| Basic Information | |
|---|---|
| Family ID | F075831 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTVALVLAGEADAGLCGQLAALGVRRVDVAERTGPGLLTVAA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 94.92 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.017 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.271 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.881 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.237 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01128 | IspD | 57.63 |
| PF12804 | NTP_transf_3 | 6.78 |
| PF00202 | Aminotran_3 | 4.24 |
| PF03006 | HlyIII | 4.24 |
| PF13466 | STAS_2 | 4.24 |
| PF01740 | STAS | 1.69 |
| PF13560 | HTH_31 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 57.63 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 57.63 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 57.63 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 57.63 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 4.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.02 % |
| All Organisms | root | All Organisms | 38.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01D1RJO | Not Available | 516 | Open in IMG/M |
| 3300001593|JGI12635J15846_10211196 | Not Available | 1275 | Open in IMG/M |
| 3300001632|JGI20235J16296_1004800 | Not Available | 654 | Open in IMG/M |
| 3300003218|JGI26339J46600_10162400 | Not Available | 515 | Open in IMG/M |
| 3300005165|Ga0066869_10130122 | Not Available | 529 | Open in IMG/M |
| 3300005363|Ga0008090_15278154 | Not Available | 718 | Open in IMG/M |
| 3300005434|Ga0070709_10887040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300005435|Ga0070714_102487180 | Not Available | 503 | Open in IMG/M |
| 3300005537|Ga0070730_10150363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1580 | Open in IMG/M |
| 3300005537|Ga0070730_11068737 | Not Available | 501 | Open in IMG/M |
| 3300005576|Ga0066708_10150895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1428 | Open in IMG/M |
| 3300005591|Ga0070761_10679788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300005610|Ga0070763_10284669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300005610|Ga0070763_10884310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300005840|Ga0068870_10377346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300006034|Ga0066656_10728649 | Not Available | 636 | Open in IMG/M |
| 3300006806|Ga0079220_10687334 | Not Available | 749 | Open in IMG/M |
| 3300006881|Ga0068865_101694316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria kofuensis | 570 | Open in IMG/M |
| 3300006953|Ga0074063_13666202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria kofuensis | 920 | Open in IMG/M |
| 3300009088|Ga0099830_10888912 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 736 | Open in IMG/M |
| 3300009523|Ga0116221_1407567 | Not Available | 592 | Open in IMG/M |
| 3300009524|Ga0116225_1280836 | Not Available | 745 | Open in IMG/M |
| 3300009824|Ga0116219_10514914 | Not Available | 661 | Open in IMG/M |
| 3300010366|Ga0126379_11926203 | Not Available | 694 | Open in IMG/M |
| 3300010876|Ga0126361_10880092 | Not Available | 1343 | Open in IMG/M |
| 3300010880|Ga0126350_11031104 | Not Available | 642 | Open in IMG/M |
| 3300011107|Ga0151490_1130858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria kofuensis | 1073 | Open in IMG/M |
| 3300012355|Ga0137369_10855273 | Not Available | 615 | Open in IMG/M |
| 3300012513|Ga0157326_1014625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 915 | Open in IMG/M |
| 3300012975|Ga0134110_10145141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria kofuensis | 978 | Open in IMG/M |
| 3300012984|Ga0164309_10209356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300014487|Ga0182000_10580200 | Not Available | 537 | Open in IMG/M |
| 3300014499|Ga0182012_10719109 | Not Available | 636 | Open in IMG/M |
| 3300014654|Ga0181525_10683084 | Not Available | 575 | Open in IMG/M |
| 3300016357|Ga0182032_10787020 | Not Available | 803 | Open in IMG/M |
| 3300016404|Ga0182037_11273338 | Not Available | 648 | Open in IMG/M |
| 3300017822|Ga0187802_10261559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300017937|Ga0187809_10037843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
| 3300017974|Ga0187777_11186377 | Not Available | 558 | Open in IMG/M |
| 3300017994|Ga0187822_10179206 | Not Available | 696 | Open in IMG/M |
| 3300018001|Ga0187815_10144384 | Not Available | 1006 | Open in IMG/M |
| 3300018047|Ga0187859_10439383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus chilensis | 720 | Open in IMG/M |
| 3300018062|Ga0187784_10083511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2596 | Open in IMG/M |
| 3300019787|Ga0182031_1353173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1538 | Open in IMG/M |
| 3300019789|Ga0137408_1477899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2815 | Open in IMG/M |
| 3300020062|Ga0193724_1126160 | Not Available | 503 | Open in IMG/M |
| 3300021180|Ga0210396_10561860 | Not Available | 994 | Open in IMG/M |
| 3300021180|Ga0210396_10877464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
| 3300021401|Ga0210393_10107015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2229 | Open in IMG/M |
| 3300021403|Ga0210397_10073223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2251 | Open in IMG/M |
| 3300021405|Ga0210387_11004192 | Not Available | 731 | Open in IMG/M |
| 3300021407|Ga0210383_10984771 | Not Available | 716 | Open in IMG/M |
| 3300021474|Ga0210390_11030039 | Not Available | 671 | Open in IMG/M |
| 3300021478|Ga0210402_11201886 | Not Available | 685 | Open in IMG/M |
| 3300024219|Ga0247665_1064455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300025634|Ga0208589_1087282 | Not Available | 745 | Open in IMG/M |
| 3300025899|Ga0207642_10197733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300025905|Ga0207685_10528233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria kofuensis | 625 | Open in IMG/M |
| 3300025916|Ga0207663_11736611 | Not Available | 502 | Open in IMG/M |
| 3300026035|Ga0207703_10940567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300026377|Ga0257171_1072365 | Not Available | 605 | Open in IMG/M |
| 3300026998|Ga0208369_1022669 | Not Available | 612 | Open in IMG/M |
| 3300026999|Ga0207949_1014128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300027119|Ga0209522_1004231 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300027158|Ga0208725_1059249 | Not Available | 568 | Open in IMG/M |
| 3300027172|Ga0208098_1016995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300027497|Ga0208199_1126159 | Not Available | 523 | Open in IMG/M |
| 3300027576|Ga0209003_1097261 | Not Available | 554 | Open in IMG/M |
| 3300027684|Ga0209626_1212013 | Not Available | 513 | Open in IMG/M |
| 3300027725|Ga0209178_1129464 | Not Available | 860 | Open in IMG/M |
| 3300027855|Ga0209693_10206994 | Not Available | 965 | Open in IMG/M |
| 3300027867|Ga0209167_10055650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
| 3300027889|Ga0209380_10591013 | Not Available | 643 | Open in IMG/M |
| 3300028742|Ga0302220_10128548 | Not Available | 977 | Open in IMG/M |
| 3300028773|Ga0302234_10239406 | Not Available | 782 | Open in IMG/M |
| 3300028789|Ga0302232_10092025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1558 | Open in IMG/M |
| 3300028879|Ga0302229_10035612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2578 | Open in IMG/M |
| 3300029882|Ga0311368_10167616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1775 | Open in IMG/M |
| 3300029943|Ga0311340_10488833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1104 | Open in IMG/M |
| 3300030013|Ga0302178_10202630 | Not Available | 954 | Open in IMG/M |
| 3300030399|Ga0311353_11597874 | Not Available | 526 | Open in IMG/M |
| 3300031028|Ga0302180_10220159 | Not Available | 1011 | Open in IMG/M |
| 3300031234|Ga0302325_11271273 | Not Available | 971 | Open in IMG/M |
| 3300031549|Ga0318571_10118493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 886 | Open in IMG/M |
| 3300031564|Ga0318573_10296272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300031572|Ga0318515_10234000 | Not Available | 985 | Open in IMG/M |
| 3300031640|Ga0318555_10041905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2286 | Open in IMG/M |
| 3300031640|Ga0318555_10532357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300031718|Ga0307474_11067857 | Not Available | 639 | Open in IMG/M |
| 3300031724|Ga0318500_10297660 | Not Available | 790 | Open in IMG/M |
| 3300031724|Ga0318500_10435337 | Not Available | 655 | Open in IMG/M |
| 3300031724|Ga0318500_10547993 | Not Available | 584 | Open in IMG/M |
| 3300031747|Ga0318502_10330229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 900 | Open in IMG/M |
| 3300031765|Ga0318554_10292123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300031770|Ga0318521_10960159 | Not Available | 523 | Open in IMG/M |
| 3300031805|Ga0318497_10577266 | Not Available | 630 | Open in IMG/M |
| 3300031835|Ga0318517_10491095 | Not Available | 553 | Open in IMG/M |
| 3300031846|Ga0318512_10224862 | Not Available | 922 | Open in IMG/M |
| 3300031860|Ga0318495_10365290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300031860|Ga0318495_10455952 | Not Available | 560 | Open in IMG/M |
| 3300031890|Ga0306925_10612198 | Not Available | 1149 | Open in IMG/M |
| 3300031890|Ga0306925_11899060 | Not Available | 566 | Open in IMG/M |
| 3300031954|Ga0306926_11428173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 802 | Open in IMG/M |
| 3300032008|Ga0318562_10545141 | Not Available | 671 | Open in IMG/M |
| 3300032009|Ga0318563_10393455 | Not Available | 750 | Open in IMG/M |
| 3300032025|Ga0318507_10294996 | Not Available | 705 | Open in IMG/M |
| 3300032066|Ga0318514_10419659 | Not Available | 710 | Open in IMG/M |
| 3300032074|Ga0308173_10526600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1062 | Open in IMG/M |
| 3300032090|Ga0318518_10145024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
| 3300032160|Ga0311301_12709295 | Not Available | 545 | Open in IMG/M |
| 3300032261|Ga0306920_102606385 | Not Available | 693 | Open in IMG/M |
| 3300032782|Ga0335082_11252018 | Not Available | 610 | Open in IMG/M |
| 3300032805|Ga0335078_12391664 | Not Available | 549 | Open in IMG/M |
| 3300032892|Ga0335081_11492820 | Not Available | 749 | Open in IMG/M |
| 3300032897|Ga0335071_10747587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300032954|Ga0335083_11113464 | Not Available | 616 | Open in IMG/M |
| 3300033158|Ga0335077_10795754 | Not Available | 963 | Open in IMG/M |
| 3300034124|Ga0370483_0167847 | Not Available | 741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_06746440 | 2189573000 | Grass Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAERTGPGLLTVAAAAR |
| JGI12635J15846_102111961 | 3300001593 | Forest Soil | MTVALVLATQPDAGLRGQLAALGVRRVDAAERAGPGLLT |
| JGI20235J16296_10048001 | 3300001632 | Forest Soil | MTVALVLATEADAGLRIQLAALGVRKVDAAERAGPGLLTIAATARAVAERV |
| JGI26339J46600_101624001 | 3300003218 | Bog Forest Soil | MTVALVLAGVADAGLCGQLAALGVRRVDAAEWTGPGLLTV |
| Ga0066869_101301221 | 3300005165 | Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAYRTGPGLLTVAAAAR |
| Ga0008090_152781542 | 3300005363 | Tropical Rainforest Soil | MTVALVLAGRADAGLCGQLAALGVRRVDVAERTGPGLLTVAAAARSA |
| Ga0070709_108870401 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVALVLAAEADASMCGQLAALGVRRVDLAGAGRGRDYGSGLLTVAAAARVA |
| Ga0070714_1024871802 | 3300005435 | Agricultural Soil | MTVALVLAGNLDEADEGLCGRLAALGVHRVDAAERTGPGLLTVAAAAR |
| Ga0070730_101503633 | 3300005537 | Surface Soil | MTVALVLATEADASMCGQLAALGVRRVDLAGTGAADDGGQGLLTVAA |
| Ga0070730_110687372 | 3300005537 | Surface Soil | MTVALVLAGQPDAGQPASQPDAKLRDQLAALGVRRVDAAG |
| Ga0066708_101508953 | 3300005576 | Soil | MTVALVLAGEADAGFCGQLAALGVRRVDVAERTGPGLLTVAAA |
| Ga0070761_106797881 | 3300005591 | Soil | LTVALVLAAEADASMWGQLAALGVRRVDLAGAGPFGPGLL |
| Ga0070763_102846691 | 3300005610 | Soil | MTVALVLAGNLDEADAGLCGQLAALGVRRVDAAGQTGPGL |
| Ga0070763_108843103 | 3300005610 | Soil | MTVALVLVGNRDEADAGLCGQLAALGVRRVDAAERTGPGLLTVAAAA |
| Ga0068870_103773463 | 3300005840 | Miscanthus Rhizosphere | MTVALVLAGNLGEDDAGQQQMLCGQLAALGVRRVDAAERTG |
| Ga0066656_107286491 | 3300006034 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAERTGPGLLTVAA |
| Ga0079220_106873342 | 3300006806 | Agricultural Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAEGTGLGLLTVGAAAR |
| Ga0068865_1016943161 | 3300006881 | Miscanthus Rhizosphere | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDA |
| Ga0074063_136662021 | 3300006953 | Soil | MTVALVLAVNLGDDDAGQQQQMLCGQLAALGVRRVD |
| Ga0099830_108889121 | 3300009088 | Vadose Zone Soil | MTVALVLAGNPGEADAGLCGQLAALGVRRVDAAERTGHGLLTVAAAARA |
| Ga0116221_14075672 | 3300009523 | Peatlands Soil | MTVALVLAGNLDEADAGLCGQLAALGVRRVDVAERT |
| Ga0116225_12808361 | 3300009524 | Peatlands Soil | MTVALVLAGNPGEADAGLCGQLAALGVRRIDVAERTGPGL |
| Ga0116219_105149141 | 3300009824 | Peatlands Soil | MTVALVLAGNPGEADAGLCGQLAALGVRRIDVAERTGP |
| Ga0126379_119262032 | 3300010366 | Tropical Forest Soil | MTVALVLAARPDAGLRGQLAALGVRRVGAAEQAGPGLLAVTAEARV |
| Ga0126361_108800921 | 3300010876 | Boreal Forest Soil | MTVALVLAGKGDEADAGLCGQLAALGVRRVDAAERT |
| Ga0126350_110311041 | 3300010880 | Boreal Forest Soil | MTVALVLAAQPAAGQPDAKLRGQLAALGVRRVDAAERAGPGVL |
| Ga0151490_11308583 | 3300011107 | Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAER |
| Ga0137369_108552731 | 3300012355 | Vadose Zone Soil | MTVALVLAGNLGEDDAGEQQQMLCGQLAALGVRRVDAAERTGPGL |
| Ga0157326_10146251 | 3300012513 | Arabidopsis Rhizosphere | MTVALVLAGNLGEDDAGQQQLLCGQLAALGVRRVDAAERTGPGLLTVAA |
| Ga0134110_101451412 | 3300012975 | Grasslands Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAA* |
| Ga0164309_102093563 | 3300012984 | Soil | MTVALVLAGEAEAGPRNQLCGQLAALGVRRVDAAE |
| Ga0182000_105802001 | 3300014487 | Soil | MTVALVLAGEADAGQQQQMLCGQLAALGVRRVDAAERTG |
| Ga0182012_107191091 | 3300014499 | Bog | MTVALVLAGGADARLRGQLAALGVRRVDAADRTGPGLLTIAAAARAAGE |
| Ga0181525_106830842 | 3300014654 | Bog | MTVALVLASQPDAGLRGQLAALGVRRVDAAERAGAGLLTVVAAAR |
| Ga0182032_107870201 | 3300016357 | Soil | MTVALVLAGKADTGLCGQLAALGVRRVDVAEQTGPGMLTVAAAART |
| Ga0182037_112733382 | 3300016404 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPGLLTVA |
| Ga0187802_102615591 | 3300017822 | Freshwater Sediment | MTVALVLAAEADAGLRGQLTALGVRRVDAAEPAGPGLLTVATA |
| Ga0187809_100378433 | 3300017937 | Freshwater Sediment | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERTGPGLLTVAAAAR |
| Ga0187777_111863771 | 3300017974 | Tropical Peatland | MTVALVLAGSPDEADAGLCGQLAALGVRRVDAAERTGPGLLTVAA |
| Ga0187822_101792062 | 3300017994 | Freshwater Sediment | MTVALVLAAQPDAGLRGQLTALGVRRIDAAERAGPGLLTVAAAARAA |
| Ga0187815_101443842 | 3300018001 | Freshwater Sediment | MTVALVLAAEADAGLRGQLTALGVRRVDAAEQAGPGLLTVATA |
| Ga0187859_104393831 | 3300018047 | Peatland | MTVALVLVGEADAGLCGQLAALGVRRVDAAEWTGPGLLT |
| Ga0187784_100835111 | 3300018062 | Tropical Peatland | MTVALVLADEADAGLRGRLAALGVQRVDATERTGPGLLAV |
| Ga0182031_13531734 | 3300019787 | Bog | MTVALVLAGEADGGLCGQLEALGVRRVDTADRTGPG |
| Ga0137408_14778997 | 3300019789 | Vadose Zone Soil | MTVALVLAAQPDAGLRGQLAALGVRRVDAAERAGPGLLT |
| Ga0193724_11261602 | 3300020062 | Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRV |
| Ga0210396_105618601 | 3300021180 | Soil | MTVALVLAGQPDAGLRGQLAALGVRQVDAAERAGPGLLTVAAA |
| Ga0210396_108774642 | 3300021180 | Soil | MTVALVLAGNLDEADAGLCGQLAALGVRRVDAAGQT |
| Ga0210393_101070151 | 3300021401 | Soil | MTVALVLAGQPDAGLRGQLAALGVRQVDAADRAGPGLLTVAAAARA |
| Ga0210397_100732234 | 3300021403 | Soil | MTVALVLAGNLDDAAAGLCGQLAALGVRRVDAAEQTGPGLLTVA |
| Ga0210387_110041921 | 3300021405 | Soil | MTVALVLAAQADAGLCGQLAALGVRRIDAADRGGPGLLTIAAAAR |
| Ga0210383_109847711 | 3300021407 | Soil | MTVALILAGQADAGLRGQLTALGVRRVDATDRAGPALLSVAAAAQV |
| Ga0210390_110300392 | 3300021474 | Soil | MTVALILAGQADAGLRGQLTALGVRRVDATDRAGPALLSVAAAAQVAGE |
| Ga0210402_112018861 | 3300021478 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAEGTGLGLLTVAAAA |
| Ga0247665_10644551 | 3300024219 | Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERTGPGLLTVAAAA |
| Ga0208589_10872821 | 3300025634 | Arctic Peat Soil | MTVALVLAGEADAGLRGQLAALGVRRVDVADRTGPGLLTVAAA |
| Ga0207642_101977331 | 3300025899 | Miscanthus Rhizosphere | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERT |
| Ga0207685_105282332 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERTGLGLLT |
| Ga0207663_117366111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVALVLAAQADAGLCGQLAALDVRRIDAADRGGPGLLAVAEAAQ |
| Ga0207703_109405671 | 3300026035 | Switchgrass Rhizosphere | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERTGLG |
| Ga0257171_10723651 | 3300026377 | Soil | MTIALVLAGEADAGQQQQMLCGQLAALGVRRVDVAERTGPGLL |
| Ga0208369_10226692 | 3300026998 | Forest Soil | MTVALVLAAQPDAGLRGQLAALGVRRVDAAERAGPGLLTVAAAAR |
| Ga0207949_10141281 | 3300026999 | Forest Soil | MTVALVLAAQPDAGLRGQLAALGVRRVDAAERAGPGLLTVAAAA |
| Ga0209522_10042313 | 3300027119 | Forest Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEGTGPGLLTVAAAA |
| Ga0208725_10592491 | 3300027158 | Forest Soil | MTVALVLAAQPDAGLRGQLAALGVRRVDAAERAGAGLLTVV |
| Ga0208098_10169951 | 3300027172 | Forest Soil | MTVALVLAGQPDAGLRGQLAALGVRRVDAAEHAGPSLLTV |
| Ga0208199_11261591 | 3300027497 | Peatlands Soil | MTVALVLVGEADAGLCGQLAALGVRRVDAAEWTGPG |
| Ga0209003_10972611 | 3300027576 | Forest Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEGTGP |
| Ga0209626_12120131 | 3300027684 | Forest Soil | MTVALVLAAQPDAGQDAKLRGQLAALGVRRVDAAERA |
| Ga0209178_11294642 | 3300027725 | Agricultural Soil | MTVALVLAGEADAGFCGQLAALGVRRVDVAERTGPGLLTVA |
| Ga0209693_102069941 | 3300027855 | Soil | MTVALVLAAEADAGLRVQLAALGVRRVDAAERAGPGLLTVAATA |
| Ga0209167_100556501 | 3300027867 | Surface Soil | MTVALILADRADAGLRGQLTALGVRRVDTTDRAGPALLS |
| Ga0209380_105910133 | 3300027889 | Soil | MTVALVLVGNRDEADAGLCGQLAALGVRRVDAAERTGPGLLTV |
| Ga0302220_101285482 | 3300028742 | Palsa | MTVALVLSGGADAGLRGQLAALGVRRVDAADRTGPGLL |
| Ga0302234_102394062 | 3300028773 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPG |
| Ga0302232_100920251 | 3300028789 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPGLLTIAAA |
| Ga0302229_100356121 | 3300028879 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPGLLTI |
| Ga0311368_101676163 | 3300029882 | Palsa | MTVALVLAAQPDAGLRGQLAALGVRRVDAAERAGPGLLTVVAAARAAR |
| Ga0311340_104888331 | 3300029943 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPGLLTVA |
| Ga0302178_102026302 | 3300030013 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPGLLTIAA |
| Ga0311353_115978741 | 3300030399 | Palsa | MTVALVLAGEADAGLCGQLAALGVRRVDAADRTGPGL |
| Ga0302180_102201591 | 3300031028 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRTGPGL |
| Ga0302325_112712732 | 3300031234 | Palsa | MTVALVLAGGADAGLRGQLAALGVRRVDAADRAGPGLLTVA |
| Ga0318571_101184932 | 3300031549 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEG |
| Ga0318573_102962722 | 3300031564 | Soil | MTVALVLAARPDAGLRGQLAALGVRRVDAAERTGPG |
| Ga0318515_102340001 | 3300031572 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAGPTGPGL |
| Ga0318555_100419051 | 3300031640 | Soil | MTVALVLAARPDAVLRGQLDALGVRRVDAAERAGPGLLTVA |
| Ga0318555_105323572 | 3300031640 | Soil | MTVALVLADEADAGLRGQLAALGVHQVGAAERTGPGL |
| Ga0307474_110678571 | 3300031718 | Hardwood Forest Soil | MTVALVLAGEADAGFCGQLAALGVRRVDVAERTGP |
| Ga0318500_102976602 | 3300031724 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPGLLT |
| Ga0318500_104353371 | 3300031724 | Soil | MTVALVLAGEADAGLRGQLAALGVRRIDAAPGSDGSGPGLLT |
| Ga0318500_105479932 | 3300031724 | Soil | MTVALVLAARPDAGLRGQLAALGVRRVDAAERDGPGLLTDADEHA |
| Ga0318502_103302291 | 3300031747 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPGLLTVAAAA |
| Ga0318554_102921231 | 3300031765 | Soil | MTVALVLAAQPDAGLRGQLTALGVRRVDAAEQAGPGLLAVVAAARTA |
| Ga0318521_109601592 | 3300031770 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPGLLTVAAAARA |
| Ga0318497_105772662 | 3300031805 | Soil | MTVALVLAARPDAGLRGQLAALGVRRVDAAERSGP |
| Ga0318517_104910952 | 3300031835 | Soil | MTVALVLAGKADTGLCGQLAALGVRRVDVAEQTGPGMLTVAAAARTAGE |
| Ga0318512_102248622 | 3300031846 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPG |
| Ga0318495_103652902 | 3300031860 | Soil | MTVALVLADEADAGLRGRLAALGVHRVDAAERTGPGLL |
| Ga0318495_104559522 | 3300031860 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAGPTGPG |
| Ga0306925_106121981 | 3300031890 | Soil | MTVALVLAANLDEADAGLCGQLAALGVRRVDAAEQT |
| Ga0306925_118990602 | 3300031890 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEGTEGAGP |
| Ga0306926_114281731 | 3300031954 | Soil | MTVALVLAARPDAGLRGQLAALGVRQVDAAERTGPGLL |
| Ga0318562_105451412 | 3300032008 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEGTDG |
| Ga0318563_103934552 | 3300032009 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVASRHEGTEGAGPGL |
| Ga0318507_102949962 | 3300032025 | Soil | MTVALVLAANLDEADTGLCGQLAALGVRRVDAAEQT |
| Ga0318514_104196591 | 3300032066 | Soil | MTVALVLAANLDEADAGLCGQLAALGVRRVDAAEQ |
| Ga0308173_105266001 | 3300032074 | Soil | MTVALVLAGNLGEDDAGQQQQMLCGQLAALGVRRVDAAERTGPGLL |
| Ga0318518_101450241 | 3300032090 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAGPTGPGLLTVAAAARTAGE |
| Ga0311301_127092951 | 3300032160 | Peatlands Soil | MTVALVLAAEADAGLRGQLAALGVGRVDAAGQTGPGLLTIAA |
| Ga0306920_1026063851 | 3300032261 | Soil | MTVALVLASEANAGLCGQLAALGVRRVDVAEGTGLGLLTVAAAARTA |
| Ga0335082_112520181 | 3300032782 | Soil | MTVALVLAGEADAGPHNQLCGQLAALGVRRVDAAERTGPGLLAV |
| Ga0335078_123916642 | 3300032805 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAERTGPG |
| Ga0335081_114928201 | 3300032892 | Soil | MTVALVLAAEADAGLRVQLAALGVRQVDAAERAGPGLLT |
| Ga0335071_107475872 | 3300032897 | Soil | MTVALVLAANPAETDVGLCGQLAALGVRRVDAAERTGPGLLTVAAA |
| Ga0335083_111134641 | 3300032954 | Soil | MTVALVLAANLGEADAGLCDQLAALGVRRVDAAERTG |
| Ga0335077_107957542 | 3300033158 | Soil | MTVALVLAGEADAGLCGQLAALGVRRVDVAGPTGPGLLTV |
| Ga0370483_0167847_1_138 | 3300034124 | Untreated Peat Soil | MTVALVLTGEAGAGLRGQLAALGVRRVDAANRTGPGLLTVAAAARA |
| ⦗Top⦘ |