| Basic Information | |
|---|---|
| Family ID | F076157 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | IPLINGIGGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.72 % |
| % of genes near scaffold ends (potentially truncated) | 94.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.53 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.627 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (16.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.254 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.441 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF08755 | YccV-like | 72.03 |
| PF01578 | Cytochrom_C_asm | 18.64 |
| PF04279 | IspA | 2.54 |
| PF03100 | CcmE | 2.54 |
| PF04995 | CcmD | 0.85 |
| PF10984 | DUF2794 | 0.85 |
| PF08534 | Redoxin | 0.85 |
| PF02254 | TrkA_N | 0.85 |
| PF03918 | CcmH | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3785 | Heat shock protein HspQ | Posttranslational modification, protein turnover, chaperones [O] | 72.03 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 2.54 |
| COG2917 | Intracellular septation protein A | Cell cycle control, cell division, chromosome partitioning [D] | 2.54 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG3114 | Heme exporter protein D | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.63 % |
| All Organisms | root | All Organisms | 42.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000239|SI36aug09_120mDRAFT_1044385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 879 | Open in IMG/M |
| 3300001974|GOS2246_10143554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1485 | Open in IMG/M |
| 3300003271|JGI26114J46594_1005109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2566 | Open in IMG/M |
| 3300003601|JGI26382J51730_1113054 | Not Available | 524 | Open in IMG/M |
| 3300005960|Ga0066364_10157199 | Not Available | 780 | Open in IMG/M |
| 3300006027|Ga0075462_10082762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300006345|Ga0099693_1024939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2981 | Open in IMG/M |
| 3300006413|Ga0099963_1367870 | Not Available | 557 | Open in IMG/M |
| 3300006481|Ga0100229_1502691 | Not Available | 717 | Open in IMG/M |
| 3300006565|Ga0100228_1162607 | Not Available | 520 | Open in IMG/M |
| 3300006870|Ga0075479_10331865 | Not Available | 594 | Open in IMG/M |
| 3300007057|Ga0101644_1006143 | Not Available | 1360 | Open in IMG/M |
| 3300007514|Ga0105020_1231688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1245 | Open in IMG/M |
| 3300008253|Ga0105349_10452018 | Not Available | 536 | Open in IMG/M |
| 3300009077|Ga0115552_1036165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2314 | Open in IMG/M |
| 3300009077|Ga0115552_1408265 | Not Available | 535 | Open in IMG/M |
| 3300009172|Ga0114995_10554327 | Not Available | 628 | Open in IMG/M |
| 3300009498|Ga0115568_10067806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1830 | Open in IMG/M |
| 3300009593|Ga0115011_10730393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 813 | Open in IMG/M |
| 3300012919|Ga0160422_10812124 | Not Available | 600 | Open in IMG/M |
| 3300012928|Ga0163110_11008137 | Not Available | 663 | Open in IMG/M |
| 3300012936|Ga0163109_10329465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1118 | Open in IMG/M |
| 3300017714|Ga0181412_1065227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 897 | Open in IMG/M |
| 3300017717|Ga0181404_1120098 | Not Available | 641 | Open in IMG/M |
| 3300017720|Ga0181383_1185859 | Not Available | 554 | Open in IMG/M |
| 3300017734|Ga0187222_1101108 | Not Available | 652 | Open in IMG/M |
| 3300017738|Ga0181428_1087536 | Not Available | 727 | Open in IMG/M |
| 3300017738|Ga0181428_1169301 | Not Available | 510 | Open in IMG/M |
| 3300017755|Ga0181411_1228240 | Not Available | 517 | Open in IMG/M |
| 3300017760|Ga0181408_1079907 | Not Available | 857 | Open in IMG/M |
| 3300017773|Ga0181386_1130560 | Not Available | 774 | Open in IMG/M |
| 3300017779|Ga0181395_1148748 | Not Available | 738 | Open in IMG/M |
| 3300017781|Ga0181423_1187454 | Not Available | 787 | Open in IMG/M |
| 3300017824|Ga0181552_10213273 | Not Available | 990 | Open in IMG/M |
| 3300017950|Ga0181607_10555771 | Not Available | 608 | Open in IMG/M |
| 3300017950|Ga0181607_10566742 | Not Available | 600 | Open in IMG/M |
| 3300017958|Ga0181582_10395704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 881 | Open in IMG/M |
| 3300019938|Ga0194032_1017008 | Not Available | 772 | Open in IMG/M |
| 3300020013|Ga0182086_1297080 | Not Available | 637 | Open in IMG/M |
| 3300020270|Ga0211671_1017252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1434 | Open in IMG/M |
| 3300020343|Ga0211626_1091108 | Not Available | 723 | Open in IMG/M |
| 3300020362|Ga0211488_10051309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1331 | Open in IMG/M |
| 3300020379|Ga0211652_10181148 | Not Available | 643 | Open in IMG/M |
| 3300020391|Ga0211675_10317053 | Not Available | 657 | Open in IMG/M |
| 3300020413|Ga0211516_10360088 | Not Available | 648 | Open in IMG/M |
| 3300020414|Ga0211523_10125735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1078 | Open in IMG/M |
| 3300020421|Ga0211653_10280410 | Not Available | 724 | Open in IMG/M |
| 3300020438|Ga0211576_10142551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1301 | Open in IMG/M |
| 3300020451|Ga0211473_10171642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1117 | Open in IMG/M |
| 3300020452|Ga0211545_10305875 | Not Available | 727 | Open in IMG/M |
| 3300020452|Ga0211545_10423204 | Not Available | 605 | Open in IMG/M |
| 3300020453|Ga0211550_10083945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1509 | Open in IMG/M |
| 3300020457|Ga0211643_10317733 | Not Available | 765 | Open in IMG/M |
| 3300020465|Ga0211640_10120234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1505 | Open in IMG/M |
| 3300020467|Ga0211713_10520249 | Not Available | 579 | Open in IMG/M |
| 3300020469|Ga0211577_10402352 | Not Available | 846 | Open in IMG/M |
| 3300020475|Ga0211541_10400983 | Not Available | 670 | Open in IMG/M |
| 3300020601|Ga0181557_1229189 | Not Available | 665 | Open in IMG/M |
| 3300021084|Ga0206678_10316298 | Not Available | 748 | Open in IMG/M |
| 3300021185|Ga0206682_10219089 | Not Available | 858 | Open in IMG/M |
| 3300021364|Ga0213859_10202505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 919 | Open in IMG/M |
| 3300021368|Ga0213860_10265843 | Not Available | 751 | Open in IMG/M |
| 3300021957|Ga0222717_10486636 | Not Available | 667 | Open in IMG/M |
| 3300021958|Ga0222718_10043326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2911 | Open in IMG/M |
| 3300021960|Ga0222715_10686073 | Not Available | 517 | Open in IMG/M |
| 3300021962|Ga0222713_10170046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1485 | Open in IMG/M |
| 3300022907|Ga0255775_1309539 | Not Available | 545 | Open in IMG/M |
| 3300022928|Ga0255758_10341834 | Not Available | 618 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10137062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1132 | Open in IMG/M |
| 3300022934|Ga0255781_10459331 | Not Available | 522 | Open in IMG/M |
| 3300022934|Ga0255781_10461706 | Not Available | 520 | Open in IMG/M |
| 3300023081|Ga0255764_10280996 | Not Available | 773 | Open in IMG/M |
| 3300023180|Ga0255768_10184071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1278 | Open in IMG/M |
| 3300024221|Ga0228666_1081409 | Not Available | 619 | Open in IMG/M |
| 3300024235|Ga0228665_1016002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1519 | Open in IMG/M |
| 3300024237|Ga0228653_1102747 | Not Available | 610 | Open in IMG/M |
| (restricted) 3300024243|Ga0233436_1102609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 926 | Open in IMG/M |
| (restricted) 3300024252|Ga0233435_1072514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1235 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10289402 | Not Available | 711 | Open in IMG/M |
| 3300024321|Ga0228626_1051110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 992 | Open in IMG/M |
| 3300024328|Ga0228635_1044583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1219 | Open in IMG/M |
| 3300024334|Ga0228671_1059276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 988 | Open in IMG/M |
| 3300024428|Ga0233396_1046492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1216 | Open in IMG/M |
| 3300025596|Ga0209662_1015199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2469 | Open in IMG/M |
| 3300025643|Ga0209151_1081398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 885 | Open in IMG/M |
| 3300025653|Ga0208428_1040020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1459 | Open in IMG/M |
| 3300025656|Ga0209054_1057775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1159 | Open in IMG/M |
| 3300025770|Ga0209362_1029947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2495 | Open in IMG/M |
| 3300026258|Ga0208130_1005457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5361 | Open in IMG/M |
| 3300026321|Ga0208764_10107479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1437 | Open in IMG/M |
| 3300026505|Ga0228647_1025677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1544 | Open in IMG/M |
| 3300027234|Ga0208170_1051793 | Not Available | 817 | Open in IMG/M |
| 3300027506|Ga0208973_1024537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1780 | Open in IMG/M |
| 3300027702|Ga0209036_1049963 | Not Available | 1353 | Open in IMG/M |
| 3300027791|Ga0209830_10163782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1057 | Open in IMG/M |
| 3300027906|Ga0209404_10840630 | Not Available | 625 | Open in IMG/M |
| 3300028128|Ga0228645_1133990 | Not Available | 545 | Open in IMG/M |
| 3300028194|Ga0257106_1047917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1622 | Open in IMG/M |
| 3300028194|Ga0257106_1068856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1307 | Open in IMG/M |
| 3300028194|Ga0257106_1092447 | Not Available | 1097 | Open in IMG/M |
| 3300028198|Ga0257121_1165544 | Not Available | 732 | Open in IMG/M |
| 3300028277|Ga0257116_1003399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 7927 | Open in IMG/M |
| 3300028391|Ga0233394_1050202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 987 | Open in IMG/M |
| 3300028414|Ga0228627_1049354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1136 | Open in IMG/M |
| 3300028416|Ga0228614_1045260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 963 | Open in IMG/M |
| 3300028706|Ga0257115_1078054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 907 | Open in IMG/M |
| 3300031766|Ga0315322_10588469 | Not Available | 714 | Open in IMG/M |
| 3300031775|Ga0315326_10622012 | Not Available | 685 | Open in IMG/M |
| 3300031775|Ga0315326_10811111 | Not Available | 582 | Open in IMG/M |
| 3300031775|Ga0315326_10889062 | Not Available | 549 | Open in IMG/M |
| 3300031785|Ga0310343_11173407 | Not Available | 580 | Open in IMG/M |
| 3300031851|Ga0315320_10535866 | Not Available | 782 | Open in IMG/M |
| 3300032011|Ga0315316_10880924 | Not Available | 734 | Open in IMG/M |
| 3300032032|Ga0315327_10207306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1229 | Open in IMG/M |
| 3300032047|Ga0315330_10097840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1942 | Open in IMG/M |
| 3300032088|Ga0315321_10732387 | Not Available | 569 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.95% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.86% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.17% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 9.32% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.39% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.39% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.39% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.54% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 2.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.54% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.85% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.85% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.85% |
| Cinachyra Sp. (Marine Sponge) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 3300000239 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300003271 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 | Environmental | Open in IMG/M |
| 3300003601 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007057 | Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg17ic | Host-Associated | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020013 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024243 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MG | Environmental | Open in IMG/M |
| 3300024252 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025643 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025656 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300028706 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100m | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_00638350 | 2166559017 | Environmental And Host-Associated | LEEFFFQKTKTTANATKIATISGSIAIEKFLPLLE |
| SI36aug09_120mDRAFT_10443851 | 3300000239 | Marine | MVRPPKNVIKIPLSKGIMGIFFSKTQTIAKATRVATISGGMATD |
| GOS2246_101435542 | 3300001974 | Marine | PKKVIKIPLTKGIGGIFFSKNQTIANATKVATISGGIATDKFLPLFVIIEKKYC* |
| JGI26114J46594_10051097 | 3300003271 | Marine | SPPKNVIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFXLL* |
| JGI26382J51730_11130542 | 3300003601 | Marine | PPKNVIKXPLTKGMVGIFFSKNQTTTSAIKVATISGGIAIDKFLSLL* |
| Ga0066364_101571991 | 3300005960 | Marine | PKKVIKIPLTKGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL* |
| Ga0075462_100827623 | 3300006027 | Aqueous | TKGIGGIFFSITQTTANAIIVAIINGGIATDKFLSLL* |
| Ga0099693_10249397 | 3300006345 | Marine | KVIKIPLTKGIGGIFFSKNHTIANATKVAIISGGIATDIFLPLL* |
| Ga0099963_13678702 | 3300006413 | Marine | MSITKKVIKIPLTKGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL* |
| Ga0100229_15026911 | 3300006481 | Marine | TKGIGGIFFSKYQTTANAIKVATISGGIATDKFLSLL* |
| Ga0100228_11626072 | 3300006565 | Marine | FDAGGIGGIFFSKNQTTANAIKVATISGGIATDKFLSLL* |
| Ga0075479_103318652 | 3300006870 | Aqueous | VIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL* |
| Ga0101644_10061431 | 3300007057 | Cinachyra Sp. (Marine Sponge) | KGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL* |
| Ga0105020_12316881 | 3300007514 | Marine | LTKGIGGIFFSKNQTTANAIKVATISGGMAIDKFLSLL* |
| Ga0105349_104520181 | 3300008253 | Methane Seep Mesocosm | IIVRSPKKVIKRPLINGIIGILLSKNQTINSAINVATISGGMAIDKFLSLL* |
| Ga0115552_10361651 | 3300009077 | Pelagic Marine | IKIQLIKNICDIFFSITQTTANAIIVAIINGGIATDKFLSLL* |
| Ga0115552_14082651 | 3300009077 | Pelagic Marine | KKVINIPLIKGIIGIFFSKNQTINNEIIVATISGGIAIDKFLSLS* |
| Ga0114995_105543272 | 3300009172 | Marine | PKNVIKTPLIKGIMGIFFSKNQTIISAIKVATISGGIATVKFLSLL* |
| Ga0115568_100678061 | 3300009498 | Pelagic Marine | LINGIIGIFFSKNQTINNEAIVATISGGIATDKFLSLL* |
| Ga0115011_107303932 | 3300009593 | Marine | MGGIFFSKNHTTPRAIKVATMSGGIAIDKFLSLF* |
| Ga0160422_108121241 | 3300012919 | Seawater | VNPPKRVIRIPPTRGTVGIFFSKNQTIKTEIIVATIRGGIAT* |
| Ga0163110_110081371 | 3300012928 | Surface Seawater | IVNPPKRVIKIPPVSGTIGIFFSKNQTIKMEIIVATISGGIAT* |
| Ga0163109_103294651 | 3300012936 | Surface Seawater | IGGIFFSKNHTTANAIRVATMSGGIAIDKFLSLL* |
| Ga0181412_10652271 | 3300017714 | Seawater | PLINGINGIFFSKNQTIANAIKVATISGGIATDKFLSLL |
| Ga0181404_11200981 | 3300017717 | Seawater | NVINTPLINGIIGIFFSKNQTTTSAIKVATISGGIATDKFLSLL |
| Ga0181383_11858591 | 3300017720 | Seawater | IVSPPKNVINIPLTKGIGGIFFSKNHTTARAIKVATMSGGIATDKFLSLL |
| Ga0187222_11011082 | 3300017734 | Seawater | PKNVINIPLINGIGGIFFSKNQTTAKATKVATISGGIATDKFLSLL |
| Ga0181428_10875363 | 3300017738 | Seawater | LINGIGGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0181428_11693012 | 3300017738 | Seawater | GSLKYIVRLPKNVIKIPLTKGIVGIFFSKNQTIAKATNVATMSGGIAIDKFLSLL |
| Ga0181411_12282402 | 3300017755 | Seawater | VIKIPLTKGIGGIFFSKNHTTANAIRVATMSGGIAIDKFLSLL |
| Ga0181408_10799072 | 3300017760 | Seawater | NPPKNVINIPLINGIGGIFFSKNQTTANAIKVATISGGIATDKFLLLL |
| Ga0181386_11305601 | 3300017773 | Seawater | GLTKGMAGIFFSKNQTTPNAIKVATMSGGIATDKFLSLL |
| Ga0181395_11487481 | 3300017779 | Seawater | KKVINIPLANGIIGIFFSKNQTSVNAIRVATISGGIATDKFLSLL |
| Ga0181423_10089177 | 3300017781 | Seawater | IVKPPKNVIKIPLINGIVGIFLSKNQTTVNAIKVATISGGIAIFKSFPLS |
| Ga0181423_11874542 | 3300017781 | Seawater | PPKNVIKIPLINGIIGIFFSKNQTIANAINVATISGGIATDKFFSLL |
| Ga0181552_102132732 | 3300017824 | Salt Marsh | GIGGIFFSNIHMMINATIVAIINGGIAMDKFLSLL |
| Ga0181607_105557712 | 3300017950 | Salt Marsh | LKYIVKPPKNVIKIPLINGIGGIFFSKIQTITNETNVATIRGGIETDKFLSLL |
| Ga0181607_105667422 | 3300017950 | Salt Marsh | MVNPPKNVINIPLINGIGGIFFSKNQTTANAIIVATIKGGIATDKFFPLL |
| Ga0181582_103957043 | 3300017958 | Salt Marsh | TKGIGGIFFSNTQTTISAIIVAIINGGIATDKFLSLL |
| Ga0194032_10170081 | 3300019938 | Freshwater | TKGIGGIFFSITQTTANAIIVAIINGGIATDKFLSLL |
| Ga0182086_12970801 | 3300020013 | Salt Marsh | KGIGGIFFSITQTTANAIIVAIINGGIATDKFLSLL |
| Ga0211671_10172523 | 3300020270 | Marine | IPLTNGIGGIFFSKNQTTDNAIKVATISGGIATDKFLSLL |
| Ga0211626_10911082 | 3300020343 | Marine | LAKGIGGIFFSKNHTTANAIRVATMSGGIAIDKFLSLL |
| Ga0211488_100513093 | 3300020362 | Marine | IPPIRGIIGIFFSKNQIITTAINVATMNGGMATLRSLPLL |
| Ga0211652_101811481 | 3300020379 | Marine | PLTKGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL |
| Ga0211675_103170532 | 3300020391 | Marine | NVINIPLTNGIGGIFFSKNHTIANAIKVATISGGIATDKFLSLL |
| Ga0211516_103600882 | 3300020413 | Marine | IKIGSLKYIVNPPKNVINIPLNRGMGGIFFSKNQTTPSAIKVATISGGIATDKFLSLL |
| Ga0211523_101257351 | 3300020414 | Marine | IPLTKGIGGIFFSNNHTTINAIIVAIIKGGIAIDKFLSLL |
| Ga0211653_102804102 | 3300020421 | Marine | KGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL |
| Ga0211576_101425513 | 3300020438 | Marine | PLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL |
| Ga0211473_101716421 | 3300020451 | Marine | INIGSLKYIVSPPKKVIKIPLNKGIGGIFFSKNQTMANAMIVATIKGGIATDKFFPLL |
| Ga0211545_103058751 | 3300020452 | Marine | PPKKVINIPLIRGIGGIFFSNTQTTISAIIVAIINGGIAIDIFLSLL |
| Ga0211545_104232042 | 3300020452 | Marine | KYIVSPPKKVIKIPLNKGIGGIFFSKNQKTANAMIVATIKGGIATDKFFPLL |
| Ga0211550_100839451 | 3300020453 | Marine | LNKGIGGIFFSKNQTTANAMIVATIKGGIATDKFFPLL |
| Ga0211643_103177331 | 3300020457 | Marine | PKNVIKIPLTKGIGGIFFSKNQTTANATRVATISGGIATDKFLSLL |
| Ga0211640_101202343 | 3300020465 | Marine | VIKIPLAKGMGGIFFSKNQTTANAIRVATISGGIATDKFLSLL |
| Ga0211713_105202492 | 3300020467 | Marine | PPKNVIKTPPNSGTIGIFFSKNQTTTNDIIVAIIKGGIATFKSLLES |
| Ga0211577_104023521 | 3300020469 | Marine | PPKNVIKIPLTKGIGGIFFSNTQTMINAIIVATISGGIATDKFFSLL |
| Ga0211541_104009832 | 3300020475 | Marine | YIVNPPKNVINIPLNRGMGGIFFSKNQTTPNAIKVATISGGIATDKFLSLL |
| Ga0181557_12291891 | 3300020601 | Salt Marsh | KVIKIPLTKGIGGIFFSNTQTTISAIIVAIINGGIATDKFLSLL |
| Ga0206678_103162982 | 3300021084 | Seawater | GIIGIFFSKNQTTANAIKVATISGGMATDKFLSLL |
| Ga0206682_102190891 | 3300021185 | Seawater | KNVINIPLINGIIGIFFSKNQTTVNAINVATISGGIATDKFLSLL |
| Ga0213859_102025051 | 3300021364 | Seawater | GIIGIFFSKNQTTVNAIKVATISGGIATDKFLSLL |
| Ga0213860_102658432 | 3300021368 | Seawater | IVRTQKKVIKIPLNKGIGGIFFSKNQTTANAIIVATIKGGIATDKFFPLL |
| Ga0222717_104866361 | 3300021957 | Estuarine Water | PKNVIKIPLNKGIIGIFFSKTQTSNNAINVATMSGGIAIDKFLSLL |
| Ga0222718_100433266 | 3300021958 | Estuarine Water | RPPKNVIKIPLKRGIGGIFFSKNQTTPKAIKVATISGGIATAKFLSLL |
| Ga0222715_106860732 | 3300021960 | Estuarine Water | LKYIVSPPKKVIKIPLTKGIGGIFFSITQTTANAIIVAIINGGIATDKFLSLL |
| Ga0222713_101700461 | 3300021962 | Estuarine Water | PLINGIGGIFFSKNQTTAKATKVATISGGIATDKFLSLL |
| Ga0255775_13095392 | 3300022907 | Salt Marsh | KKVIKIPLNKGIGGIFFSKNQTTANAIIVATIKGGIATDKFFPLL |
| Ga0255758_103418342 | 3300022928 | Salt Marsh | RIPLNKGIGGIFFSKNQTTINATIVATIKGGIATDKFFPLL |
| (restricted) Ga0233427_101370621 | 3300022933 | Seawater | NPPKNVIRIPLISGIIGIFFSKNQTTANATKVATISGGIAIDKFLSLL |
| Ga0255781_104593312 | 3300022934 | Salt Marsh | MVKPPKNVINIPLINGIGGIFFSKNQTTAKATKVATISGGIATDKFLSLL |
| Ga0255781_104617062 | 3300022934 | Salt Marsh | IVRPPKKVIKIPLNKGIGGIFFSKNQTTANAIIVATIKGGIATDKFFPLL |
| Ga0255764_102809963 | 3300023081 | Salt Marsh | KGIGGIFFSNTQTTISAIIVAIINGGIATDKFLSLL |
| Ga0255768_101840713 | 3300023180 | Salt Marsh | PKKVIKIPLNKGIGGIFFSKNQTTANAIIVATIKGGIATDKFFPLL |
| Ga0228666_10814091 | 3300024221 | Seawater | VINIPLINGIIGIFFSKNQTTVNAINVATISGGIATDKFLSLL |
| Ga0228665_10160023 | 3300024235 | Seawater | LINGIGGIFFSKNQTTAKATKVATISGGIATDKFLSLL |
| Ga0228653_11027472 | 3300024237 | Seawater | KNVIKIPLTSGMVGIFFSKNQTTTSAIKVATISGGIATDKFLSLL |
| (restricted) Ga0233436_11026093 | 3300024243 | Seawater | NGIIGIFFSKNQTTANAIKVATISGGMATDKFLSLL |
| (restricted) Ga0233435_10725143 | 3300024252 | Seawater | NVIKIPLINGIIGIFFSKNQTMANATKVATISGGIATDKFFPLL |
| (restricted) Ga0233444_102894021 | 3300024264 | Seawater | PPKNVIKIPLINGIIGIFFSKNQTITNAIKVATISGGIATDKFFSLL |
| Ga0228626_10511103 | 3300024321 | Seawater | VSPPKNVIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFPLL |
| Ga0228635_10445833 | 3300024328 | Seawater | VIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFPLL |
| Ga0228671_10592763 | 3300024334 | Seawater | NVIKTPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL |
| Ga0233396_10464921 | 3300024428 | Seawater | GIIGIFFSKNQTIANAIKVATISGGIATDKFFPLL |
| Ga0209662_10151991 | 3300025596 | Marine | IPLIKGIIGIFFSKNQTTANAIKVATISGGMATDKFLLLL |
| Ga0209151_10813981 | 3300025643 | Marine | PKNVIKIPLTKGMVGIFFSKNQTTTSAIKVATISGGIAIDKFLSLL |
| Ga0208428_10400201 | 3300025653 | Aqueous | RGIGGIFFSKNQTTPKAIKVATISGGIATAKFLSLL |
| Ga0209054_10577751 | 3300025656 | Marine | NGIIGIFFSKNQTTPNAIKVATISGGMATDKFLSLL |
| Ga0209362_10299476 | 3300025770 | Marine | NVIKIPLINGIMGIFFSKNQTTTNAIKVATISGGIATDKFLSLL |
| Ga0208130_10054571 | 3300026258 | Marine | VNPPKKVIKIPLTKGIGGIFFSKNQTTANATKVATISGGIATDKFLPLL |
| Ga0208764_101074793 | 3300026321 | Marine | KNVIKIPLINGIIGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0228647_10256771 | 3300026505 | Seawater | NVIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL |
| Ga0208170_10517931 | 3300027234 | Estuarine | LIKGIIGIFFSKNQTTANATKVATISGGIATDKFLSLL |
| Ga0208973_10245375 | 3300027506 | Marine | GIGGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0209036_10499632 | 3300027702 | Marine | MLRPPKKVIKIPLTKGIGGIFFSKNHTTANAIRVATMSGGIAIDKFLSLL |
| Ga0209830_101637823 | 3300027791 | Marine | IKGMVGIFFSKNQTTVNAIKVATISGGIATDKFLSLL |
| Ga0209404_108406302 | 3300027906 | Marine | NPPKKVIKIPLIRGILGIFFSKNQITANAITVTIMKGGIATFKFFPLS |
| Ga0228645_11339901 | 3300028128 | Seawater | KNVIKTPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL |
| Ga0257106_10479174 | 3300028194 | Marine | KKVINIPLINGIIGIFLSKNQTTTNAIKVATISGGIATDKFLSLL |
| Ga0257106_10688561 | 3300028194 | Marine | NGIIGIFLSKNQTTTSAIKVATISGGIATDKFLSLL |
| Ga0257106_10924471 | 3300028194 | Marine | KGIMGIFFSKTQTIANATRVATISGGMATDKFLSLL |
| Ga0257121_11655442 | 3300028198 | Marine | NIPLTNGIIGIFFSKNQTSVNAIRVATISGGIATDKFLSLL |
| Ga0257116_10033991 | 3300028277 | Marine | NGIIGIFFSKNQTTANAIKVATISGGMATDKFLLLL |
| Ga0233394_10502023 | 3300028391 | Seawater | GIIGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0228627_10493543 | 3300028414 | Seawater | IPLINGIGGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0228614_10452601 | 3300028416 | Seawater | LINGIIGIFFSKNQTIANAIKVATISGGIATDKFFPLL |
| Ga0257115_10780543 | 3300028706 | Marine | TPLTRGIVGIFFSKNQTTTSAIKVATISGGIATDKFLSLL |
| Ga0315322_105884691 | 3300031766 | Seawater | IVNPPKNVIKIPLTKGMVGIFFSKNQTTTSAIKVATISGGIATDKFLSLL |
| Ga0315326_106220121 | 3300031775 | Seawater | VIKIPLISGIIGIFFSKNQTTANAIKVATMSGGIATDKFLSLL |
| Ga0315326_108111112 | 3300031775 | Seawater | SGIIGIFFSKNQTTANAIKVATISGGIATDKFLSLL |
| Ga0315326_108890622 | 3300031775 | Seawater | LTKGMVGIFFSKNQTTTSAIKVATISGGIATDKFLSLL |
| Ga0310343_111734072 | 3300031785 | Seawater | IPLTKGIGGIFFSKNQTIANATKVATISGGIATDKFLPLL |
| Ga0315320_105358662 | 3300031851 | Seawater | KGMAGIFFSKNQTTPNAIKVATMSGGIATDKFLSLL |
| Ga0315316_108809243 | 3300032011 | Seawater | LNNGIFGIFFSKNQTTASAIKVATISGGIATDKFLSLL |
| Ga0315327_102073063 | 3300032032 | Seawater | KNVIKIPLINGIIGIFFSKNQTIANAIKVATISGGIATDKFFSLL |
| Ga0315330_100978401 | 3300032047 | Seawater | IPLTNGIVGIFFSKNQTTAKAIRVATISGGIATDKFLSLL |
| Ga0315321_107323871 | 3300032088 | Seawater | KLINIPLTNGIIGIFFSKNQTSVNAIRVATISGGIATDKFLSLL |
| ⦗Top⦘ |