M |
| 3300015374|Ga0132255_102039923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 873 | Open in IMG/M |
| 3300016371|Ga0182034_10918245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 753 | Open in IMG/M |
| 3300017965|Ga0190266_10458024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 729 | Open in IMG/M |
| 3300018029|Ga0187787_10233405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300018064|Ga0187773_10778979 | Not Available | 605 | Open in IMG/M |
| 3300018075|Ga0184632_10412408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
| 3300018084|Ga0184629_10366909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 758 | Open in IMG/M |
| 3300018084|Ga0184629_10581868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 573 | Open in IMG/M |
| 3300018433|Ga0066667_11207286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 658 | Open in IMG/M |
| 3300019887|Ga0193729_1072676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1354 | Open in IMG/M |
| 3300021331|Ga0210347_1271813 | Not Available | 593 | Open in IMG/M |
| 3300025588|Ga0208586_1082690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 703 | Open in IMG/M |
| 3300025703|Ga0208357_1031187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1890 | Open in IMG/M |
| 3300025927|Ga0207687_10641712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 898 | Open in IMG/M |
| 3300025933|Ga0207706_10353657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1277 | Open in IMG/M |
| 3300025935|Ga0207709_10154581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1593 | Open in IMG/M |
| 3300025937|Ga0207669_10300443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1220 | Open in IMG/M |
| 3300025945|Ga0207679_10272741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1447 | Open in IMG/M |
| 3300025961|Ga0207712_11048245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300026041|Ga0207639_10675286 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300026067|Ga0207678_11604498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300026088|Ga0207641_11012916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 827 | Open in IMG/M |
| 3300026089|Ga0207648_11051545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
| 3300027890|Ga0209496_10256933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 858 | Open in IMG/M |
| 3300028380|Ga0268265_12433913 | Not Available | 530 | Open in IMG/M |
| 3300028770|Ga0302258_1170553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas → unclassified Pacificimonas → Pacificimonas sp. WHA3 | 538 | Open in IMG/M |
| 3300029923|Ga0311347_10279231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1021 | Open in IMG/M |
| 3300029980|Ga0302298_10223233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688 | 619 | Open in IMG/M |
| 3300029984|Ga0311332_11408544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300029987|Ga0311334_11187577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 639 | Open in IMG/M |
| 3300029990|Ga0311336_11361035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300030000|Ga0311337_11560103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688 | 579 | Open in IMG/M |
| 3300031544|Ga0318534_10806485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031595|Ga0265313_10274565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688 | 682 | Open in IMG/M |
| 3300031719|Ga0306917_11329774 | Not Available | 555 | Open in IMG/M |
| 3300031720|Ga0307469_10251198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1423 | Open in IMG/M |
| 3300031720|Ga0307469_11727686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300031740|Ga0307468_100160260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1461 | Open in IMG/M |
| 3300031831|Ga0318564_10286313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 729 | Open in IMG/M |
| 3300031902|Ga0302322_102240392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300031941|Ga0310912_10000624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 17906 | Open in IMG/M |
| 3300031946|Ga0310910_10799569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 743 | Open in IMG/M |
| 3300031999|Ga0315274_10088309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4058 | Open in IMG/M |
| 3300031999|Ga0315274_11404955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300032039|Ga0318559_10031612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2119 | Open in IMG/M |
| 3300032163|Ga0315281_11675234 | Not Available | 618 | Open in IMG/M |
| 3300032173|Ga0315268_10910843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
| 3300032177|Ga0315276_11482106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300032180|Ga0307471_102141618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300032256|Ga0315271_10181659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1672 | Open in IMG/M |
| 3300032397|Ga0315287_11062206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 939 | Open in IMG/M |
| 3300032397|Ga0315287_11936368 | Not Available | 651 | Open in IMG/M |
| 3300032770|Ga0335085_10110119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3537 | Open in IMG/M |
| 3300033419|Ga0316601_102326157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300033433|Ga0326726_10712528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 969 | Open in IMG/M |
| 3300033482|Ga0316627_100018838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3539 | Open in IMG/M |
| 3300033482|Ga0316627_101299925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300033488|Ga0316621_10091677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1679 | Open in IMG/M |
| 3300033488|Ga0316621_10334410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1009 | Open in IMG/M |
| 3300034129|Ga0370493_0029188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1674 | Open in IMG/M |
| 3300034129|Ga0370493_0147992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 769 | Open in IMG/M |
| 3300034417|Ga0364941_129242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 0.85% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.85% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007281 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B | Engineered | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021331 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_v_00030830 | 2124908036 | Soil | MKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYART |
| A5_c1_01003840 | 2124908044 | Soil | MGMKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYART |
| F14TC_1025593141 | 3300000559 | Soil | MAQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSEPEVEVLART |
| AP72_2010_repI_A01DRAFT_10659541 | 3300000579 | Forest Soil | MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVYARTWQGL |
| AP72_2010_repI_A100DRAFT_10611312 | 3300000837 | Forest Soil | MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVY |
| AP72_2010_repI_A001DRAFT_10814011 | 3300000893 | Forest Soil | MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVYAR |
| Ga0055460_101508651 | 3300004011 | Natural And Restored Wetlands | MSATMAEPLKRIIAHRYGGRNLPVTLVLPDGGRIPLAPSSDVE |
| Ga0062590_1017561562 | 3300004157 | Soil | MATMAEPLQKIIASRYGGRDLPVTLVLPDGGRLPLASRTE |
| Ga0066395_109588532 | 3300004633 | Tropical Forest Soil | MNSLSKMVANRYGGRNLPIALVLPDGGRLALSETPEIDIYARTWSGL |
| Ga0070683_1020588282 | 3300005329 | Corn Rhizosphere | MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILARTWRGLKA |
| Ga0070675_1000305226 | 3300005354 | Miscanthus Rhizosphere | MTQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSQPEVEIL |
| Ga0070671_1011852321 | 3300005355 | Switchgrass Rhizosphere | MTLPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPELEVLARTWRG |
| Ga0070710_106467182 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLRALA |
| Ga0066702_104476382 | 3300005575 | Soil | MSRPLTRIIASRYGGRDIPVALVLPDGGRVALSERPE |
| Ga0068861_1003770793 | 3300005719 | Switchgrass Rhizosphere | MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEIL |
| Ga0068862_1001853621 | 3300005844 | Switchgrass Rhizosphere | MTQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSQPEVEILARTW |
| Ga0068862_1026563622 | 3300005844 | Switchgrass Rhizosphere | MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNTEIELVA |
| Ga0066794_100841201 | 3300005947 | Soil | MGMKEPLSKIVESRYGGRNIPVALVLPDGGRVALSATPEVDIYARTWSGVRA |
| Ga0066696_106250873 | 3300006032 | Soil | MNQPLQKIIASRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTL |
| Ga0066656_110632992 | 3300006034 | Soil | MTNSLSKMVVNRYGGRNLPIALVLPDGGRLPLSETPEIDVYA |
| Ga0066652_1002868851 | 3300006046 | Soil | MNQPLQKIIASRYSGRDIPIALVLPDGDRVPLSETPE |
| Ga0075026_1002368713 | 3300006057 | Watersheds | MPEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDAEIEILARTW |
| Ga0070712_1002302623 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLRA |
| Ga0079037_1018710992 | 3300006224 | Freshwater Wetlands | MSATMAEPLKRIIANRYGGRNLPVTLVLPDGGRIPLAPQPEVEILA |
| Ga0068871_1006955313 | 3300006358 | Miscanthus Rhizosphere | MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDP |
| Ga0066665_102517791 | 3300006796 | Soil | MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTLAS |
| Ga0066660_112745171 | 3300006800 | Soil | MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTL |
| Ga0074063_124600823 | 3300006953 | Soil | MAEALQKIIASRYGGRNLPVTLVLPDGGRVPLSSNS |
| Ga0104349_10364183 | 3300007281 | Aeration Tank Of Activated Sludge Process | MAASLQKIISGRYAGRNGPIALVLPDGGRLALSAAPEVEVVARTWRG |
| Ga0105238_102746003 | 3300009551 | Corn Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPEINI |
| Ga0126380_104065721 | 3300010043 | Tropical Forest Soil | MKAPLQKIIASRYRDRNLPIALVLPDGGRVPLSETPEIDVYARTFNGLKALAS |
| Ga0133939_11259152 | 3300010051 | Industrial Wastewater | MAEALQRIITDRYGGRDLPVTLVLPDGARVPLSXXXXXXX |
| Ga0074046_100493334 | 3300010339 | Bog Forest Soil | MKEPLQRIIAHRYAGRDIPISLVLPDGGRVPLSAAPEVDVYARTWQGLRTLAS |
| Ga0074045_1000283616 | 3300010341 | Bog Forest Soil | MNAPLQSIIASRYRGRNIPIALVLPDGGRVALSDAPEVDVYART |
| Ga0116238_101850401 | 3300010347 | Anaerobic Digestor Sludge | MAASLQKIIAGRYAGRNVPIALVLPDGGRLSLSAAPEVEVVARTWRGIN |
| Ga0134128_121697352 | 3300010373 | Terrestrial Soil | MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPE |
| Ga0126383_135922181 | 3300010398 | Tropical Forest Soil | MNSSLSKMVASRYSGRNLPIALVLPAGGRLALSETPEIDVYARTW |
| Ga0105246_115199042 | 3300011119 | Miscanthus Rhizosphere | MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILAR |
| Ga0137389_105994983 | 3300012096 | Vadose Zone Soil | MHQPLQKIIANRYSGRDIPISLVLPDGDRVPLSETPEVDV |
| Ga0137459_11544642 | 3300012228 | Soil | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEIEIAARTWRG |
| Ga0137360_105272912 | 3300012361 | Vadose Zone Soil | MKSVLPKIVANRYGGRNLPIALVLPDGGRVALSASPEI |
| Ga0164307_106636772 | 3300012987 | Soil | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYART |
| Ga0157374_115029011 | 3300013296 | Miscanthus Rhizosphere | MAPPLKRIIENRYGGKNLPGALVLPAGGGVRLSAA |
| Ga0157378_104654631 | 3300013297 | Miscanthus Rhizosphere | MAEPLQRIISNRYGGRNLPVTLVLPDGGRVPLSSNAEIEVLARTWRGLK |
| Ga0157372_120397602 | 3300013307 | Corn Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPE |
| Ga0120127_101718552 | 3300013503 | Permafrost | MVLAPISIMKQPLQKLIASRYGGRNIPVALVLPDGGRGPL |
| Ga0120126_10005081 | 3300013831 | Permafrost | MKQPLQKLIASRYGGRDIPVALVLPDGGRVALSKTPEINIYAHTW |
| Ga0157380_109937761 | 3300014326 | Switchgrass Rhizosphere | MPQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILA |
| Ga0157376_108193381 | 3300014969 | Miscanthus Rhizosphere | MAPPLKRIIENRYGGKNLPVALVLPDGGRVPLSAAPEVDVVA |
| Ga0167639_10193191 | 3300015080 | Glacier Forefield Soil | MKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYARTW |
| Ga0132258_102394331 | 3300015371 | Arabidopsis Rhizosphere | MNASLSKIVASRYDGRNIPVALVLPDGGRVALSQPTEVDIYARTWSG |
| Ga0132258_115182291 | 3300015371 | Arabidopsis Rhizosphere | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDPEVEILARTWRGLKAL |
| Ga0132256_1015270082 | 3300015372 | Arabidopsis Rhizosphere | MAAALKKIIESRYGGRDLPVTLVLPDGGRMALSSRPDL |
| Ga0132257_1021222441 | 3300015373 | Arabidopsis Rhizosphere | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILAHTW |
| Ga0132255_1010300723 | 3300015374 | Arabidopsis Rhizosphere | MNDSLSKIVASRYGGRNIPVALVLPDGGRVALSQPT |
| Ga0132255_1020399233 | 3300015374 | Arabidopsis Rhizosphere | MAAALKKIIESRYGGRDLPVALVLPDGGRMALSSRPD |
| Ga0182034_109182452 | 3300016371 | Soil | MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSAD |
| Ga0190266_104580241 | 3300017965 | Soil | MATPLQSILASRYGGRGIPAALVLPDGGRVALSSSPEIEV |
| Ga0187787_102334052 | 3300018029 | Tropical Peatland | MKESLQKLIASRYRGRNLPISLVLPDGGRVSLSDTPELDIYARTWEGLKAL |
| Ga0187773_107789792 | 3300018064 | Tropical Peatland | MSEPLQKIIASRYQGRSLPIVLVLPDGGRVPLSADADIEIIARTWKGLKAL |
| Ga0184632_104124082 | 3300018075 | Groundwater Sediment | MAEPLRKLIESRYGGRNPPVAPVLSDGGPGALSPTPEG |
| Ga0184629_103669091 | 3300018084 | Groundwater Sediment | MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGL |
| Ga0184629_105818682 | 3300018084 | Groundwater Sediment | MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRVPLSSEPE |
| Ga0066667_112072861 | 3300018433 | Grasslands Soil | MSRPLTRIIASRYGGRDIPVALVLPDGGRVALSERPEVDVYARTWRGPKALP |
| Ga0193729_10726763 | 3300019887 | Soil | MGMKEPLSKIVESRYGGRNIPVAVVLPDGGRVALSAAPEVDVY |
| Ga0210347_12718132 | 3300021331 | Estuarine | LMAQPLQKIIATRYTGRNLPVTLVLPDGGRVPLSSEPEIEIAAR |
| Ga0208586_10826902 | 3300025588 | Arctic Peat Soil | MADTLQKIITSRYQGRDIPIALILPGGSRVPLSTT |
| Ga0208357_10311873 | 3300025703 | Arctic Peat Soil | MAETLQRLIASRYRGRDLPVAVVLPDGGRVALSQS |
| Ga0207687_106417121 | 3300025927 | Miscanthus Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLR |
| Ga0207706_103536571 | 3300025933 | Corn Rhizosphere | MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILARTWRGLKALS |
| Ga0207709_101545811 | 3300025935 | Miscanthus Rhizosphere | MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSE |
| Ga0207669_103004433 | 3300025937 | Miscanthus Rhizosphere | MAEPLQRIISNRYGGRNLPVTLVLPDGGRVPLSSNAEIEVLARTWRGL |
| Ga0207679_102727413 | 3300025945 | Corn Rhizosphere | MPEALEKVIANRYGGRGLPVAFVLPDGARVKLAPEPE |
| Ga0207712_110482452 | 3300025961 | Switchgrass Rhizosphere | MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPEVEILA |
| Ga0207639_106752862 | 3300026041 | Corn Rhizosphere | MAEPLKKLITRRYAGRDLPVTLVLPDGGRLPLSPQADIDI |
| Ga0207678_116044981 | 3300026067 | Corn Rhizosphere | MALPLTSIIASRYAGRELPIALVLPDGGRVALSPKPEVE |
| Ga0207641_110129162 | 3300026088 | Switchgrass Rhizosphere | MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPEVEIL |
| Ga0207648_110515451 | 3300026089 | Miscanthus Rhizosphere | MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPEINIYA |
| Ga0209496_102569332 | 3300027890 | Wetland | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVALSSNPEMELLARSWRGLKAL |
| Ga0268265_124339131 | 3300028380 | Switchgrass Rhizosphere | MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNTEIEL |
| Ga0302258_11705531 | 3300028770 | Fen | MAEALRHFIASRYDGRNVPVTLVLPDGARLPLSPA |
| Ga0311347_102792313 | 3300029923 | Fen | MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTEAEIIIRTWRALKAL |
| Ga0302298_102232332 | 3300029980 | Fen | MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTEAEIIIRTWRALKA |
| Ga0311332_114085442 | 3300029984 | Fen | MNDSLSRIVANRYGGRNIPVALVLPDGGRVALSEATEVDIYARTWNGLR |
| Ga0311334_111875771 | 3300029987 | Fen | MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTE |
| Ga0311336_113610352 | 3300029990 | Fen | MKDSLSRIVANRYGGRNIPVALVLPDGGRVALSEAPEVDIYARTWNGLRA |
| Ga0311337_115601032 | 3300030000 | Fen | MSEPLQKIIAIRYGGRDLPVMVVLPDGGRVPLSSS |
| Ga0318534_108064851 | 3300031544 | Soil | MNVPLQKIIASRYRDRNLPIALVLPDGGRVPLSEAPEVDVYARTF |
| Ga0265313_102745652 | 3300031595 | Rhizosphere | MAQPLQKFIASRYGGRELPVTLILPDGGRVPLSAQPEVE |
| Ga0306917_100404304 | 3300031719 | Soil | MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSADPEVDVIARSWK |
| Ga0306917_113297741 | 3300031719 | Soil | MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNVEIEILARTWRGLKA |
| Ga0307469_102511981 | 3300031720 | Hardwood Forest Soil | MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEI |
| Ga0307469_117276861 | 3300031720 | Hardwood Forest Soil | MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYAR |
| Ga0307468_1001602601 | 3300031740 | Hardwood Forest Soil | MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDA |
| Ga0318564_102863132 | 3300031831 | Soil | MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSADP |
| Ga0302322_1022403922 | 3300031902 | Fen | MKSSLTRFVAHRYEGRNLPVALVMPDGGRVALSDRPEVDIYART |
| Ga0310912_1000062417 | 3300031941 | Soil | MKPPLQQIIARRYRDHNLPIALVLPDGGRVPLSETTEVDVYARTWNGLKALAS |
| Ga0310910_107995692 | 3300031946 | Soil | MNSLPKMVANRYGGRNLPIALVLPDGGRLALSETPEID |
| Ga0315274_100883095 | 3300031999 | Sediment | MFGALQKIIANRYGGRNLPVTLVLPDGGRVPLSSDAEIEILART |
| Ga0315274_114049551 | 3300031999 | Sediment | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSESEIEILARTWRGLKA |
| Ga0318559_100316124 | 3300032039 | Soil | MKPPLQQIIARRYRDHNLPIALVLPDGGRVPLSETTEVDVYARTW |
| Ga0315281_116752342 | 3300032163 | Sediment | MMAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSESEIEILARTW |
| Ga0315268_109108432 | 3300032173 | Sediment | MSATLAEPLKKIIAGRYAGRDLPVTLVLPDGGRLPLSPRTEVDI |
| Ga0315276_114821062 | 3300032177 | Sediment | MAQPLQKIIASRYTGRNLPVTLVLPGGGRVPLSSKPEIEIAART |
| Ga0307471_1021416182 | 3300032180 | Hardwood Forest Soil | MKEPLSKIVESRYGGRDIPVAVVLPDGGRVALSPTPEVD |
| Ga0315271_101816591 | 3300032256 | Sediment | MSATIAEPLRKIIASRYGGRDLPVTLVLPDGGRIPLAP |
| Ga0315287_110622061 | 3300032397 | Sediment | MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSE |
| Ga0315287_119363681 | 3300032397 | Sediment | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSES |
| Ga0335085_101101195 | 3300032770 | Soil | MKQSLQKIIANRYRGRNLPIALVLPDGGRVPLSEAPELDIYARTWDGLKAL |
| Ga0316601_1023261571 | 3300033419 | Soil | MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEVEIL |
| Ga0326726_107125281 | 3300033433 | Peat Soil | MARALQKIIASRYGGRNLPVTLVLPDGGRVPLSAQPEVEIFARSWAGLKALAS |
| Ga0316627_1000188385 | 3300033482 | Soil | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVALSSNPEMELLA |
| Ga0316627_1012999252 | 3300033482 | Soil | MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEV |
| Ga0316621_100916773 | 3300033488 | Soil | MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEVEILARTWRG |
| Ga0316621_103344102 | 3300033488 | Soil | MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILART |
| Ga0370493_0029188_1_147 | 3300034129 | Untreated Peat Soil | MKSSLTRFVAHRYEGRNLPVALVMPDGGRVALSDRPEVDIYARTWNGLR |
| Ga0370493_0147992_633_767 | 3300034129 | Untreated Peat Soil | MKDSLSRIVANRYGGRNIPVALVLPDGGRVALSESPEVDIYARTW |
| Ga0364941_129242_1_108 | 3300034417 | Sediment | MSYPLQRIIANRYRGRDIPIALVLPDGDRVSLSETP |
| ⦗Top⦘ |